Pkg.clone("https://github.com/zmactep/ProtParam.jl.git")
using ProtParam
rituximab = aa"QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWAGTTVTVSA"
protparam(rituximab)
ProtParam
Query protein sequence:
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAYPGNGDTSYN
QKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWAGTTVTVSA
Theoretical pI: 8.86279296875
Molecular weight: 12984.442140000005
Number of amino acids in protein: 119
Number of atoms in protein: 1781
Total number of negatively charged residues (Asp + Glu): 7
Total number of positively charged residues (Arg + Lys): 10
Extinction coefficient, assuming all pairs of Cys residues form cystines:
E: 37025
Abs: 2.8514894672248112
Extinction coefficient, assuming all Cys residues are reduced:
E: 36900
Abs: 2.841862561528576
Half-life:
Estimated half-life in mammalian reticulocytes, in vitro: 0.8 hour
Estimated half-life in yeast, in vivo: 10 min
Estimated half-life in Escherichia coli, in vivo: >10 hour
The instability index (II): 32.99495798319327
This classifies the protein as stable.
Aliphatic index of a protein: 51.68067226890756
Grand Average of Hydropathy (GRAVY): -0.4537815126050419
Amino acids composition:
A 11
C 2
D 4
E 3
F 3
G 12
H 1
I 1
K 8
L 6
M 3
N 4
P 4
Q 7
R 2
T 12
S 14
V 8
W 4
Y 10
Atoms composition:
O 181
H 866
C 579
N 150
S 5