-
Notifications
You must be signed in to change notification settings - Fork 1
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Add BLAST and QChem project templates.
- Loading branch information
Showing
8 changed files
with
218 additions
and
0 deletions.
There are no files selected for viewing
5 changes: 5 additions & 0 deletions
5
ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/manifest.yml
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,5 @@ | ||
--- | ||
id: mrnpex50 | ||
name: BLAST template | ||
description: This is a template for a project using BLAST software. | ||
icon: fas://syringe |
53 changes: 53 additions & 0 deletions
53
ondemand.osc.edu/apps/dashboard/projects/BLAST/.ondemand/scripts/uq2zwimz/form.yml
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,53 @@ | ||
--- | ||
title: Simple BLAST job | ||
created_at: 1707923522 | ||
form: | ||
- auto_accounts | ||
- auto_scripts | ||
- auto_batch_clusters | ||
attributes: | ||
auto_accounts: | ||
options: | ||
- - PZS1118 | ||
- PZS1118 | ||
- data-option-for-cluster-cardinal: false | ||
- - PZS0715 | ||
- PZS0715 | ||
- data-option-for-cluster-cardinal: false | ||
- - PZS0714 | ||
- PZS0714 | ||
- {} | ||
- - PZS1117 | ||
- PZS1117 | ||
- data-option-for-cluster-ascend: false | ||
data-option-for-cluster-cardinal: false | ||
- - PAS1604 | ||
- PAS1604 | ||
- data-option-for-cluster-ascend: false | ||
data-option-for-cluster-cardinal: false | ||
value: PZS0714 | ||
label: Account | ||
help: '' | ||
required: false | ||
auto_scripts: | ||
options: | ||
- - blast.sh | ||
- "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/lzdlglik/blast.sh" | ||
directory: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/lzdlglik" | ||
value: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/lzdlglik/blast.sh" | ||
label: Script | ||
help: '' | ||
required: false | ||
auto_batch_clusters: | ||
options: | ||
- ascend | ||
- cardinal | ||
- owens | ||
- pitzer | ||
value: owens | ||
exclude_options: | ||
- ascend | ||
fixed: true | ||
label: Cluster | ||
help: '' | ||
required: false |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,5 @@ | ||
>P01013 GENE X PROTEIN (OVALBUMIN-RELATED) | ||
QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE | ||
KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS | ||
VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP | ||
FLFLIKHNPTNTIVYFGRYWSP |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,30 @@ | ||
#!/bin/bash | ||
#SBATCH -J ondemand/sys/projects/basic_blast | ||
|
||
# A Basic BLAST Job | ||
# https://www.osc.edu/resources/available_software/software_list/blast | ||
|
||
# | ||
# The following lines set up the Blast environment | ||
# | ||
module load blast | ||
module load blast-database | ||
set -x | ||
|
||
# | ||
# Move to the directory where the job was submitted | ||
# | ||
cd $SLURM_SUBMIT_DIR | ||
mkdir $SLURM_JOBID | ||
cp 100.fasta $TMPDIR | ||
cd $TMPDIR | ||
|
||
# | ||
# Run Blast | ||
# | ||
/usr/bin/time tblastn -db nt -query 100.fasta -out test.out | ||
|
||
# | ||
# Now, copy data (or move) back once the simulation has completed | ||
# | ||
cp test.out $SLURM_SUBMIT_DIR/$SLURM_JOBID |
5 changes: 5 additions & 0 deletions
5
ondemand.osc.edu/apps/dashboard/projects/QCHEM/.ondemand/manifest.yml
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,5 @@ | ||
--- | ||
id: rndy3vti | ||
name: QChem template | ||
description: 'This is an example project using QChem software.' | ||
icon: fas://vial |
55 changes: 55 additions & 0 deletions
55
ondemand.osc.edu/apps/dashboard/projects/QCHEM/.ondemand/scripts/7c4d6ilx/form.yml
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,55 @@ | ||
--- | ||
title: Simple QChem job | ||
created_at: 1709137595 | ||
form: | ||
- auto_accounts | ||
- auto_scripts | ||
- auto_batch_clusters | ||
attributes: | ||
auto_accounts: | ||
options: | ||
- - PZS1118 | ||
- PZS1118 | ||
- data-option-for-cluster-cardinal: false | ||
- - PZS0715 | ||
- PZS0715 | ||
- data-option-for-cluster-cardinal: false | ||
- - PZS0714 | ||
- PZS0714 | ||
- {} | ||
- - PZS1117 | ||
- PZS1117 | ||
- data-option-for-cluster-ascend: false | ||
data-option-for-cluster-cardinal: false | ||
- - PAS1604 | ||
- PAS1604 | ||
- data-option-for-cluster-ascend: false | ||
data-option-for-cluster-cardinal: false | ||
value: PZS0714 | ||
label: Account | ||
help: '' | ||
required: false | ||
auto_scripts: | ||
options: | ||
- - qchem.sh | ||
- "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/hahsuaru/qchem.sh" | ||
directory: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/hahsuaru" | ||
value: "/users/PZS0714/johrstrom/ondemand/data/sys/dashboard/projects/hahsuaru/qchem.sh" | ||
label: Script | ||
help: '' | ||
required: false | ||
auto_batch_clusters: | ||
options: | ||
- ascend | ||
- cardinal | ||
- owens | ||
- pitzer | ||
value: owens | ||
exclude_options: | ||
- pitzer | ||
- cardinal | ||
- ascend | ||
fixed: true | ||
label: Cluster | ||
help: '' | ||
required: false |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,31 @@ | ||
#!/bin/bash | ||
|
||
# | ||
# This is a sample script for running a basic Q-Chem job. | ||
# The only thing you need to modify is 'sample' here | ||
# | ||
export INPUTFILENAME="sample" | ||
|
||
# | ||
# replace 'sample' with the actual name of your input file. | ||
# | ||
module load intel | ||
module load mvapich2 | ||
module load qchem | ||
|
||
# copy input file to $TMPDIR | ||
cp $INPUTFILENAME.inp $TMPDIR | ||
cd $TMPDIR | ||
|
||
# QChem guide at | ||
# http://www.q-chem.com/qchem-website/manual/qchem43_manual/sect-running.html | ||
# | ||
# Not all calculation types can be run in parallel with MPI. | ||
# | ||
# Temporary hack to get multinode jobs running - it is not yet | ||
# known whether multinode qchem requires a global filesystem. | ||
# setenv QCLOCALSCR $TMPDIR | ||
# export QCSCRATCH=$TMPDIR | ||
|
||
qchem -np $SLURM_NTASKS $INPUTFILENAME.inp | ||
ls -al |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,34 @@ | ||
$comment | ||
ethene | ||
$end | ||
|
||
$molecule | ||
0 1 | ||
C -2.3620772 0.9207308 0.2821606 | ||
C -1.0130626 0.5278664 -0.2865418 | ||
H -2.6220345 1.9481860 -0.0474867 | ||
H -3.1392310 0.2143160 -0.0767561 | ||
H -0.7529560 -0.4993875 0.0434971 | ||
H -0.2358785 1.2345592 0.0718086 | ||
$end | ||
|
||
$rem | ||
BASIS = 6-31G* | ||
EXCHANGE = HF | ||
GUI = 2 | ||
JOB_TYPE = Optimization | ||
PURECART = 2222 | ||
$end | ||
|
||
@@@ | ||
|
||
$molecule | ||
read | ||
$end | ||
|
||
$rem | ||
basis 6-31G* | ||
exchange hf | ||
molden_format true | ||
print_orbitals true | ||
$end |