From ae894a77eb8066fadd42e6da4a146c9d4d6dcbcc Mon Sep 17 00:00:00 2001 From: "github-actions[bot]" <41898282+github-actions[bot]@users.noreply.github.com> Date: Fri, 6 Dec 2024 21:33:14 +0000 Subject: [PATCH] Deploy to GitHub pages --- 001-trust-the-story.html | 2585 ++ 002-knowing-when-to-say-enough.html | 2581 ++ 003-master-the-beast.html | 2581 ++ 004-his-bow-in-the-clouds.html | 2593 ++ 005-misplaced-curse.html | 2587 ++ 006-a-tale-of-a-tower.html | 2591 ++ 007-the-preface.html | 2591 ++ 008-buried-in-a-geneology.html | 2582 ++ 009-letting-go.html | 2581 ++ 010-walking-the-blood-path.html | 2583 ++ 011-here-i-am.html | 2581 ++ 012-a-mission-realized.html | 2581 ++ 013-grappling-with-god-part-1.html | 2605 ++ 014-grappling-with-god-part-2.html | 2591 ++ 015-into-the-pit.html | 2589 ++ 016-out-of-the-pit.html | 2599 ++ 017-a-god-who-hears-the-cry.html | 2581 ++ 018-a-tale-of-two-kingdoms.html | 2584 ++ 019-a-strengthened-heart.html | 2584 ++ 020-with-all-your-heart.html | 2586 ++ 021-with-all-your-soul-very.html | 2589 ++ 022-under-the-chuppah.html | 2587 ++ 023-falling-on-joyful-faces.html | 2591 ++ 024-creating-a-space.html | 2583 ++ 025-a-kingdom-of-what.html | 2597 ++ 026-images-of-the-desert.html | 2593 ++ ...images-of-the-desert-rotem-and-acacia.html | 2597 ++ ...ages-of-the-desert-ar-ar-and-tamarisk.html | 2581 ++ 030-lead-with-your-voice.html | 2606 ++ ...e-hardest-story-in-the-bible-for-mary.html | 2604 ++ 035-crossroads-of-destiny.html | 2592 ++ 036-the-redemption-cycle.html | 2586 ++ 037-a-love-story.html | 2600 ++ 038-a-donkey-herder-to-lead-us.html | 2590 ++ 039-a-king-after-god-s-own-heart.html | 2587 ++ 040-one-story-two-sources.html | 2587 ++ 041-the-story-behind-the-story.html | 2594 ++ 042-the-fire-of-elijah.html | 2583 ++ 043-go-in-peace.html | 2588 ++ 044-our-harps-in-the-trees.html | 2602 ++ 074-silent-years-synagogue.html | 397 + 075-silent-years-welcome-to-hellenism.html | 506 + 076-silent-years-sadducees.html | 443 + 077-silent-years-herodians.html | 353 + 078-silent-years-essenes.html | 416 + 404.html | 238 + about.html | 260 + abraham-and-melchizedek.html | 520 + abstract-base-class.html | 383 + adblock-coverage.html | 341 + ...o-your-dataframes-html-representation.html | 492 + add-space-to-your-lvm-on-ubuntu.html | 373 + adding-docker-daemon-json-broke-docker.html | 333 + ...era-to-motioneye-on-home-assistant-os.html | 336 + advent-2024-peace.html | 360 + and-vs.html | 555 + append-string-to-list-of-files-with-xarg.html | 331 + archive-2022-1.html | 438 + archive-2022-10.html | 427 + archive-2022-11.html | 421 + archive-2022-12.html | 417 + archive-2022-13.html | 544 + archive-2022-14.html | 595 + archive-2022-15.html | 595 + archive-2022-16.html | 595 + archive-2022-17.html | 365 + archive-2022-2.html | 429 + archive-2022-3.html | 438 + archive-2022-4.html | 443 + archive-2022-5.html | 440 + archive-2022-6.html | 431 + archive-2022-7.html | 422 + archive-2022-8.html | 443 + archive-2022-9.html | 429 + archive-2022.html | 438 + archive-2022.json | 337 + archive-2022.rss | 689 + archive-2023-1.html | 425 + archive-2023-2.html | 239 + archive-2023.html | 425 + archive-2023.json | 249 + archive-2023.rss | 494 + archive-2024-1.html | 431 + archive-2024-2.html | 430 + archive-2024-3.html | 299 + archive-2024.html | 431 + archive-2024.json | 325 + archive-2024.rss | 263 + archive.html | 266 + arr-client-config.html | 343 + author-nicpayne-1.html | 456 + author-nicpayne-10.html | 447 + author-nicpayne-11.html | 450 + author-nicpayne-12.html | 470 + author-nicpayne-13.html | 445 + author-nicpayne-14.html | 456 + author-nicpayne-15.html | 444 + author-nicpayne-16.html | 479 + author-nicpayne-17.html | 620 + author-nicpayne-18.html | 620 + author-nicpayne-19.html | 620 + author-nicpayne-2.html | 455 + author-nicpayne-20.html | 580 + author-nicpayne-3.html | 449 + author-nicpayne-4.html | 463 + author-nicpayne-5.html | 465 + author-nicpayne-6.html | 456 + author-nicpayne-7.html | 465 + author-nicpayne-8.html | 476 + author-nicpayne-9.html | 458 + author-nicpayne.html | 456 + author-nicpayne.json | 325 + author-nicpayne.rss | 263 + authors.html | 211 + benchmark-your-disks-with-fio.html | 406 + bp-the-golden-rule.html | 362 + ...to-get-python-log-messages-in-ipython.html | 373 + caps-lock-polybar.html | 341 + case-insensitive-search-in-vim.html | 335 + chaos-dragon.html | 375 + chara-joy.html | 514 + cheat-on-your-man.html | 414 + check-your-bios-version-on-ubuntu.html | 337 + check-your-smart-status-with-smartctl.html | 386 + ...-network-on-ubuntu-22-04-with-netplan.html | 337 + ...-doc-to-pdf-with-headless-libreoffice.html | 340 + cron-for-nextcloud-in-docker.html | 369 + customize-k9s.html | 356 + dataframe-memory-usage.html | 357 + dataframe-to-markdown.html | 388 + dataframe-to-styled-html.html | 381 + ...om-ubuntu-might-not-do-what-you-think.html | 333 + deques.html | 385 + ...tion-of-my-proposed-vimconf-2022-talk.html | 368 + destroying-tmux-sessions-with-fzf.html | 355 + ...o-save-ubuntu-22-04-server-networking.html | 335 + dns-broke-after-reboot-ubuntu-22-04.html | 345 + docker-copy-and-chown.html | 336 + docker-remote-add.html | 340 + don-t-forget-to-load-xmp.html | 333 + ...ic-form-values-with-jinja-and-fastapi.html | 438 + faithful.html | 548 + ffmpeg-10-bit-videos-to-8-bit.html | 336 + file-length.html | 356 + filepath-completion-in-neovim.html | 440 + filtering-emails-with-core-utils.html | 354 + fonts-in-vs-c-e.html | 337 + forms-with-fastapi-and-jinja.html | 391 + fx-json.html | 356 + git-ammend-to-a-commit.html | 333 + git-bisect.html | 433 + git-fetch-failing-check-your-config.html | 348 + git-repo-specific-ssh-key.html | 336 + git-worktrees-01.html | 389 + hebrew-bible-full-class.html | 563 + home-server-refactor.html | 440 + hostnamectl-to-easily-change-hostname.html | 368 + ...se-nextcloud-for-safe-central-storage.html | 348 + how-to-survive-the-flood.html | 371 + htop.html | 347 + i3-like-keyboard-mapping-in-pop-os.html | 377 + index-1.html | 431 + index-10.html | 422 + index-11.html | 425 + index-12.html | 445 + index-13.html | 420 + index-14.html | 431 + index-15.html | 419 + index-16.html | 454 + index-17.html | 595 + index-18.html | 595 + index-19.html | 595 + index-2.html | 430 + index-20.html | 555 + index-3.html | 424 + index-4.html | 438 + index-5.html | 440 + index-6.html | 431 + index-7.html | 440 + index-8.html | 451 + index-9.html | 433 + index.html | 442 + index.json | 325 + index.rss | 263 + initial-proxmox-setup.html | 337 + ...nding-on-tailscale-and-server-address.html | 407 + ipython-prompt.html | 415 + jellyfin-media-players.html | 374 + ...rd-to-keep-me-focused-on-my-own-ideas.html | 364 + kvm-network-interface-via-nat-ubuntu-20.html | 411 + limit-zfs-list-to-avoid-docker-vomit.html | 337 + local-dns-with-pi-hole.html | 335 + ...-to-find-what-s-using-your-filesystem.html | 336 + make-a-series-of-directories-fast.html | 337 + marmite.json | 68 + media/builtin-calendar.png | Bin 0 -> 405680 bytes media/df-memory-usage.png | Bin 0 -> 349606 bytes media/glances-iowait.png | Bin 0 -> 71188 bytes media/ipython-prompt-no-git.png | Bin 0 -> 7969 bytes media/ipython-prompt.png | Bin 0 -> 8198 bytes media/plotly-streamlit.gif | Bin 0 -> 144880 bytes media/py-print-align.png | Bin 0 -> 78179 bytes media/python-crop.png | Bin 0 -> 43444 bytes media/python.png | Bin 0 -> 54474 bytes media/sh-prompt.png | Bin 0 -> 30527 bytes media/skimpy-ipython.png | Bin 0 -> 157001 bytes media/skimpy-ipython2.png | Bin 0 -> 162753 bytes media/skimpy-zsh.png | Bin 0 -> 160901 bytes media/tiddlywiki-example.png | Bin 0 -> 51669 bytes media/truenas-wireguard.png | Bin 0 -> 46829 bytes media/typed-dict-warning.png | Bin 0 -> 6886 bytes media/typed-dict.png | Bin 0 -> 4026 bytes media/zsh-oh-my-zsh-prompt.png | Bin 0 -> 32247 bytes media/zsh-prompt.png | Bin 0 -> 22020 bytes media/zsh-starship-prompt.png | Bin 0 -> 45970 bytes mocking-s3-with-moto.html | 407 + modal-labs.html | 421 + mounting-exfat-usb-in-linux.html | 390 + mu.html | 441 + my-passmark-scores.html | 366 + netplan-change-from-focal-to-jammy.html | 361 + new-lines-in-markdown-tables.html | 372 + nextcloud-docker-upgrade-error.html | 337 + ...-permissions-with-zfs-and-ansible-nas.html | 373 + olivet-mens-group-james-2023.html | 581 + on-earth-as-it-is-in-heaven.html | 410 + ...lick-to-dockerized-app-from-portainer.html | 331 + opnsense-bootstrap-recovery.html | 313 + pages-1.html | 211 + pages.html | 211 + pandas-select-dtypes.html | 350 + pandas-string-contains.html | 392 + ...gx-filtering-on-ids-instead-of-values.html | 338 + ...reserve-console-output-in-ssh-session.html | 339 + pipx.html | 388 + playing-with-mdformat.html | 340 + plotly-and-streamlit.html | 472 + plug-snapshot-to-save-your-life.html | 416 + plug-snapshot.html | 335 + polybar-01.html | 451 + psutil-01.html | 386 + pyclean.html | 371 + python-builtin-calendar.html | 355 + python-eval.html | 364 + python-f-string-align.html | 363 + ...rytped-datasets-with-sane-permissions.html | 347 + recovering-opnsense.html | 364 + reflection-wisdom-in-relationships-2.html | 382 + reflection-wisdom-in-relationships.html | 338 + ...fter-messing-around-on-the-filesystem.html | 337 + ...x-nextcloud-after-adding-data-via-cli.html | 367 + ...about-ssh-copy-id-for-ssh-and-ansible.html | 337 + remove-zfs-dataset-specific-snapshots.html | 349 + reset-ssh-key-passphrase.html | 347 + restart-kde-plasma.html | 342 + robots.txt | 5 + sabbath.html | 666 + ...untu-22-needs-inherit-permissions-set.html | 337 + screwtape.html | 694 + see-git-history-about-one-file.html | 333 + see-zfs-snapshot-disk-usage.html | 339 + ...cker-registry-with-proxy-pull-through.html | 353 + self-hosted-media.html | 489 + session-2-intro.html | 2596 ++ session-3-intro.html | 409 + setup-kvm-to-boot-from-local-pxe-server.html | 337 + shalom-and-peace.html | 510 + simple-port-forwarding-opnsense.html | 337 + skimpy.html | 370 + stable-diffusion-notes.html | 470 + starship.html | 391 + static/Atkinson-Hyperlegible-Regular-102.woff | Bin 0 -> 22792 bytes static/avatar-placeholder.png | Bin 0 -> 1511 bytes static/colorschemes/catppuccin.css | 50 + static/colorschemes/clean.css | 77 + static/colorschemes/dracula.css | 50 + static/colorschemes/github.css | 48 + static/colorschemes/gruvbox.css | 48 + static/colorschemes/iceberg.css | 48 + static/colorschemes/monokai.css | 48 + static/colorschemes/nord.css | 48 + static/colorschemes/one.css | 48 + static/colorschemes/solarized.css | 58 + static/colorschemes/typewriter.css | 48 + static/custom.css | 1 + static/custom.js | 1 + static/favicon.ico | 0 static/marmite.css | 749 + static/marmite.js | 192 + static/pico.min.css | 4 + static/robots.txt | 5 + static/search.js | 83 + static/search_index.json | 1 + stow-target.html | 345 + stow.html | 351 + streams.html | 208 + stylus-for-custom-webpage-themes.html | 343 + ...-another-list-with-itertools-compress.html | 331 + suda-vim-for-sudo-access-to-files.html | 339 + suddenly-ssh-requires-a-password.html | 339 + ...from-altacv-to-rendercv-for-my-resume.html | 333 + systemd-timer-for-syncoid.html | 377 + tag-bash-1.html | 299 + tag-bash.html | 299 + tag-bash.json | 121 + tag-bash.rss | 63 + tag-bema-1.html | 507 + tag-bema-2.html | 595 + tag-bema-3.html | 595 + tag-bema-4.html | 595 + tag-bema-5.html | 479 + tag-bema.html | 507 + tag-bema.json | 309 + tag-bema.rss | 20419 ++++++++++++++++ tag-bible-project-1.html | 441 + tag-bible-project-2.html | 309 + tag-bible-project.html | 441 + tag-bible-project.json | 303 + tag-bible-project.rss | 1536 ++ tag-blog-1.html | 277 + tag-blog.html | 277 + tag-blog.json | 95 + tag-blog.rss | 354 + tag-books-1.html | 218 + tag-books.html | 218 + tag-books.json | 30 + tag-books.rss | 345 + tag-cli-1.html | 427 + tag-cli-2.html | 427 + tag-cli-3.html | 253 + tag-cli.html | 427 + tag-cli.json | 338 + tag-cli.rss | 249 + tag-data-1.html | 261 + tag-data.html | 261 + tag-data.json | 75 + tag-data.rss | 273 + tag-faith-1.html | 440 + tag-faith-2.html | 378 + tag-faith.html | 440 + tag-faith.json | 323 + tag-faith.rss | 1636 ++ tag-git-1.html | 275 + tag-git.html | 275 + tag-git.json | 94 + tag-git.rss | 242 + tag-homelab-1.html | 425 + tag-homelab-2.html | 422 + tag-homelab-3.html | 438 + tag-homelab-4.html | 427 + tag-homelab-5.html | 426 + tag-homelab-6.html | 421 + tag-homelab.html | 425 + tag-homelab.json | 337 + tag-homelab.rss | 187 + tag-homepage-1.html | 239 + tag-homepage.html | 239 + tag-homepage.json | 53 + tag-homepage.rss | 55 + tag-infrastructure-1.html | 216 + tag-infrastructure.html | 216 + tag-infrastructure.json | 31 + tag-infrastructure.rss | 4 + tag-linux-1.html | 432 + tag-linux-2.html | 424 + tag-linux-3.html | 433 + tag-linux-4.html | 429 + tag-linux-5.html | 400 + tag-linux.html | 432 + tag-linux.json | 339 + tag-linux.rss | 279 + tag-olivet-1.html | 221 + tag-olivet.html | 221 + tag-olivet.json | 30 + tag-olivet.rss | 240 + tag-python-1.html | 425 + tag-python-2.html | 434 + tag-python-3.html | 417 + tag-python-4.html | 252 + tag-python.html | 425 + tag-python.json | 332 + tag-python.rss | 812 + tag-tech-1.html | 430 + tag-tech-10.html | 426 + tag-tech-11.html | 429 + tag-tech-12.html | 418 + tag-tech-13.html | 417 + tag-tech-14.html | 236 + tag-tech-2.html | 415 + tag-tech-3.html | 435 + tag-tech-4.html | 434 + tag-tech-5.html | 429 + tag-tech-6.html | 438 + tag-tech-7.html | 430 + tag-tech-8.html | 424 + tag-tech-9.html | 445 + tag-tech.html | 430 + tag-tech.json | 336 + tag-tech.rss | 209 + tag-terminal-1.html | 268 + tag-terminal.html | 268 + tag-terminal.json | 75 + tag-terminal.rss | 47 + tag-til-1.html | 302 + tag-til.html | 302 + tag-til.json | 117 + tag-til.rss | 119 + tag-vim-1.html | 430 + tag-vim-2.html | 264 + tag-vim.html | 430 + tag-vim.json | 268 + tag-vim.rss | 223 + tag-webdev-1.html | 249 + tag-webdev.html | 249 + tag-webdev.json | 53 + tag-webdev.rss | 47 + tag-zfs-1.html | 434 + tag-zfs-2.html | 234 + tag-zfs.html | 434 + tag-zfs.json | 254 + tag-zfs.rss | 184 + tags.html | 630 + tdarr-worker-nodes-share-the-cache.html | 369 + tdarr.html | 329 + terraform-01.html | 397 + the-two-houses.html | 360 + tiddly-wiki.html | 386 + traefik-01.html | 551 + tree-of-life.html | 480 + tree.html | 395 + ...n-to-web-server-on-another-box-on-lan.html | 333 + truenas-and-wireguard.html | 400 + typeddict.html | 402 + ubuntu-static-ip.html | 345 + unpack-anywhere-with-star.html | 356 + ...ading-your-kernel-can-f-you-up-whoops.html | 335 + ...n-standard-named-ssh-keys-with-github.html | 367 + use-the-right-lspsage-you-dope.html | 331 + vim-auto-space.html | 334 + vim-spell-check.html | 385 + webservers-and-indexes.html | 375 + welcome.html | 335 + wireguard.html | 381 + wish-list-with-fastapi.html | 573 + ...quired-to-create-managed-color-device.html | 350 + you-can-embed-gifs.html | 340 + zfs-permissions-for-sanoid-syncoid.html | 338 + 447 files changed, 265307 insertions(+) create mode 100644 001-trust-the-story.html create mode 100644 002-knowing-when-to-say-enough.html create mode 100644 003-master-the-beast.html create mode 100644 004-his-bow-in-the-clouds.html create mode 100644 005-misplaced-curse.html create mode 100644 006-a-tale-of-a-tower.html create mode 100644 007-the-preface.html create mode 100644 008-buried-in-a-geneology.html create mode 100644 009-letting-go.html create mode 100644 010-walking-the-blood-path.html create mode 100644 011-here-i-am.html create mode 100644 012-a-mission-realized.html create mode 100644 013-grappling-with-god-part-1.html create mode 100644 014-grappling-with-god-part-2.html create mode 100644 015-into-the-pit.html create mode 100644 016-out-of-the-pit.html create mode 100644 017-a-god-who-hears-the-cry.html create mode 100644 018-a-tale-of-two-kingdoms.html create mode 100644 019-a-strengthened-heart.html create mode 100644 020-with-all-your-heart.html create mode 100644 021-with-all-your-soul-very.html create mode 100644 022-under-the-chuppah.html create mode 100644 023-falling-on-joyful-faces.html create mode 100644 024-creating-a-space.html create mode 100644 025-a-kingdom-of-what.html create mode 100644 026-images-of-the-desert.html create mode 100644 027-images-of-the-desert-rotem-and-acacia.html create mode 100644 028-images-of-the-desert-ar-ar-and-tamarisk.html create mode 100644 030-lead-with-your-voice.html create mode 100644 034-the-hardest-story-in-the-bible-for-mary.html create mode 100644 035-crossroads-of-destiny.html create mode 100644 036-the-redemption-cycle.html create mode 100644 037-a-love-story.html create mode 100644 038-a-donkey-herder-to-lead-us.html create mode 100644 039-a-king-after-god-s-own-heart.html create mode 100644 040-one-story-two-sources.html create mode 100644 041-the-story-behind-the-story.html create mode 100644 042-the-fire-of-elijah.html create mode 100644 043-go-in-peace.html create mode 100644 044-our-harps-in-the-trees.html create mode 100644 074-silent-years-synagogue.html create mode 100644 075-silent-years-welcome-to-hellenism.html create mode 100644 076-silent-years-sadducees.html create mode 100644 077-silent-years-herodians.html create mode 100644 078-silent-years-essenes.html create mode 100644 404.html create mode 100644 about.html create mode 100644 abraham-and-melchizedek.html create mode 100644 abstract-base-class.html create mode 100644 adblock-coverage.html create mode 100644 add-colored-indicators-to-your-dataframes-html-representation.html create mode 100644 add-space-to-your-lvm-on-ubuntu.html create mode 100644 adding-docker-daemon-json-broke-docker.html create mode 100644 adding-ip-camera-to-motioneye-on-home-assistant-os.html create mode 100644 advent-2024-peace.html create mode 100644 and-vs.html create mode 100644 append-string-to-list-of-files-with-xarg.html create mode 100644 archive-2022-1.html create mode 100644 archive-2022-10.html create mode 100644 archive-2022-11.html create mode 100644 archive-2022-12.html create mode 100644 archive-2022-13.html create mode 100644 archive-2022-14.html create mode 100644 archive-2022-15.html create mode 100644 archive-2022-16.html create mode 100644 archive-2022-17.html create mode 100644 archive-2022-2.html create mode 100644 archive-2022-3.html create mode 100644 archive-2022-4.html create mode 100644 archive-2022-5.html create mode 100644 archive-2022-6.html create mode 100644 archive-2022-7.html create mode 100644 archive-2022-8.html create mode 100644 archive-2022-9.html create mode 100644 archive-2022.html create mode 100644 archive-2022.json create mode 100644 archive-2022.rss create mode 100644 archive-2023-1.html create mode 100644 archive-2023-2.html create mode 100644 archive-2023.html create mode 100644 archive-2023.json create mode 100644 archive-2023.rss create mode 100644 archive-2024-1.html create mode 100644 archive-2024-2.html create mode 100644 archive-2024-3.html create mode 100644 archive-2024.html create mode 100644 archive-2024.json create mode 100644 archive-2024.rss create mode 100644 archive.html create mode 100644 arr-client-config.html create mode 100644 author-nicpayne-1.html create mode 100644 author-nicpayne-10.html create mode 100644 author-nicpayne-11.html create mode 100644 author-nicpayne-12.html create mode 100644 author-nicpayne-13.html create mode 100644 author-nicpayne-14.html create mode 100644 author-nicpayne-15.html create mode 100644 author-nicpayne-16.html create mode 100644 author-nicpayne-17.html create mode 100644 author-nicpayne-18.html create mode 100644 author-nicpayne-19.html create mode 100644 author-nicpayne-2.html create mode 100644 author-nicpayne-20.html create mode 100644 author-nicpayne-3.html create mode 100644 author-nicpayne-4.html create mode 100644 author-nicpayne-5.html create mode 100644 author-nicpayne-6.html create mode 100644 author-nicpayne-7.html create mode 100644 author-nicpayne-8.html create mode 100644 author-nicpayne-9.html create mode 100644 author-nicpayne.html create mode 100644 author-nicpayne.json create mode 100644 author-nicpayne.rss create mode 100644 authors.html create mode 100644 benchmark-your-disks-with-fio.html create mode 100644 bp-the-golden-rule.html create mode 100644 call-basicconfig-to-get-python-log-messages-in-ipython.html create mode 100644 caps-lock-polybar.html create mode 100644 case-insensitive-search-in-vim.html create mode 100644 chaos-dragon.html create mode 100644 chara-joy.html create mode 100644 cheat-on-your-man.html create mode 100644 check-your-bios-version-on-ubuntu.html create mode 100644 check-your-smart-status-with-smartctl.html create mode 100644 configure-bridge-network-on-ubuntu-22-04-with-netplan.html create mode 100644 convert-word-doc-to-pdf-with-headless-libreoffice.html create mode 100644 cron-for-nextcloud-in-docker.html create mode 100644 customize-k9s.html create mode 100644 dataframe-memory-usage.html create mode 100644 dataframe-to-markdown.html create mode 100644 dataframe-to-styled-html.html create mode 100644 deleting-files-on-remote-storage-from-ubuntu-might-not-do-what-you-think.html create mode 100644 deques.html create mode 100644 description-of-my-proposed-vimconf-2022-talk.html create mode 100644 destroying-tmux-sessions-with-fzf.html create mode 100644 dhcp-restart-to-save-ubuntu-22-04-server-networking.html create mode 100644 dns-broke-after-reboot-ubuntu-22-04.html create mode 100644 docker-copy-and-chown.html create mode 100644 docker-remote-add.html create mode 100644 don-t-forget-to-load-xmp.html create mode 100644 dynamic-form-values-with-jinja-and-fastapi.html create mode 100644 faithful.html create mode 100644 ffmpeg-10-bit-videos-to-8-bit.html create mode 100644 file-length.html create mode 100644 filepath-completion-in-neovim.html create mode 100644 filtering-emails-with-core-utils.html create mode 100644 fonts-in-vs-c-e.html create mode 100644 forms-with-fastapi-and-jinja.html create mode 100644 fx-json.html create mode 100644 git-ammend-to-a-commit.html create mode 100644 git-bisect.html create mode 100644 git-fetch-failing-check-your-config.html create mode 100644 git-repo-specific-ssh-key.html create mode 100644 git-worktrees-01.html create mode 100644 hebrew-bible-full-class.html create mode 100644 home-server-refactor.html create mode 100644 hostnamectl-to-easily-change-hostname.html create mode 100644 how-i-use-nextcloud-for-safe-central-storage.html create mode 100644 how-to-survive-the-flood.html create mode 100644 htop.html create mode 100644 i3-like-keyboard-mapping-in-pop-os.html create mode 100644 index-1.html create mode 100644 index-10.html create mode 100644 index-11.html create mode 100644 index-12.html create mode 100644 index-13.html create mode 100644 index-14.html create mode 100644 index-15.html create mode 100644 index-16.html create mode 100644 index-17.html create mode 100644 index-18.html create mode 100644 index-19.html create mode 100644 index-2.html create mode 100644 index-20.html create mode 100644 index-3.html create mode 100644 index-4.html create mode 100644 index-5.html create mode 100644 index-6.html create mode 100644 index-7.html create mode 100644 index-8.html create mode 100644 index-9.html create mode 100644 index.html create mode 100644 index.json create mode 100644 index.rss create mode 100644 initial-proxmox-setup.html create mode 100644 interesting-ips-between-jellyfin-clients-and-server-depending-on-tailscale-and-server-address.html create mode 100644 ipython-prompt.html create mode 100644 jellyfin-media-players.html create mode 100644 kanboard-to-keep-me-focused-on-my-own-ideas.html create mode 100644 kvm-network-interface-via-nat-ubuntu-20.html create mode 100644 limit-zfs-list-to-avoid-docker-vomit.html create mode 100644 local-dns-with-pi-hole.html create mode 100644 lsof-to-find-what-s-using-your-filesystem.html create mode 100644 make-a-series-of-directories-fast.html create mode 100644 marmite.json create mode 100644 media/builtin-calendar.png create mode 100644 media/df-memory-usage.png create mode 100644 media/glances-iowait.png create mode 100644 media/ipython-prompt-no-git.png create mode 100644 media/ipython-prompt.png create mode 100644 media/plotly-streamlit.gif create mode 100644 media/py-print-align.png create mode 100644 media/python-crop.png create mode 100644 media/python.png create mode 100644 media/sh-prompt.png create mode 100644 media/skimpy-ipython.png create mode 100644 media/skimpy-ipython2.png create mode 100644 media/skimpy-zsh.png create mode 100644 media/tiddlywiki-example.png create mode 100644 media/truenas-wireguard.png create mode 100644 media/typed-dict-warning.png create mode 100644 media/typed-dict.png create mode 100644 media/zsh-oh-my-zsh-prompt.png create mode 100644 media/zsh-prompt.png create mode 100644 media/zsh-starship-prompt.png create mode 100644 mocking-s3-with-moto.html create mode 100644 modal-labs.html create mode 100644 mounting-exfat-usb-in-linux.html create mode 100644 mu.html create mode 100644 my-passmark-scores.html create mode 100644 netplan-change-from-focal-to-jammy.html create mode 100644 new-lines-in-markdown-tables.html create mode 100644 nextcloud-docker-upgrade-error.html create mode 100644 nextcloud-permissions-with-zfs-and-ansible-nas.html create mode 100644 olivet-mens-group-james-2023.html create mode 100644 on-earth-as-it-is-in-heaven.html create mode 100644 one-click-to-dockerized-app-from-portainer.html create mode 100644 opnsense-bootstrap-recovery.html create mode 100644 pages-1.html create mode 100644 pages.html create mode 100644 pandas-select-dtypes.html create mode 100644 pandas-string-contains.html create mode 100644 paperless-ngx-filtering-on-ids-instead-of-values.html create mode 100644 pipe-to-a-pager-to-preserve-console-output-in-ssh-session.html create mode 100644 pipx.html create mode 100644 playing-with-mdformat.html create mode 100644 plotly-and-streamlit.html create mode 100644 plug-snapshot-to-save-your-life.html create mode 100644 plug-snapshot.html create mode 100644 polybar-01.html create mode 100644 psutil-01.html create mode 100644 pyclean.html create mode 100644 python-builtin-calendar.html create mode 100644 python-eval.html create mode 100644 python-f-string-align.html create mode 100644 quick-setup-of-zfs-encrytped-datasets-with-sane-permissions.html create mode 100644 recovering-opnsense.html create mode 100644 reflection-wisdom-in-relationships-2.html create mode 100644 reflection-wisdom-in-relationships.html create mode 100644 refresh-nextcloud-groupfolders-after-messing-around-on-the-filesystem.html create mode 100644 reindex-nextcloud-after-adding-data-via-cli.html create mode 100644 reminder-about-ssh-copy-id-for-ssh-and-ansible.html create mode 100644 remove-zfs-dataset-specific-snapshots.html create mode 100644 reset-ssh-key-passphrase.html create mode 100644 restart-kde-plasma.html create mode 100644 robots.txt create mode 100644 sabbath.html create mode 100644 samba-on-ubuntu-22-needs-inherit-permissions-set.html create mode 100644 screwtape.html create mode 100644 see-git-history-about-one-file.html create mode 100644 see-zfs-snapshot-disk-usage.html create mode 100644 self-hosted-docker-registry-with-proxy-pull-through.html create mode 100644 self-hosted-media.html create mode 100644 session-2-intro.html create mode 100644 session-3-intro.html create mode 100644 setup-kvm-to-boot-from-local-pxe-server.html create mode 100644 shalom-and-peace.html create mode 100644 simple-port-forwarding-opnsense.html create mode 100644 skimpy.html create mode 100644 stable-diffusion-notes.html create mode 100644 starship.html create mode 100644 static/Atkinson-Hyperlegible-Regular-102.woff create mode 100644 static/avatar-placeholder.png create mode 100644 static/colorschemes/catppuccin.css create mode 100644 static/colorschemes/clean.css create mode 100644 static/colorschemes/dracula.css create mode 100644 static/colorschemes/github.css create mode 100644 static/colorschemes/gruvbox.css create mode 100644 static/colorschemes/iceberg.css create mode 100644 static/colorschemes/monokai.css create mode 100644 static/colorschemes/nord.css create mode 100644 static/colorschemes/one.css create mode 100644 static/colorschemes/solarized.css create mode 100644 static/colorschemes/typewriter.css create mode 100644 static/custom.css create mode 100644 static/custom.js create mode 100644 static/favicon.ico create mode 100644 static/marmite.css create mode 100644 static/marmite.js create mode 100644 static/pico.min.css create mode 100644 static/robots.txt create mode 100644 static/search.js create mode 100644 static/search_index.json create mode 100644 stow-target.html create mode 100644 stow.html create mode 100644 streams.html create mode 100644 stylus-for-custom-webpage-themes.html create mode 100644 subset-a-list-based-on-values-in-another-list-with-itertools-compress.html create mode 100644 suda-vim-for-sudo-access-to-files.html create mode 100644 suddenly-ssh-requires-a-password.html create mode 100644 switching-from-altacv-to-rendercv-for-my-resume.html create mode 100644 systemd-timer-for-syncoid.html create mode 100644 tag-bash-1.html create mode 100644 tag-bash.html create mode 100644 tag-bash.json create mode 100644 tag-bash.rss create mode 100644 tag-bema-1.html create mode 100644 tag-bema-2.html create mode 100644 tag-bema-3.html create mode 100644 tag-bema-4.html create mode 100644 tag-bema-5.html create mode 100644 tag-bema.html create mode 100644 tag-bema.json create mode 100644 tag-bema.rss create mode 100644 tag-bible-project-1.html create mode 100644 tag-bible-project-2.html create mode 100644 tag-bible-project.html create mode 100644 tag-bible-project.json create mode 100644 tag-bible-project.rss create mode 100644 tag-blog-1.html create mode 100644 tag-blog.html create mode 100644 tag-blog.json create mode 100644 tag-blog.rss create mode 100644 tag-books-1.html create mode 100644 tag-books.html create mode 100644 tag-books.json create mode 100644 tag-books.rss create mode 100644 tag-cli-1.html create mode 100644 tag-cli-2.html create mode 100644 tag-cli-3.html create mode 100644 tag-cli.html create mode 100644 tag-cli.json create mode 100644 tag-cli.rss create mode 100644 tag-data-1.html create mode 100644 tag-data.html create mode 100644 tag-data.json create mode 100644 tag-data.rss create mode 100644 tag-faith-1.html create mode 100644 tag-faith-2.html create mode 100644 tag-faith.html create mode 100644 tag-faith.json create mode 100644 tag-faith.rss create mode 100644 tag-git-1.html create mode 100644 tag-git.html create mode 100644 tag-git.json create mode 100644 tag-git.rss create mode 100644 tag-homelab-1.html create mode 100644 tag-homelab-2.html create mode 100644 tag-homelab-3.html create mode 100644 tag-homelab-4.html create mode 100644 tag-homelab-5.html create mode 100644 tag-homelab-6.html create mode 100644 tag-homelab.html create mode 100644 tag-homelab.json create mode 100644 tag-homelab.rss create mode 100644 tag-homepage-1.html create mode 100644 tag-homepage.html create mode 100644 tag-homepage.json create mode 100644 tag-homepage.rss create mode 100644 tag-infrastructure-1.html create mode 100644 tag-infrastructure.html create mode 100644 tag-infrastructure.json create mode 100644 tag-infrastructure.rss create mode 100644 tag-linux-1.html create mode 100644 tag-linux-2.html create mode 100644 tag-linux-3.html create mode 100644 tag-linux-4.html create mode 100644 tag-linux-5.html create mode 100644 tag-linux.html create mode 100644 tag-linux.json create mode 100644 tag-linux.rss create mode 100644 tag-olivet-1.html create mode 100644 tag-olivet.html create mode 100644 tag-olivet.json create mode 100644 tag-olivet.rss create mode 100644 tag-python-1.html create mode 100644 tag-python-2.html create mode 100644 tag-python-3.html create mode 100644 tag-python-4.html create mode 100644 tag-python.html create mode 100644 tag-python.json create mode 100644 tag-python.rss create mode 100644 tag-tech-1.html create mode 100644 tag-tech-10.html create mode 100644 tag-tech-11.html create mode 100644 tag-tech-12.html create mode 100644 tag-tech-13.html create mode 100644 tag-tech-14.html create mode 100644 tag-tech-2.html create mode 100644 tag-tech-3.html create mode 100644 tag-tech-4.html create mode 100644 tag-tech-5.html create mode 100644 tag-tech-6.html create mode 100644 tag-tech-7.html create mode 100644 tag-tech-8.html create mode 100644 tag-tech-9.html create mode 100644 tag-tech.html create mode 100644 tag-tech.json create mode 100644 tag-tech.rss create mode 100644 tag-terminal-1.html create mode 100644 tag-terminal.html create mode 100644 tag-terminal.json create mode 100644 tag-terminal.rss create mode 100644 tag-til-1.html create mode 100644 tag-til.html create mode 100644 tag-til.json create mode 100644 tag-til.rss create mode 100644 tag-vim-1.html create mode 100644 tag-vim-2.html create mode 100644 tag-vim.html create mode 100644 tag-vim.json create mode 100644 tag-vim.rss create mode 100644 tag-webdev-1.html create mode 100644 tag-webdev.html create mode 100644 tag-webdev.json create mode 100644 tag-webdev.rss create mode 100644 tag-zfs-1.html create mode 100644 tag-zfs-2.html create mode 100644 tag-zfs.html create mode 100644 tag-zfs.json create mode 100644 tag-zfs.rss create mode 100644 tags.html create mode 100644 tdarr-worker-nodes-share-the-cache.html create mode 100644 tdarr.html create mode 100644 terraform-01.html create mode 100644 the-two-houses.html create mode 100644 tiddly-wiki.html create mode 100644 traefik-01.html create mode 100644 tree-of-life.html create mode 100644 tree.html create mode 100644 trick-to-login-to-web-server-on-another-box-on-lan.html create mode 100644 truenas-and-wireguard.html create mode 100644 typeddict.html create mode 100644 ubuntu-static-ip.html create mode 100644 unpack-anywhere-with-star.html create mode 100644 upgrading-your-kernel-can-f-you-up-whoops.html create mode 100644 use-non-standard-named-ssh-keys-with-github.html create mode 100644 use-the-right-lspsage-you-dope.html create mode 100644 vim-auto-space.html create mode 100644 vim-spell-check.html create mode 100644 webservers-and-indexes.html create mode 100644 welcome.html create mode 100644 wireguard.html create mode 100644 wish-list-with-fastapi.html create mode 100644 xrdp-authentication-required-to-create-managed-color-device.html create mode 100644 you-can-embed-gifs.html create mode 100644 zfs-permissions-for-sanoid-syncoid.html diff --git a/001-trust-the-story.html b/001-trust-the-story.html new file mode 100644 index 00000000..a5dd8e00 --- /dev/null +++ b/001-trust-the-story.html @@ -0,0 +1,2585 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 001 Trust the Story | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

001 Trust the Story

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

1: Trust the Story

+
9th August 2021 at 7:31pm
+
+ +bema-session-1 + +
+
+

Podcast link

notes

Creation story of Genesis 1:1-2:4

Observations

  • Poetic nature
  • Evening and Morning vs Morning and Evening... should stick out to us as westerners
  • "It is good" is something God sees regularly
  • Plants created on day 3, sun not until day 4, so how do the plants survive or anything?
    • Days are only measured, in human history, by the sun - so how are the first 3 days even days?
  • this poem is not about how the world was made, but about who made it
  • The poem is not only about creating but also resting...
  • Day 5 corresponds to day 2 where day 2 is separation and day 5 is filling
    • Day 4 to day 1
    • Day 6 to day 3
    • God doesn't actually create much - he separates and brings order to the chaotic nothingness - to-hu wa bo-hu
  • Chiastic structure of the creation narrative
    • The first part of the story mirrors the last part
      • ABCDDCBA
      • ABCDABCD
  • Genesis 1 is both types of chiasms at the same time
    • from a literary (like looking at the words) perspective we see ABCDDCBA wherein the paragraph's structure is chiastic in its form... day 1 is a "baby paragraph", day 2 "mommy paragraph", day 3 "daddy paragraph" etc. except that day 6 is not a "baby paragraph" because the creation of man sticks out a bit - making it kind of hard to see.
    • from a material perspective, as noted, it's the other kind of chiasm of ABCDABCD where day 1,2,3 are separation, and days 4,5,6 are filling of the things that were separated on days 1,2,3 respectively

How can we be sure it's poetic?

A: patterns...

  • 3 days mirror 3 days, so we'd expect some patterns of 3.
    • The god is creator, word, and spirit
    • the poem is about rest
    • bara (create) shows up in 3 places, beginning, middle, and end
      • at the end it shows up 3 times in rapid fire
  • 7 days making us think of patterns of 7
    • verse 1 has 7 words
    • verse 2 has 14 words
    • earth shows up 21 times
    • God shows up 35 times
    • it was so shows up 7 times
    • God saw shows up 7 times
  • Are there patterns of 10?
    • to make, according to its kind, and God said all show up 10 times
    • And God said...
    • around 18 minute mark?

Bookends +* Story starts with "chaotic nothingness" (to-hu wa bo-hu) +* Story ends with God resting (doing nothing) +* So the story is bookended by "nothingness"

So what's the center?

  • mo-ed - the day for "seasons" in the creation on day 4
    • Sabbath is a "season", a festival, and is a common theme. It's put forth that the entire story is about rest, bookended by nothingness and the center "treasure" is rest.

Why?

    • Israel spent 400 years in slavery, valued only by how many bricks an individual can produce.
    • Gods' story outlines how he feels about humanity and creation... the creation of man sticks out weirdly from the chiasm, and is the last thing made before "it was very good", and then on the 7th day there is no "evening and morning"...

evening and morning +The Hebrew day begins with rest, not with waking up and thinking about what to do... very opposed to the western mindset where our day begins with waking up. In God's economy, the day begins with rest, not with thinking about what we can do to prove our worth

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/002-knowing-when-to-say-enough.html b/002-knowing-when-to-say-enough.html new file mode 100644 index 00000000..4a79eb9c --- /dev/null +++ b/002-knowing-when-to-say-enough.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 002 Knowing When to Say Enough | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

002 Knowing When to Say Enough

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

2: Knowing When to Say Enough

+
21st February 2022 at 11:16am
+
+ +bema-session-1 + +
+
+

link to podcast

Genesis 2

  • Rabbinic tradition that the Tree of Knowledge of Good and Evil is not physically in the middle of the garden, but is in the middle of "her" garden (when she says to the serpent, we are not to eat of the tree in 'the middle' of the garden)
  • Tree of Life is for sure in the middle, whereas the Tree of Knowledge of Good and Evil might be, might not be...
  • There's 4 rivers, decreasing level of details given
  • No rain so far - made evident by the streams coming up from the earth. These may or may not be the rivers - there's freedom to go either way
  • God says it's not good that man is alone and then he's told to name the animals
    • We might expect it to be the other way if it was to be discovered that Adam was alone, but God knows he is alone and then it's reiterated that there's no helper suitable for him
    • is this part of the chiastic structure?
  • Man leaves his father and mother?
    • Doesn't the woman leave? Why the emphasis on the man in verse 24?
    • Could be an a thought imputed into the text by a scribe doing commentary later on

Genesis 3

  • Jewish Oral tradition teaches that Adam added to God's command, and that's why Eve says "we must not touch it"
  • Just a talking snake out of nowhere?

Man and Woman

  • Woman being taken from man
  • Woman is the edzer kinegido
    • She is the help that comes against him or the help that opposes
  • A part of man, a part of is is taken and is called is-hah. Only when male and female come together is humanity seen at its fullness.
  • Rabbinic teaching of 2 planks resting against each other to form a pyramid shape - if you remove one, they fall, but because they are in opposition to each other, the pyramid shape is supported and remains standing

What are the Problems?

  • Talking snake
  • The fruit was seen to be desirable for gaining wisdom - how?
    • When God made trees we're told the trees are pleasing to the eye and good for food, so the woman adds this third element
  • What is "the sound" of the Lord walking in the garden in the cool of the day?
  • Eve has the knowledge of good and evil before she eats from the tree - so it's clearly not just a tree that gives wisdom about right and wrong, it's something more
    • There's also an element of injustice for God to punish someone to eat of the the knowledge of good and evil if they don't know good and evil before they eat of it
  • Serpent says they can be like God, but they're already like God (humans are)
  • Weird that God would set up his creation for failure (if that's what's happening)... "You can whatever you want, just don't touch this one extremely desirable thing right in the middle of the garden"

Chiasm

  • Bookends of being placed in the garden and banishment
  • Middle details of Adam naming woman and Eve
    • Final note: First name "woman" is about "who [eve] is, her being" and the second name, after banishment is "Eve" which is about "what she can do" – callback to Sabbath, to Egypt, that God says worth is about who we are, but Egypt put all value on what someone can do...
  • Dead center is "the eyes of both of them were opened and they realized they were naked"
    • Interesting routine return back to nakedness within the story (stay tuned as this continues)
    • Of all the things that could happen - after they eat of the tree of the knowledge of good and evil, it's nakedness that the human realize
    • When God finds Adam and Eve the first thing Adam says is "I hid because I was naked"
    • God's response isn't about the tree immediately or anything, it's that "who told you you were naked"
    • Hebrew word play on naked (Arowm), nakedness (Erowm), and the word in 3:1, "crafty" (description of serpent, Eruwm). So if you're literally hearing the story, via spoken word, those 3 words all come from the same root and they are nearly extinguishable when heard... it would stand our significantly if we were hearing this.
  • Also note that the snake is oddly human
    • talks
    • reasons rather well
    • snake relates to the humans
    • snake is walking (curse is that it crawls, meaning it's not crawling in the beginning)
    • it's incredibly human but it's clear in the story that the snake is a beast
  • what is the real temptation that the snake issues towards Eve?
    • Look at emphasis...
    • In English we put emphasis on "Did God really say you must not eat from any tree..."
    • But in Hebrew the emphasis must be on "say"... "Did God really say you must not..."
    • The temptation is to give into desire - which is a new element from Eve... She was the fruit was "desirable".. it's animals, beasts, who give into desires, but as God's imagers they are invited to trust the story, trust God, and to know, like God on Day 7, when to "say enough"... The Serpent offers them to question God's design of humans... he challenges the humans to give into beastly desires and to forsake the humanness, which they do.

El Shaddai

  • Put the Hebrew consonants into a phrase and it means the God who knows when to say "enough"
  • Humans made in God's image need to know when to say "enough"... They are tempted by the serpent to keep going, to keep gaining wisdom apart from what God has given them

Problems with literal view

  • Western tendency is to read creation accounts in a chronological fashion but this story, starting in verse 4, doesn't pick up where the first story leaves off... best you could do is start at day 3
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/003-master-the-beast.html b/003-master-the-beast.html new file mode 100644 index 00000000..e53ea81c --- /dev/null +++ b/003-master-the-beast.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 003 Master the Beast | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

003 Master the Beast

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

3: Master the Beast

+
14th August 2021 at 10:38pm
+
+ +bema-session-1 + +
+
+

podcast link

Cain and Abel

Observations and questions

  • Cain in its truest form means "acquired"
    • Hebrew names were almost a legacy that someone was to live out - names have a lot of meaning
    • Eve calls him this not in spite of Adam, like she got Cain without Adam's help, but rather that by God's assistance, she has been given a son (she acquired a son)
    • Hebrew names could be lived out in a positive or negative sense...
  • God looks with favor on Abel's offering but not Cain's, but we're not given any information about how they should know what they're supposed to bring
    • Should cause us to question some stuff about the nature of God - because what kind of good father doesn't give his kids this information?
  • Cain's legacy
    • Should be about what he is given (what he acquires)
    • When fear enters the equation, when Cain sees that God likes Abel's stuff more and Cain knows that he is dependent on God to acquire anything, then his story will be about being afraid that he will not acquire enough - Abel becomes a symbol of mistrust for Cain.
  • This story shows us that God's position on humanity has not changed
    • he still loves his creation, he still walks with humanity (there's nothing in the story so far that says that "sin has entered humanity" even though they're banished from the garden... that is not separation from God necessarily
    • What we do see is that humanity's position on themselves has changed
      • They now have shame, are angry, downcast... they are what Cain demonstrates
    • God approaches Cain regarding his anger and God still thinks that Cain can live out the right legacy and trust the story... he gives him the direction to just do what is right, meaning that Cain can do what is right.
  • Desire as a theme shows up in this story again - just like in Adam and Eve
    • God reminds Cain that he is not a beast, which in the story of Adam and Eve is a defining characteristic of beasts over men, and that Cain can master it
  • Cain and Abel is a retelling of Adam and Eve
    • 2 characters enter the story in harmony with each other
    • Desire is a central theme for the fall of the characters
    • God asks "where are you [is your brother]?"
    • Ends with cursing

Problems

  • How does Cain know what he should bring to offer to God?
  • A problem with God's character... what kind of dad demonstrates favor over one child to another so blatantly?
    • shows that this story is not really about something as zoned in as this character quality... it's about something bigger
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/004-his-bow-in-the-clouds.html b/004-his-bow-in-the-clouds.html new file mode 100644 index 00000000..0994ffc0 --- /dev/null +++ b/004-his-bow-in-the-clouds.html @@ -0,0 +1,2593 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 004 His Bow in the Clouds | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

004 His Bow in the Clouds

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

4: His Bow in the Clouds

+
26th August 2021 at 6:31am
+
+ +bema-session-1 + +
+
+

link to podcat

Flood Stories

  • Exist everywhere (Mesopotamia, Egypt, Babylon, etc... every other nation has a flood story)
    • Most of these for sure pre-date Genesis
    • Leads some historians to go "well a flood must've for sure happened"
    • Either way, just like we look at the previous stories in Genesis so far - these are stories that the author ir retelling that they're used to telling
      • of course because everyone is telling them
  • Epic of Gilgamesh in Mesopotamia has some of the same names as the Genesis flood account
    • Hero: Gilgamesh
    • On a journey through the world where he encounters other gods all with similar stories that ultimately leads to the god getting angry and lashing out at either Gilgamesh or humanity
    • At one point there's a new character who meets the god of storm and thunder (looks just like story of Noah where a god is going to destroy the world with a deluge)
      • The character builds a raft and outsmarts the god when the rains come
      • Seems like the bible story is obviously swiping at this story teaching things about Yahweh's position on humanity as opposed to the gods of the other flood narratives' positions on humanity
      • Gilgamesh was a story in Chaldea - the land that Abram is from so it makes perfect sense that this is a story the Israelites would retell and contrast with similar stories that they're used to

Problems

  • every inclination of man is always evil all the time... very hyperbolic

Chiasm here... found by looking at the numbers + 7, 7, 140, 150, 140, 7, 7 + center: Genesis 8:1

    Genesis 8:1 (LEB)
+    1And God remembered Noah and all the wild animals, and all the domesticated animals that 
+    were with him in the ark. And God caused a wind to blow over the earth, and the waters 
+    subsided.
  • Noah as a word means "rest"... center is rest/sabbath again!

creation roadmap is also followed + **Noah opens a window in the Ark (light and darkness) + **Rain stops (Water above and below) + **Dry ground appears + **Noah sends a raven out (bird in the air) + **Midrash teaching on the son,moon, and stars showing up from creation in the Noah story -Marty skips it + **Ark opens and animals and man come out onto the land (day 6 of creation + **Sabbath doesn't follow though - the man and animals coming out of the Ark...

Repetition of Covenant

  • Genesis 9
  • "covenant" shows up 7 times
  • "earth" shows up 7 times
  • "clouds" shows up 4 times in English, but 5 times in Hebrew
  • "bow" 3 times
  • odd numbers are a big deal in Eastern thinking because they have a center
    • So think of a mini chiasm here?
  • Take the 4th "covenant", 4th "earth", 3rd "cloud", and 2nd "bow" to find the center of this mini-chiasm, last part of verse 9:14...
    • When I make the clouds appear over the earth the bow shall be seen in the clouds
    • This is the center... the bow is the big deal
    • Genesis 1,2,3 is all about a God who knows when to stop creating
    • This is now about the God who knows when to stop destroying

Covenants

  • Suzerain-Vassel Covenants
    • two parties
    • Suzerain - the powerful party
    • Vassel - the lesser
    • Usually meant that the lesser would become the "vassel" to the suzerain, and if you don't maintain your posture of submission that the greater party would destroy the lesser
    • The vassel was given a sign of the covenant with the Suzerain, in order to prove that the powerful party did in fact make a covenant with you
  • God is clearly the Suzerain here
    • God though, owns the sign
    • God takes the aim of the bow - he will be destroyed by himself if he forgets the covenant, so he bears the sign and he remembers
    • Yahweh stands out in the flood story now - because he's different... he's not angry, he's not trying to destroy the world
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/005-misplaced-curse.html b/005-misplaced-curse.html new file mode 100644 index 00000000..083c2f39 --- /dev/null +++ b/005-misplaced-curse.html @@ -0,0 +1,2587 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 005 Misplaced Curse | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

005 Misplaced Curse

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

5: Misplaced Curse

+
26th August 2021 at 6:59am
+
+ +bema-session-1 + +
+
+

link

Problems +* Order of sons listed +* First time "vineyard" shows up +** Law of first mention wherein a Jewish hermenutical principle suggests that the first mention of an important word lays the groundwork for how we understand it later - ie. now anytime we see vineyard we should tie it back to Noah +* Noah is naked in "his own" tent... why is this even mentioned? +* Not a lot of people around - so how did Noah find out what was going on?

Marty Reading

  • Parenthetical comment about Canaan often
Genesis 9:18-27
+Now the sons of Noah who came out of the ark were Shem, Ham, and Japheth. (Ham was the father of Canaan.) These three were the sons of Noah, and from these the whole earth was populated. And Noah began to be a man of the ground, and he planted a vineyard. And he drank some of the wine and became drunk, and he exposed himself in the midst of his tent. And Ham, the father of Canaan, saw the nakedness of his father, and he told his two brothers outside. Then Shem and Japheth took a garment, and the two of them put it on their shoulders and, walking backward, they covered the nakedness of their father. And their faces were turned backward, so that they did not see the nakedness of their father. Then Noah awoke from his drunkenness, and he knew what his youngest son had done to him. And he said, “Cursed be Canaan, a slave of slaves he shall be to his brothers.” Then he said, “Blessed be Yahweh, the God of Shem, and let Canaan be a slave to them. May God make space for Japheth, and let him dwell in the tents of Shem, and let Canaan be a slave for him.”
  • Ham is kind of dropped from the story eventually... "Ham the father of Canaan" shows up a bit then all of a sudden in verse 25 Noah goes right after Canaan
  • Recall that the flood narrative paralleled creation, so we might expect this to then parallel the fall narrative
    • Guy comes out and creates a garden, then there's fruit
    • Noah tastes the garden's fruit and bad things happen
    • Nakedness is another big theme
    • There is a covering of the nakedness
    • Story ends with a curse

Midrash

  • Ancient Jewish form of commentary
  • Western commentary is very deductive and straight forward
  • Easterner does this very differently
    • Inductive
    • A story is hidden with a story (the midrash) which is designed to help the reader discover a truth
  • Culturally "To look upon the nakedness" means more than "to see". The word is about "perceiving"
    • Idiom has 2 primary meanings: molestation or castration
  • Idea that this means to sleep with Noah's wife, or to sleep with one's mother
    • Linked to Deuteronomy
    • The phrase doesn't necessarily mean that, it would be tied to the idea "to sleep with your mother is to molest your father"
  • Midrash says this is obviously castration
  • Why is that so obvious to the Midrash?
    • This parallels Genesis 2 and 3
    • Awkward paragraph about the rivers that didn't seem to belong
    • Family trees are talked about with 2 images... trees or rivers
    • There were 4 rivers, Noah has 3 sons, and God told Noah out of the Ark to "be fruitful and multiply"
      • Noah is supposed to have another son
    • Rabbi Fohrman teaches that from the Midrash we are to discover that Noah is bent on revenge here...
      • Ham in a sense cursed Noah's ability to have more sons, and so Noah curses Ham's son
    • God knew when to say enough regarding his destructive power in the flood narrative
      • In Genesis 1 God knows when to say enough regarding creation, paralleled with humanity's choice to know when to say enough but they choose not to by eating the fruit.
      • Similarly here we have the same choice for Noah to make God's decision - to know when to say enough about his destructive power
    • The story teaches the same thing here that we see with humanity's nature - Noah is given the choice to either trust the story and to make the right decision to not perpetuate the falleness of humanity but Noah's desire for revenge takes over, and he uses a curse that is only ever used by God, which changes the course of history for the people of Canaan - the story has eternal consequences.

Main Point

Forgiveness is about mimicking God in the flood story - to know when to stop destroying and we see the characters constantly not make this choice, but choose to define good and bad for themselves and not trust God's story

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/006-a-tale-of-a-tower.html b/006-a-tale-of-a-tower.html new file mode 100644 index 00000000..1a5b859a --- /dev/null +++ b/006-a-tale-of-a-tower.html @@ -0,0 +1,2591 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 006 A Tale of a Tower | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

006 A Tale of a Tower

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

6: A Tale of a Tower

+
29th August 2021 at 6:51am
+
+ +bema-session-1 + +
+
+

link to podcast

Genesis 10:32–11:9 (LEB)
+32These are the families of the sons of Noah, according to their generations and in their nations. And from these the nations spread abroad on the earth after the flood. 
+1Now the whole earth had one language and the same words. 
+2And as people migrated from the east they found a plain in the land of Shinar and settled there. 
+3And they said to each other, “Come, let us make bricks and burn them thoroughly.” And they had brick for stone and they had tar for mortar. 
+4And they said, “Come, let us build ourselves a city and a tower whose top reaches to the heavens. And let us make a name for ourselves, lest we be scattered over the face of the whole earth.” 
+5Then Yahweh came down to see the city and the tower that humankind was building. 
+6And Yahweh said, “Behold, they are one people with one language, and this is only the beginning of what they will do. So now nothing that they intend to do will be impossible for them. 
+7Come, let us go down and confuse their language there, so that they will not understand each other’s language.” 
+8So Yahweh scattered them from there over the face of the whole earth, and they stopped building the city. 
+9Therefore its name was called Babel, for there Yahweh confused the language of the whole earth, and there Yahweh scattered them over the face of the whole earth.

Observations

  • Geography is becoming a big deal
    • Adam and Eve are cast out east of the garden
    • Cain wanders east
    • God brings the people through Noah back west from the flood
    • Babel is built farther in the east
  • What does the geography mean?
    • Evil is on the move and starting to get organised
    • Starts with 2 people, escalates to murder, then more murder and cities, and finally Babel
  • NBLH are the Hebrew consonants that are repeated over and over in this story, halfway through they switch to HLBN indicating another chiasm centered around verse 11:4, regarding humanity being scattered around the whole earth
    • 10:32 parallels 11:8-9 are the bookend
    • It' nearly impossible to see in English
    • More chiasms
  • Parallels
    • Noah paralleled Creation
    • Noah and the curse parallels Adam and Eve
    • We should expect this to parallel Cain an Able
  • The cherubim guarding the tree of life may show, base on the geographic notions, that God doesn't want his people to settle away from his will - and as people continue moving east (away from his will) then he finally scatters them so that they don't settle "in the east" (or away from his will)
  • Story level repetition (post flood stories parallel the pre flood stories)
    • Creation and re-creation at the flood
    • Adam and Eve is God affirming the goodness of creation and inviting them to join him in his rest but they fail to do so an pursue themselves anyways
    • Cain is invited to do the same, humanity spirals, then God reaffirms the goodness of creation in the flood through a recreation
    • Now in Babel, after eating of the Tree of Knowledge, mankind is starting to look like God but not in the way intended... God knows that humanity haven't learned how to know when to say enough so he can't let them settle (thus the "nothing will be impossible for them" being a problem)
  • This story is a lot about technology - they invest the brick
    • God doesn't have a problem with them building a tower
    • When Hebrew interrupts a dialogue it means there are multiple conversations taking place in the story
      • So at verse 4 is there a second action/story start - a story about "acquiring" and "names" (Cain and Abel)
      • God waits to see what humans will do with the brick, and they use it to rebel so he then intervenes
      • God doesn't condemn the action of building the tower, but he condemns the reasons which are directly contrary to his plan
      • Some teach that God's confusing the speech of humanity isn't necessarily a way for him to stop to tower being built, but that this story teaches that God set up his people for success - all they have to do is work together and learn about each other, and in doing that they will be brought "back to Eden" so to speak because they will gain different perspectives by learning about the new languages, and by getting that perspective humans will be invited to "trust the story" once again.
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/007-the-preface.html b/007-the-preface.html new file mode 100644 index 00000000..d93dd39a --- /dev/null +++ b/007-the-preface.html @@ -0,0 +1,2591 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 007 The Preface | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

007 The Preface

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

7: The Preface

+
2nd September 2021 at 7:04am
+
+ +bema-session-1 + +
+
+

link to podcast

link to presentation

In Hebrew it's obvious, in English it's still noticeable, that Genesis 1-11 is simply a different genre of literature.

Review

Genesis 1

  • Creation
  • Chiasm in and of itself
  • About a God who knows when to stop
  • Centers around rest

Adam and Eve

  • Chiasitc with "nakedness"
  • Tragedy ensues because they don't know how to stop
  • They don't find rest, they find mistrust

Cain and Abel

  • Chiasm
  • Another tragedy that parallels Adam and Eve
  • Cain becomes obsessed with acquiring more

Noah's Ark

  • Another chiasm
  • God reaffirms the goodness of creation by partnering with humanity to save it
  • Here we see God know when to say enough, but about destruction

Noah's Curse +* Another chiasm, hard to see - Marty hasn't nailed the details down +* Noah is obsessed with destruction +** Parallels Cain's obsession with acquiring +* Noah shows mistrust of God, not knowing when to say enough about destruction and curses Canaan with eternal consequences basically

Tower of Babel +* Chiasm around the letters +* Another tragedy

Observations

  • Genesis 1-11 is itself a larger chiasm (see presentation)
    • So what's the center?
    • Genesis 5:28-29
    • Center of this verse is Noah - reiterates that the entire preface is about rest

+When Lamech had lived 182 years, he had a son. He named him Noah and said, 
+“He will comfort us in the 
+labor and painful toil of our hands caused by the grounds the LORD has cursed.
+ 

We are invited through this story of stories to reframe what we think is most fundamentally true about the world we live in. Who are we? Who is God? What does God think about us?

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/008-buried-in-a-geneology.html b/008-buried-in-a-geneology.html new file mode 100644 index 00000000..7ef69c5e --- /dev/null +++ b/008-buried-in-a-geneology.html @@ -0,0 +1,2582 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 008 Buried in a Geneology | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

008 Buried in a Geneology

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

8: Buried in a Geneology

+
3rd September 2021 at 8:08pm
+
+ +bema-session-1 + +
+
+

Presentation link

Why did God choose Abraham?

  • Westerner: God chooses whoever he wants - doesn't matter why
  • Jewish mind: There has to be a reason - the story is written this way for a purpose

Observations

  • Terah has 3 sons
    • Haran, his third son, dies in Ur of the Chaldeans
    • Abram and Nahor take wives or Sarai and Milcah (The daughter of Haran)
  • Sarai was barren
  • Hebrew grammar is all messed up (see below)

Problems

  • Sarai is barren
  • Abram is first-born and we're told his wife is barren
  • Haran is either not married or his wife is not mentioned
    • This would be slightly inconsistent with Milcah and Iscash being mentioned
  • The last born son, Haran, is the first listed in the genealogy of Terah
    • Also Haran is the one with children before the eldest son is even married
  • Milcah is mentioned 3 times but Iscah is only mentioned once
  • Iscah is not mentioned later in the story - so what is the reason?
  • The barrenness of Sarai is mentioned in a weird spot, should be in the previous verse, 3 ideas before but instead it's tacked onto the end of the wife description of Terah's 3 sons.
  • note Nahor married his niece (not unhead of in the ancient world)

Midrash

Teaches that Abram marries Iscah. If you say "Iscah" in a Chaldean tongue it means "my princess" but "Sarai" in Hebrew means "my princess", so there's an idea that Sari and Iscah may be the same person.

Hebrew grammar being messed up (from observations)

  • "Abram and Nahor he took wives" (Genesis 11:29)
    • "took" is singular
  • This same thing is done back in Genesis 9 where Noah's sons, "Shem and Japheth he took blankets"
  • You have a plurality of people deciding to do a benevolent thing together - they are of one mind
    • First named gets the credit, so Shem gets the credit for this
  • So back to the Abram/Nahor thing, then Abram and Nahor are of one mind together, doing a benevolent thing, is to marry their nieces. Their father (Haran) has died who is their protector and it was Abram's idea.
    • Abram ought to be the one who gets to choose between Sarai and Milcah and Iscah (who Midrash teaches is the one that Abram picks and she may then be the same person as Sarai - see note below)
    • They may not know that Sarai is barren, but it seems that the story is written in a way that presumes it is known... how?
      • When a woman menstruates she is given away in marriage because it is the sign her bodyis ready to conceive.
    • Doing the math on the story (whatever this means) makes Iscah/Sarai older, not a young girl - so it would be relatively obvious by age and lack of menstruation that she is barren
      • Abram is not ever "shocked" that Sarai is barren
      • Abram chose the barren daughter, which means that his family line is over.
      • At the very least the story is written in a way that wants us to know that she's barren from the onset
    • Story so far has a focal point on someone's name (Adam, Eve, Cain, ...) and so we have a man, Abram, who seems to not care much about his own name - he's more interested in someone else...

The backend of the chaism of Genesis 1-11

Abram is a man who knows when to say enough and control himself and this is why God chooses him +

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/009-letting-go.html b/009-letting-go.html new file mode 100644 index 00000000..bf0f3595 --- /dev/null +++ b/009-letting-go.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 009 Letting Go | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

009 Letting Go

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

9: Letting Go

+
31st July 2021 at 8:48pm
+
+ +bema-session-1 + +
+
+

Genesis 12

  • Scriptures point out that Abram is leaving his father's household
    • People lived in a "be-dav" which means "house of my father"
    • Patriarch was over a family and everyone rolled up to that patriarch, to leave it was no laughing matter
    • Inherent community following the will of the patriarch (a father)
    • Abram leaving his father's house signifies changing allegiances spiritually - he is leaving Terah's gods for Yahweh
      • Lots of Midrash teachings abour how this might've gone
      • By all accounts the split was supported by Terah
  • Abram's first promise from Yahweh is that the rest of the world will be blessed through him
  • Abram builds an altar in Genesis 12:7
    • There's metaphorical and literal meanings to towers and altars
    • In Babel, we see that God does not want his people, the creation, to settle - they are supposed to be mobile and to go throughout the earth
    • God promises to give Abram land, and according to the Babel narrative we expect Abram to build a tower to his own name
      • instead Abram builds an altar to Yahweh's name, and Abram pitches his tent (he is mobile, not stagnant) and continues moving
  • Genesis 12:10, there is regularly famine and draught as a Biblical theme
    • Abram goes to Egypt due to the famine
    • Goshen always floodsvia the Nile, regardless of draught, so Egypt is always where someone will go in time of draught
    • Abram is a human being... if he was some big epic hero character, than he would NOT be going to Egypt during a draught - he would be the character who just trusts in God and lives his life. But isntead we see something relatable, that Abram takes some of his destiny into his own hands, and we as readers know that there is another narrative in Egypt (other gods, etc) and we expect now that Abram will fall
      • Abram does, but Yahweh also has grace on him
      • Genesis 12:13, Abram has a plan as we can see with his saying "I will be blessed on your account [sarai]"
        • Egyptians will want to court Sarai so they will sucker up to Abram since he (as the supposed brother of Sarai) will receive gifts and what not for Sarai's marital hand
      • Plan backfires because Pharaoh takes and then courts, he doesn't court first. So Yahweh afflicts Pharaho's house... interesting backfiring
  • Genesis 13, Abram and Sarai come "up from egypt"... another freaking chiasm
    • Abram "say you are my sister", Pharaoh "why did you said 'she is my sister'"
    • center is berse 14 and 15... "Egyptians saw that she was a beautiful woman and she was taken into Pharaoh's household"... the center of the chiasm is when the plan backfires... it's the moment when Abram learns that things will not always go as planned.
    • Our question then is "what does Abram do with this newfound knmowledge from here on out in the story"

problems and questions

  • Why are Soddom and Gomorrah named and said they aren't destroyed yet... we don't even know what they are in the story yet
  • verse 7, Canaanites and Perezites are mentioned way too early, right after Abram says "no one else is here, you [Lot] go left and I go right"
    • Almost identical line back in Genesis 12:6 where the Canaanites posession of the land is also mentioned for no apparent reason.
  • Abram claims Sarai is his sister, which is not an outright lie... same with Lot, he is not a "brother" but the word means "close relative". We can't let Abram off the hook for lying, but in the Hebrew it's techincally the truth what he says
  • Why did Abram bring Lot to Egypt in the first place and not Nahor...
    • Terah would still be alive when Abram left, so why is Lot with him?
    • Abram received a promise from Yahweh about many decendendents but Sarah is barren.... Abram brings Lot because Abram knows he needs Lot for his family tree to actually grow

Observations

  • Abram, with the newfound knowledge that his plans don't always pan out, is parting ways with Lot who was his safety net for the blessing that Yahweh promised him
  • Abram and Lot ("Brothers but not really") are arguing in a field (call back to Cain and Able)
    • Lot "looks" (same phrase as when Eve looks at the tree and see), but Abram hasn't looked at all, called out when Yahweh says, after Lot leaves "Abram look up and see all that is yours" - Genesis 13:14
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/010-walking-the-blood-path.html b/010-walking-the-blood-path.html new file mode 100644 index 00000000..6dc8ed32 --- /dev/null +++ b/010-walking-the-blood-path.html @@ -0,0 +1,2583 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 010 Walking the Blood Path | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

010 Walking the Blood Path

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

10: Walking the Blood Path

+
5th August 2021 at 4:54am
+
+ +bema-session-1 + +
+
+

link to podcast

presentation

recap

  • Biblical God is out to save creation, not destroy it
  • God has shown through the Genesis account that he's a God who knows when to stop creating and when to stop destroying - this is part of carrying God's image is that we "should know when to say enough"
    • Means we can't get addicted to productivity and creation, we don't have to keep producing
    • We can rest - thus the focus on sabot (sabbath)
  • At the end of the preface (Gen 1-11) we are introduced to Abram, a man who is willing to put his legacy aside for the sake of righteousness
    • He takes care of Sarai and says that his name isn't as important as someone else's (his brother)
    • So this is why God chooses to partner with Abram, because he is a man who knows when to say enough

Genesis 12-15

  • Twice we have the phrase "Abram said" meaning that there's 2 conversations and the first time Abram expresses concern over not having heirs he doesn't get any answer from God
  • God does answer the second time and shows Abram the stars out of the firmament
  • God knows Abram doesn't need this answer, but Abram and Sarai take the info, but without God's perspective and plan because of their limited foresight, they screw the story up by looking to Hagar as the one who will actually bear the child of the promise
    • Abram demands answers, as we do sometimes, but the answer causes him to mess up his own story - this is one of the lessons of the story

Observations

  • God requests some animals from Abram, and he does but then Abram immediately cuts them in half
    • Shows that Abram knows exactly what God is asking here - God is asking Abram to set up a covenant, a betrothal covenant
  • Also note that eventually birds of prey show up - shows that Abram is extremely hesitant to walk down the blood path it'e because he knows the consequences of breaking the covenant, the covenant is with God, and Abram knows he will fail the standards of the covenant.
  • What is the significance of the blood path
    • In the marital covenant, it's the groom and father of the bride who walk down this aisle
    • There's a covenental agreement that each will keep their end of the bargain, and if not then the other shall do to them as they've done to the animals and walk in their blood
      • The lesser party would go first - so the groom in that case, and Abram in this case
  • So God shows up as 2 theophanies and walks through on both parties behalf
    • Shows that God knows Abram will screw it up but also that God will be the one to make it right (via sacrifice)
    • This is the same principal as the Abram and Isaac story... that at the end of that story, God provides. He provides himself here for Abram and provides the goat for Isaac then.
  • Rabbi Foreman material at Aleph Beta Academy for commentary on Hagar and Ishmael narrative

Genesis 17 +*Like the Noah narrative there is a lot of repetition of the covenant language - it's a chiasm +*Similar structure to the Noah narrative suggests some kind of relationship between them

Observations

  • Center of the chiasm is verse 10 about circumcision
    • In Noah story, God puts the sign of the bow in the sky signifying that he will bare the responsibility for the covenant but here God actually does put the responsibility, the sign of the covenant, on Abraham. The sign is something that can't be forgotten but it does take a step of obedience. This is God handing off some expectation and responsibility to the people he's chosen - it's like he's saying to Abraham "Now that you know a little bit more, I will expect a bit more from you"
    • For us... we are 2k years on this side of Jesus so how much more should we understand about what God expects of us as his chosen people?
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/011-here-i-am.html b/011-here-i-am.html new file mode 100644 index 00000000..f0dfd512 --- /dev/null +++ b/011-here-i-am.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 011 Here I Am | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

011 Here I Am

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

11: Here I Am

+
26th September 2021 at 3:03pm
+
+ +bema-session-1 + +
+
+

presentation

Genesis 18

  • starts with Abraham sitting in a tent (keep in mind that he was just circumcised)
  • Middle-eastern cultural premium on hospitality is really lost on us - but even today this persists because no matter who you ask in the Arab world they are "children of Abraham"
  • Right after being circumcised, Abraham "hurries" to meet the visitors
    • premium on hospitality is really noted here
    • Verse 6 - 3 seahs of flour is ~60 lbs of flour...
    • Verse 7, not sure if "ran" is a good translation, but could be... Patriarchs don't run in this culture, but perhaps this demonstrates that Abraham is not the typical ANE patriarch
  • Big point made here about Abraham is that he is marked as a guy who cares about others, who's hospitable, who does work himself to serve others, etc. He's the kind of guy who God wants to partner with.

Challenge

  • How willing are we to take people, strangers, into our home and feed them until we run out of food?

Genesis 18:16-33

  • Abraham bartering with God for righteous lives in Sodom
  • Note that we have not really seen a wrathful God yet - basically been all about grace once we understand the flood with some context

Genesis 19

  • Kind of skipped over - worth coming back to take some notes
  • Only point made in podcast is that we are often disgusted by Lot's willing to offer his daughters to protect the strangers, and this is a disgusting thing however there's an extreme premium placed on hospitality and we have to keep that in mind when commentating on the story
    • Lot is willing to offer his own family to protect and serve the outsider. Again, it is disgusting, but there's reasons to it and we just have to be careful about imposing our western ideologies onto an ancient text as we interpret.

Genesis 20

  • Abraham repeats his mistake
    • Who can't relate to knowing something is out of bounds but making that decision anyways?

Genesis 21

  • Hagar and Ishmael go sit "a bowshot away" when they are exiled, and Ismael grows up to become an archer
    • Pondering whether or not this is the author's way of saying that the things that happen to us have a real affect on who we become?
  • God hears the cry of Ishmael, not Hagar
    • God hears the cry of the oppressed - point that the podcast will return to later

Problems

  • The genre of literature is changing - Genesis 1-11 is written differently than 12+
  • Sarah kicks Hagar out even though it was her idea in the first place to use Hagar for fulfilling Yahweh's promise of a son
    • Real problem is that Yahweh tells Abraham to just listen to her and actually kick Hagar out
      • This is really an act of compassion as Yahweh knows that he will take care of Hagar but it's Yahweh saying "This isn't how the story was supposed to go - the promise was through Sarah but you took the story into your own hands so now we're in a mess... I will clean it up but the story needs to continue even though you've mucked it up"
  • Somehow Hagar has the gumption to just let her son die (Gen 21:15) - who can imagine this?
    • Abraham didn't pass on Yahweh's promise about Ishmael becoming a nation himself to Hagar
    • Ishmael is a 13 year old boy at this point... the story is either out of place or we're missing something
    • This story and the story of Isaac being sacrificed have been moved in order to sit next to each other

Genesis 22

  • Abraham's testing
  • we are too familiar with this story
  • Every religion that Abraham has ever seen (ANE stuff) demands child sacrifice so to Abraham it is not a surprise to hear that Yahweh demands it as well
  • See presentation link above for some notes on the parallels between this story and the story of Ishmael
    • So we should look for things that are similar in these stories to see how they build on top of one another
  • "Here I am" is not a Hebrew word/phrase here - it's a passing conjugation, we only know what it is from context (maybe like when someone says 'hey Nic' and I say "yo" as a response?)
  • Chiasm shows up here with center in verse 7 "Yes, my son"
    • Imagine being a dad and walking to the spot where you are going to sacrifice your son... how are you going to talk to your son?
    • Isaac "spoke up" (Hebrew implies that he interrupts Abraham who may just be making small talk to avoid the conflict about to happen)
    • Issac says "Father" (It's like Issac is interrupting Abraham's rambling to say "daddy?")
    • Abraham responds with "hin en-ni" (Here I am), which is a Hebrew conjugation that also bookends this chiasm
      • It's an implication that Abraham is telling his son "I will not leave you", and it's the same response Abraham gives to God when he is called
      • This is juxtaposed against Hagar's story as she does leave her son initially
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/012-a-mission-realized.html b/012-a-mission-realized.html new file mode 100644 index 00000000..e08cfec7 --- /dev/null +++ b/012-a-mission-realized.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 012 A Mission Realized | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

012 A Mission Realized

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

12: A Mission Realized

+
27th September 2021 at 7:00am
+
+ +bema-session-1 + +
+
+

link to podcast

Note on circumcision

  • Possible that Egypt was practicing priesthood circumcision prior to the sign given to Abram which is still cool because it shows God re-purposing human's existing culture for his purposes
    • Egypt presumably circumcised priests as a sign of priesthood
    • Yahweh circumsises all males - indicative of God's redemptive plan that finds its culmination in Jesus, wherein all people who are redeemed are priests (kingdom of priests from Peter)

Genesis 24 and 26

  • Isaac needs a wife

Observations

  • Hand under the thigh is an idiom to the groin, and the oath is sworn by holding the sign of the covenant (this is obviously nothing sexual, it's a cultural way to make an oath)
  • Abram wants to find a wife for Isaac from Nahor or about where he's from, not from the Canaanites
  • To water a camel takes 10-20 trips into a cistern, so Eliazer's request is that a woman offers to make ~100 trips into the cistern just to water his camels - he's asking God to provide something ridiculous
    • Wondering if this is Eliazer looking for his freedom by requesting something that will never happen so that he can just be done?
  • Isaac repeats the sin of Abraham wherein he tells Egypt that Rebekah is his sister and not his wife
    • Remember this happened twice in Abraham's life: first to Egypt and second to a king by the name of Abimelech
      • MIGHT be, but probably a son, of the same guy who Isaac lies to
  • Isaac's life is starting, in the Bible, with right about where Abraham's life leaves the story in Genesis 20
  • Another parallel to Abraham in Egypt is that Isaac becomes very wealthy in Gerar
  • Another retelling of Abraham happens in verse 20 where herders fight over land (Abraham and Lot)
    • Looks like Isaac retells, in reverse, Abraham's story and is redeeming parts of it
    • Genesis 26 is the reverse story of Abraham

Story for Us

  • Over the course of 2 generations, the mission of God to bless all nations starts working....
  • Isaac builds wells multiple times over that the nations take from him, and he just submits and moves on
  • How often in our world do we not trust in forgiveness and just submitting to the world but persevering in godliness
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/013-grappling-with-god-part-1.html b/013-grappling-with-god-part-1.html new file mode 100644 index 00000000..99c371fa --- /dev/null +++ b/013-grappling-with-god-part-1.html @@ -0,0 +1,2605 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 013 Grappling with God - Part 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

013 Grappling with God - Part 1

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

13: Grappling with God - Part 1

+
30th September 2021 at 5:15am
+
+ +bema-session-1 + +
+
+

link to podcast

Abraham -> Issac -> Jacob and Esau

Text

Genesis 25:19–34 (LEB)
+19Now these are the generations of Isaac, the son of Abraham. Abraham fathered Isaac, 
+20And Isaac was forty years old when he took Rebekah, the daughter of Bethuel the Aramean of Paddan-Aram, the sister of Laban the Aramean, as his wife. 
+21And Isaac prayed to Yahweh on behalf of his wife, for she was barren. And Yahweh responded to his prayer, and Rebekah his wife conceived. 
+22And the children in her womb jostled each other, and she said, “If it is going to be like this, why be pregnant?” And she went to inquire of Yahweh. 
+23And Yahweh said to her, “Two nations are in your womb, and two peoples from birth shall be divided. And one people shall be stronger than the other. And the elder shall serve the younger.” 
+24And when her days to give birth were completed, then—behold—twins were in her womb. 
+25And the first came out red, all his body was like a hairy coat, so they called his name Esau. 
+26And afterward his brother came out, and his hand grasped the heel of Esau, so his name was called Jacob. And Isaac was sixty years old at their birth. 
+27And the boys grew up. And Esau was a skilled hunter, a man of the field, but Jacob was a peaceful man, living in tents. 
+28And Isaac loved Esau because he could eat of his game, but Rebekah loved Jacob. 
+29Once Jacob cooked a thick stew, and Esau came in from the field, and he was exhausted. 
+30And Esau said to Jacob, “Give me some of that red stuff to gulp down, for I am exhausted!” (Therefore his name was called Edom). 
+31Then Jacob said, “Sell me your birthright first.” 
+32And Esau said, “Look, I am going to die; now what is this birthright to me?” 
+33Then Jacob said, “Swear to me first.” And he swore to him, and sold his birthright to Jacob. 
+34Then Jacob gave Esau bread, and thick lentil stew, and he ate and drank. Then he got up and went away. So Esau despised his birthright.
+

Notes

  • Name literally means heel grabber
  • Esau is the behor - firstborn son
    • He has the responsibility to carry on the legacy of his father
    • The firstborn gets a double portion
      • Not just about blessing
      • He has a double portion of responsibility
  • Promises of Abraham were being realized in Issac in the previous stories
    • This story is supposed to now follow through into Esau
  • Jacob appears to wish to be the first-born
    • Esau apparently doesn't care about the privilege of the first-born shown in him forsaking his double portion

Text

Genesis 27

Notes

  • Story of Rebekah setting up the the situation for Jacob to receive Esau's blessing
    • Multiple possibilities to how and why Rebekah set this up
    • Did God tell Rebekah how the story was to go and she then took it into her own hands (like Abraham with Lot?)
    • Is this story illustrating that Rebekah is just as deceitful as her son?
  • Q: Why does Isaac just "take it back" (the blessing crafted for Esau that he preaches over Jacob)
    • Eastern culture, "word is power" (Genesis 1)
    • Once the blessing is out of Isaac's mouth, the words have gone forth and they have power over their subject

Text

Genesis 28

Notes

  • Jacob has to flee, so he goes back to Terah's house meaning that he goes to Nahor
    • This is the only bedav that he can be apart of if he leaves Jacob's (Isaac's -> Abraham's bedav)
    • Looking ahead we know that Jacovb will go toe to toe with Laban - the grandson of Abraham and the grandson of Nahor trying to out-deceive one another.
Genesis 28:11 ESV
+And he came to a certain place and stayed there that night, because the sun had set. Taking one of the stones of the place, he put it under his head and lay down in that place to sleep.
+
    • Jacob is in the "middle of nowhere's nowhere" and the dream he has (Jacob's ladder) teaches us that God is present, his holiness is with us, no matter where we go.

Text

Genesis 29

Notes

  • Leah is Laban's first daughter
    • Described as having "weak eyes" (means that she's not very attractive)
  • Jacob falls in love with Rachel
    • Rachel is said to be "beautiful in form and appearance"
  • Nic: So it's somewhat clear that Jacob goes after what he finds attractive, not necessarily what God finds attractive
  • Jacob meets his match with Laban
    • Deceived out of 7 years of work and is given Leah

Genesis 30

Notes

  • A usurping competition kind of kicks off between Jacob and Laban
  • Jacob eventually amasses his own house and has to leave Laban's be-dav (end of Genesis 30)
  • Jacob somehow swindles Laban out of much of his flock
    • Looks as though God is behind it though - somehow God sees this as a fit method to bless Jacob
    • Parallel between this story and Joseph's story that we'll get to later on
    • Otherwise we don't have a ton of details about how and why Jacob carries out this sticks and watering thing
    • Jacob claims he had a dream about this from God (Genesis 31:10) but we have no way to confirm Jacob's claim

Problems

  • I have no idea what's going on with the first part of Genesis 30 - Rachel and Leah giving Abraham their servants and the thing with the mandrakes... I see how it explains the size of Jacob's household, and why he must leave Laban (Genesis 30:25) but the entire structure and the responses of the characters is just very strange.

Genesis 31

Notes

  • Jacob and Laban eat a meal together at a heap of stones (Genesis 31:46) which sort of indicates that they are seeking reconciliation... Meals in the ANE were only shared, you only broke bread with someone, who was in right relationship with you - never with an enemy (according to Marty)
    • They argue a bit over what to name the place and scripture settles on Mizpah
    • Laban sets up a second pillar becuase he wants to honor his god (Yahweh isn't good enough - Laban has his own household, own idols, own god(s))
      • Laban is swearing by Terah's gods? (31:53)
Genesis 31:53 (ESV)
+53The God of Abraham and the God of Nahor, the God of their father, judge between us.” So Jacob swore by the Fear of his father Isaac,
+
  • Jacob and Nahor eat another meal after this...
Genesis 31:54 (ESV)
+54and Jacob offered a sacrifice in the hill country and called his kinsmen to eat bread. They ate bread and spent the night in the hill country.
+
    • This is somewhat indicative that they really do not have a solid reconciled relationship....

Big Question: Why does God choose to work with this guy?

God has to choose between 2 guys - Jacob and Esau. One is motivated, the other is a rule follower who is safe, clean, etc. but just doesn't care (gives up the birthright). God can help steer a moving target, and correct methods, but God's partner need to be able to do something. It's easier to move the moving target then get a stale target moving.

The motivation of Jacob, in general, is called chutz-pah


+: supreme self-confidence : nerve, gall It took a lot of chutzpah to stand up to him the way she did.
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/014-grappling-with-god-part-2.html b/014-grappling-with-god-part-2.html new file mode 100644 index 00000000..ce1702d3 --- /dev/null +++ b/014-grappling-with-god-part-2.html @@ -0,0 +1,2591 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 014 Grappling with God - Part 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

014 Grappling with God - Part 2

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

14: Grappling with God - Part 2

+
4th October 2021 at 6:47am
+
+ +bema-session-1 + +
+
+

link to podcast

Summary

  • Life of Jacob so far has been full or usurping and lying
  • Laban is somewhat of his match
  • Jacob ended up with Laban because of swindling Esau, so he can't stay in Isaac's be-dav because Esau wants to kill him
  • Jacob tehn has to leave Laban's and be his own be-dav
  • Jacob is a guy who wants more - back to why God chooses who he chooses, Jacob strives and seeks to do things.

Wresting with God

Genesis 32:24–32 (ESV)
+24And Jacob was left alone. And a man wrestled with him until the breaking of the day. 
+25When the man saw that he did not prevail against Jacob, he touched his hip socket, and Jacob’s hip was put out of joint as he wrestled with him. 
+26Then he said, “Let me go, for the day has broken.” But Jacob said, “I will not let you go unless you bless me.” 
+27And he said to him, “What is your name?” And he said, “Jacob.” 
+28Then he said, “Your name shall no longer be called Jacob, but Israel, for you have striven with God and with men, and have prevailed.” 
+29Then Jacob asked him, “Please tell me your name.” But he said, “Why is it that you ask my name?” And there he blessed him. 
+30So Jacob called the name of the place Peniel, saying, “For I have seen God face to face, and yet my life has been delivered.” 
+31The sun rose upon him as he passed Penuel, limping because of his hip. 
+32Therefore to this day the people of Israel do not eat the sinew of the thigh that is on the hip socket, because he touched the socket of Jacob’s hip on the sinew of the thigh.
+
  • Jacob wrestles with a man, but the NT says Jacob wrestled with God

Meeting Esau

  • Jacob sends groups of his be-dav first to meet Esau
    • Almost certainly he sends them in reverse order of importance to himself... Leah first, then Rachel, then even himself
  • After Jacob wrestles with God and Esau forgives him, Esau offers protection and to live in reconciled relationship but Jacob continues to lie and he doesn't follow up by going to Seir with Esau, but instead he goes to Succoth

Rape of Dinah

  • Dinah is taken into the house of the king of Shechem
  • Her brothers then plan for revenge
    • Their manner of planning looks similar to their father, Jacob - full of deceit
  • At the very end of this story (Genesis 34:30-31) Jacob seems super concerned with himself still - kind of forces us to question whether the story of him wrestling with God above, is actually a turning point for Jacob... His name is changed but he so far very much hasn't

Second Name Change

  • In first part of Genesis 35, they go up to Bethel and Jacob builds an altar
    • Him building the altar looks like he's just trying to work the system - he never "builds an altar and calls on the name of the Lord", Jacob only ever builds the thing
  • Jacob's name is changed a second time in 35:10 <– Indicative of a chaism here?

Genesis 35:11

  • Be fruitful and multiply - Adam and Eve, Noah.
  • Jacob is told the same thing as these two stories so we expect a few things:
    • More children mainly
    • With Noah in our head, and the story of creation, we expect that there will be tragedy with the next child, and someone will have to take the blame (mainly with Noah in mind who blames Canaan and curses him for Noah himself not having his next child, which again was hinted at with the 4 rivers)

What followed

  • Rachel dies giving birth to Ben-oni who Jacob renames Benjamin
  • End of Genesis, Jacob blames himself for Rachel's death (not clear in English)
    • Back when someone stole Laban's idols, Jacob tells Laban that if anyone stole them, they will die. It was Rachel who stole them but kept it hidden, so at the end of Jacob's life he blames himself.
    • See the parallel to Noah blaming Ham for the loss of his (non-existent) 4th son
    • Jacob here also finally confronts himself - the only real true love of his life was Rachel, and he own the curse he put on her even unknowingly
    • Jacob's name, Israel, can mean 2 things... "Conquered God" or "God conquered"
      • Marty makes an argument that the name change means "Conquered God" the first time when Jacob wrestled with God - and God honors Jacob's "hutz-pah", but the second time is when God conquered Israel and God won. Becuase it's after Rachel's death that Jacob changes and starts to actually love, and fear losing, the things he has.
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/015-into-the-pit.html b/015-into-the-pit.html new file mode 100644 index 00000000..8c8a85ef --- /dev/null +++ b/015-into-the-pit.html @@ -0,0 +1,2589 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 015 Into the Pit | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

015 Into the Pit

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

15: Into the Pit

+
8th October 2021 at 7:11am
+
+ +bema-session-1 + +
+
+

presentation: https://bemadiscipleship.s3.us-east-2.amazonaws.com/BEMA+015+Into+the+Pit.pdf

Text

Genesis 37-40

Observations

  • Joseph lacks some wisdom here... brings a bad report of his brothers to Jacob but then goes about sharing this dream where he is a ruler over them
  • Note Every son would have had a coat like Joseph had, but Joseph has a second coat - we know this by the text saying that Joseph's brothers know Jacob loves Joseph more. That is Jacob telling his other sons who he is claiming to be the be-hor (first born - double portion)
    • This is why the brother's reaction is so extreme
    • The point is not really about the colors of the coat (Q: so what is that significance? - something about the Rainbow and sign of Noah maybe??)
  • Shcechem is mentioned 3 times really fast
    • Saw this last in the story of Dinah
    • In that story Jacob says that his sons have "made [me] a stink to the people of Schecham"
    • First mention of Schechem is in Genesis 12 right after Abraham's blessing to go and bless all nations
    • First mention is where God gives his people the mission to bless all people, next mention is exactly that family doing the exact opposite of the mission
      • This mention feels like of odd, and it doesn't show up again in the book of Genesis
  • Reuben steps in to try and save Joseph's life when his brothers want to throw him down a well and kill him
    • Reuben is actually the be-hor, the first born, so he seems to want to do the right thing and protect his brother, he wants the responsibility of the be-hor
    • Q: Why is Reuben gone when Judah steps up and says to sell Joseph??
    • Reuben then has to represent an idea that he was never in favor of, to Jacob and this might cause a major rif in the family which may explain why Judah leaves in the very next story
  • Judah's story is right in between Joseph being sold to Potiphar in Egypt and then the story of Joseph in Potiphar's house picking back up, so Judah's story here is very much interjected right in the middle of Joseph's story
    • Timeline doesn't make a ton of sense, Judah is now older, has kids, wives, etc.
    • The author of Genesis puts these stories together on purpose
    • Genesis 37 and 38 have a lot of parallels
  • In Genesis 39 we have Joseph and Potiphar's wife
    • It's Joseph's cloak that incriminates him in Potiphar's eyes... seems like a parallel to Joseph's coat from Jacob
    • Coats in Genesis 37-39 almost feel like "nakedness" in Genesis 1-3
  • Marty is hard on Joseph, I see his points - Joseph is really concerned with himself but there's faithfulness to God language kind of peppered in (see Genesis 38:7-9)
Genesis 39:7–9 (LEB)
+7And it happened that after these things his master’s wife cast her eyes on Joseph, and she said, “Lie with me.” 
+8But he refused and said to his master’s wife, “Look, my master does not worry about what is in the house, and everything he owns he has put in my hand. 
+9He has no greater authority in this house than me, and he has not withheld anything from me except you, since you are his wife. Now how could I do this great wickedness and sin against God?”
+
  • God's covenant people are really spiraling out of control - Abraham and Issac have their shortcomings but their stories are definitely full of men who learn and repent, then Jacob is very unrepentant for most of his life but has the hutz-pah, the fire to keep going and God can work with that. But we now focus in on Joseph, and what does he have? It seems like he just is self-centered and there isn't that hutz-pah... Now I have a hard time unlearning my understanding of Joseph as a man of great faithfulness to God, so seeing Marty's take on this is challenging.
  • In defense of Marty's point on Joseph, here is his self-centeredness in the prison

+Genesis 40:14–15 (LEB)
+14But remember me when it goes well with you, and please may you show kindness with respect to me, and mention me to Pharaoh, and bring me out of this house. 
+15For I was surely kidnapped from the land of the Hebrews, and here also I have done nothing that they should put me in this pit.”
+Genesis 40:14–15 (LEB)
    • Here Joseph is really focused on himself, his innocence, and his freedom
    • Joseph asks that the cupberar shows kindness (he-sed) to him, which is a major point of God from Exodus 32 - he is a God full of "faithful love", he-sed... now sure what this means.
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/016-out-of-the-pit.html b/016-out-of-the-pit.html new file mode 100644 index 00000000..53e176c4 --- /dev/null +++ b/016-out-of-the-pit.html @@ -0,0 +1,2599 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 016 Out of the Pit | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

016 Out of the Pit

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

16: Out of the Pit

+
11th October 2021 at 7:36am
+
+ +bema-session-1 + +
+
+

link

Text

Genesis 41-50

Observations

Midrash about reeds

Genesis 41:18 (LEB)
+18and behold, seven cows, well built and fat, were coming up from the Nile, and they grazed among the reeds.
+

reeds is a hard word to translate - there is a Jewish teaching (midrash) that it means "brothers"

dreams

When Joseph is in prison and the cup-bearer and baker have dreams it is said that "no one was there to interpret" meaning that there's no magicians or anything around who can listen to them to interpret - makes sense because they're in jail. +This story is different in that Pharaoh has access to every resource in Egypt but it's said that "there is none to interpret it" (Gen 41:15).

How does Joseph just jump in right away and start interpreting - seemingly without even prayer?

According to the midrash about reeds being brothers, the number seven immediately signifies years. Pharaoh's dream is actually very similar to the Rachel and Leah story - and it's like when Pharaoh says his dream what Joseph hears is God talking to him about his life...

  • Jacob worked 7 years for the "ugly" wife and 7 more for the beautiful wife
  • This plays backwards - there will be 7 beautiful years and then 7 years of famine.

After interpretation

Joseph tells Pharaoh to find a wise man (is this Jacob-ish behavior? Is Joseph hinting that he should be chosen because he's looking out for himself and doesn't want to go back to the dungeons)... Is Joseph demonstrating some hutz-pah here? Is this the reason God chose this family?

There hasn't been a lot of trusting the story from Jacob and Joseph, not like Abraham and Issac, but the Tanakh teaches that this family is "stubborn and stiff" a lot, which is like their hutz-pah, their drive and desire, and that this is why God chose them

Parallels

Joseph

In the narrative about Jacob and Joseph

  • Joseph gets a cloak from his dad
  • Joseph has dreams and tells them to his brothers
  • His coat is stripped
  • He's then thrown into a pit

In the narrative of Joseph and Potiphar/Potiphar's wife

  • Joseph gets gifts from Potiphar, he's elevated in his household just like he was by Jacob
  • Potiphar's wife has "dreams" - this word is too literal, really she has "aspirations" which are to sleep with Joseph
  • His cloak is stripped by Potiphar's wife
  • He's then thrown into a dungeon (but the same word is used as in the Jacob narrative, pit, which is never translated dungeon... shame on English)

In the Pharaoh and Joseph narrative

  • Jacob is brought up from the pit
  • A coat is put on Jacob by Pharaoh
  • He interprets dreams
  • He's given gifts by Pharaoh

Judah

These stories sit in between the narratives above

Judah and Tamar

  • Clothes and gifts are given to Tamar
  • Judah actually says very similar words to Tamar as Potiphar's wife to Joseph
  • Dreams?

Cup-bearer and Baker

  • Gifts are given to Joseph by the head guard
  • There's dreams and Joseph listens
  • Cup-bearer is pulled from the pit
  • Cup-bearer restored with clothes

Not sure what to do with all these parallels yet

Where is the pit with Judah and Tamar?

So at this point in the story Joseph is probably forced to really wrestle with his identity.... he's under Pharaoh in Egypt now and his dad never came for him so he needs to reckon with who he really is now

Joseph in command

text: Genesis 42

observations

  • The emphasis Joseph puts on the "nakedness of the land" feels like a callback to a lot things
    • Creation
    • Noah
  • Joseph puts his brothers in prison (pit? the word is different but the symbolism is certainly there)
  • Reuben rebukes his brothers by recounting their guilt regarding Joseph, but the text says Joseph understood them because "the interpreter was between them"... Why would Joseph need an interpreter?
  • Joseph then gives his brothers gifts of grain and returns their money (we are seeing parallels just like above)

Joseph's brothers come to Egypt to get food to prepare for the famine but Benjamin is not with them. Now Joseph was probably closest to Benjamin as the 2 youngest, as the son of Rachel, etc. +So Joseph starts to come up with kind of a sneaky plan of his own and coerces his brothers to bring Benjamin to him. Joseph keeps Simeon as a type of collateral. +

text: Genesis 43

  • We're definitely a while from Genesis 42 as they've eaten all the grain they originally brought back... so Simeon has just been in prison this whole time
  • Reuben guarantees Benjamin's safety by offering to replace Jacob's 2 lost sons with his 2 own sons but Jacob refuses
  • Judah guarantees Benjamin's safety as they go to Egypt and puts his own life on the line and Jacob agrees?
    • When Judah starts the conversation the text switches from calling Jacob "Jacob" to "Israel"
    • In Genesis 38 Judah leaves the family, after the brothers come back and Joseph is not with them, and this is where the Judah and Tamar story happens
    • Judah learned a unique lesson about justice... after Tamar reveals the truth to him he says "She is more righteous than I"
    • Judah takes this newfound knowledge and offers justice to Jacob which gets Jacob to become "Israel" (now he's acting like the one God chose, not the self-interested heel grabber Jacob)

Full circle

The family of God brings the story full circle with Joseph (honestly, Marty's points here were not well-summarized and on one listen it was hard to put the pieces together)

It's that with Joseph the family learns forgiveness and gives up the Cain and Abel narrative and retributive justice, but they choose forgiveness and trusting the story

  • Theme of Judah and Benjamin saving each other repeated over and over
    • Judah puts his life on the line here for Benjamin
    • Go forward to David (a descendant of Judah) and Jonathan (a descendant of Benjamin) and Jonathan saves David - Benjamin saves Judah
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/017-a-god-who-hears-the-cry.html b/017-a-god-who-hears-the-cry.html new file mode 100644 index 00000000..72406c74 --- /dev/null +++ b/017-a-god-who-hears-the-cry.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 017 A God Who Hears the Cry | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

017 A God Who Hears the Cry

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

17: A God Who Hears the Cry

+
15th October 2021 at 6:51am
+
+ +bema-session-1 + +
+
+

link to podcast

link to presentation

Narrative of God start here after Preface (Genesis 1-11) and the Introduction (Genesis 12-50)

Today is a break from the text - big picture stuff

Haga - onomatopoeia for a lion's growl while hunched over its prey. Proverbs uses this word for meditation (meditating on the law of the Lord day and night)

Questions

  • Why does God show up to kill Moses?
  • How does Zipporah know exactly what to do in Exodus 4?
  • Why is Moses' son not carrying the sign of the covenant in the first place?
  • What has been Moses' experience in this story?
  • What kinds of things stand out to us about this story?

Moses

  • A circumcised Hebrew who is raised on Pharaoh's house
  • After he killed the Egyptian he flees
  • Moses must've been struggling with his identity..
    • He carries the sign of the covenant, circumcision
    • He watches the Israelites be oppressed by his own Egyptian household
    • Moses' son might not have been circumcised because that would be Moses aligning himself with Hebrew people, and him being raised in Pharaoh's house may have led him to not feel like a part of Yahweh's family. This might be Moses' statement that he is no longer apart of Israel
  • God reveals himself at the burning bush, and more or less tells Moses that it's not about his qualifications
    • Fits with the idea that Moses has this identity crisis going on
    • Moses is called out of exile, out of his identity crisis, back into God's people
  • Genealogy in Exodus 6 is about proving to Moses himself that he's exactly who he doesn't feel qualified to be - a member of the Hebrew people, Israel, whom Yahweh chose
  • Moses actually is the most qualified person God could choose for this job
    • Raise in Pharaoh's house
    • Has royal training
    • Knows Pharaoh's family
    • Familiar with the ins and outs of Egypt

chathan

  • "bridegroom of blood" (in Exodus 4) or "son-in-law" (back in Sodom and Gomorrah story Genesis 19:12,14)
  • 3 other words show up in these 2 stories almost exclusively
    • Rasha means "wicked" in a unique way
      • First 4 in these two stories, Genesis 18:23,25 then Exodus 2:13;9:27 which serve as bookends to the Exodus story
    • tsa'aqah - cry of oppression, you are a victim of injustice
      • Appear 5 total times
      • appears twice in Genesis 18:21;19:13 then again in Exodus 3:7,9,
      • Slight exception from Esau who lets out a "tsa'aqah" when Jacob steals the blessing
    • Shaphat - judge (restorative, not retributive)
      • Genesis 18:26;19:9 and Exodus 2:14;5:21

When there is a wickedness that causes the bitter cry of oppression, God will hear their cry and come to give judgement that restores order to the chaos

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/018-a-tale-of-two-kingdoms.html b/018-a-tale-of-two-kingdoms.html new file mode 100644 index 00000000..35ac60f4 --- /dev/null +++ b/018-a-tale-of-two-kingdoms.html @@ -0,0 +1,2584 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 018 A Tale of Two Kingdoms | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

018 A Tale of Two Kingdoms

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

18: A Tale of Two Kingdoms

+
18th October 2021 at 7:04am
+
+ +bema-session-1 + +
+
+

link to podcast

God Heard Their Cry - YT

Biblical narrative vs Egyptian narrative

That the World May Know

Biblical narrative - God speaks order out of chaos, and then creation drags itself back into chaos

Egyptian narrative:

  • Re hovers over a murky swamp and accidentally brings the world into being
  • Pharaoh is much like a chief priest in Egyptian cosmology - it is up to Pharaoh to maintain order
    • Creation is in a vault and there is water above and water below and it is up to Pharaoh to maintain the order or else the world would come crashing down (contrast with Biblical narrative where God speaks order and creation obeys)

We can buy into the Biblical narrative (one of trust) or the narrative of Egypt (one of fear) - Empire vs Shalom

God Heard Their Cry

  • Goshen is the best top soil in the world - Israel originally was sent to Israel now in slavery but as a nomadic people they were given the greatest farmland they could ask
  • Israel used the best metal tools of the day, thanks to Egyptian furnaces, to farm the land
  • Israel did give into Egyptian gods, they "stood one foot in barley and one foot in empire"

God's new question is "How do I get Egypt out of my people?"

  • God does this by giving them empire, similarly to how God gives his people a king when they want a king instead of to simply follow Yahweh
    • Israel then participates in Empire, but they are now at the bottom... they can't have one foot in and one foot out and expect to continue to receive God's blessing during their rebellion
  • God needs a leader, a partner, to help lead his people out of Egypt

Plagues

Competition between the gods of Egypt and Yahweh

  • The sticks to snakes actually says that "Moses' stick swallowed up the magician's sticks", not the snakes... The point is the sticks, which represent power - like a scepter and God's stick is swallowing up Pharaoh's stick

God is out to redeem his people, and to also "let the Egyptians know that Yahweh is God"... he's not mad at Egyptians, he's mad at Pharaoh.

Marty uses Obama's and Trump's inauguration speeches together to show how regardless of our political convictions, essentially our government without Yahweh is all about Empire.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/019-a-strengthened-heart.html b/019-a-strengthened-heart.html new file mode 100644 index 00000000..9893c54c --- /dev/null +++ b/019-a-strengthened-heart.html @@ -0,0 +1,2584 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 019 A Strengthened Heart | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

019 A Strengthened Heart

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

19: A Strengthened Heart

+
1st November 2021 at 7:35pm
+
+ +bema-session-1 + +
+
+

link to podcast

Questions

  1. Why name it "passover"?
  2. Why is firstborn so important?
    1. Jews put Tefillin on their arms as a means of "binding the law to their bodies"
    2. In the Teffilin (little black boxes) is a piece of parchment with 3 laws written on it
    3. Shema
    4. Love the Lord your God with all your heart, soul, mind, strength (interesting commentary on this from Tim Mackie by the way)
    5. Exodus 13:13 (ESV): 13 Every firstborn of a donkey you shall redeem with a lamb, or if you will not redeem it you shall break its neck. Every firstborn of man among your sons you shall redeem. <– what the what?
  3. Ultimately Yahweh says to Pharaoh "Give me my firstborn or I will take yours"
    1. Israel is not God's firstborn?
  4. Why 10 plagues? Why did God take so much time to accomplish the Exodus?
  5. When Moses gets to Pharaoh he asks for him to let God's people go just for 3 days... why 3 days?
  6. Does God harden Pharaoh's heart or does he harden his own?
  7. Why does Pharaoh seem so concerned with certain things...
    1. Plague 2 - Pharaoh asks for frogs to be gone "tomorrow"
    2. Livestock are plagued later - Pharaoh doesn't seem concerned about his own but asks if the Israelite livestock are still alive
    3. Pharaoh seems unconcerned with power, but very concerned with precision...
  8. When Moses gives his speech to Pharaoh demanding that he let the Israelites go, Moses responds to Pharaoh's denial with "Well let us go for 3 days or else Yahweh well punish us - The Israelites", but it would make better sense for Moses to lean on Yahweh's power to Pharaoh as a threat (This only makes sense because the reality of our God is that this threat could be real.. it's not empty),
  9. God hasn't been concerned with his own name up until this story of the Exodus, but now all of a sudden he really cares, and reiterates his name, I AM that I AM, to Moses multiple times
    1. God says he used to be known as "El Shaddai" [Genesis 17:1] when it came to Abraham, Isaac, and Jacob. "El Shaddai" if you take the Hebrew consonants and make a sentence out of them translates to "The God who said to his world, enough". Rabbi Fohrman's point is that Yahweh's fundamental posture towards his creation is not one of power, but of self-control - knowing when to say "enough". This is the name God has been known by up until now.
    2. YHWH refers to timelessness

Polytheism vs Monotheism

  1. An inherent problem with polytheism is that it demands indirect relationship whereas monotheism demands direct relationship
  2. Pharaoh's world is full of a plurality of gods who compete with each other, they don't work together - if it rains then the rain god is exerting power over another god, etc.
    1. This explains why he is so concerned with precision above - he knows gods contend with one another, but can one god know that he will be in power tomorrow? -> this is Pharaoh's question to Moses
  3. Moses uses Pharaoh's worldview as an appeal when asking to go to the wilderness - he first asks for permission to go have relationship with Yahweh and when Pharaoh says "no", Moses responds by framing Yahweh as one of Pharaoh's gods, saying Yahweh will be angry if his people do not go worship him.

Hardening of Pharaoh's Heart

There are 2 words used for this in the Exodus story - kavad - stubbornness, and hazak - strengthened

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/020-with-all-your-heart.html b/020-with-all-your-heart.html new file mode 100644 index 00000000..479d088f --- /dev/null +++ b/020-with-all-your-heart.html @@ -0,0 +1,2586 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 020 With All Your Heart | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

020 With All Your Heart

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

20: With All Your Heart

+
23rd October 2021 at 6:54pm
+
+ +bema-session-1 + +
+
+

link to podcast

download presentation here

Exodus 14

See images in presentation

  • God's people cross the "sea of reeds" not the "Red Sea"... no idea why English translations have done this forever
  • There are 19 academically sound ideas of where Mt. Sinai is... there are also a ton of possible spots at which Moses and the Israelites crossed the sea of reeds, it's just impossible to know the exact spot when looking at a map (modern or ancient)
  • Moses' staff represents a lot of things:
    • The juxtaposition of Empire with Shalom
    • Yahweh's power over everything
    • Deliverance vs slavery
  • Eastern wind (ruach) may symbolize judgement from God (judgement from the East)

Kingdom

We don't see kingdom until Exodus 19 but it is taught in Judaism that for God's Kingdom to come there are 3 things that happen:

  1. The finger of God works (Magicians in Exodus story tell Pharaoh to back off because this "is the finger of God")
  2. People call on the name of YHWH
  3. Yahweh's people are obedient

Testing

  • Tradition says God tests his people 3 times - they're heart, soul, and might
  • Eastern vs Western testing... Testing in the East is not a pass/fail thing, it is a thing which reveals something... Testing reveals truth
  • Deuteronomy 8 - "to humble you and to test you in order to know [yada] what is in your heart"
    • yada has sexual overtones, it refers to an in-depth knowing
    • yada is experiential, not cerebral; it's experience, not facts
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/021-with-all-your-soul-very.html b/021-with-all-your-soul-very.html new file mode 100644 index 00000000..626b74eb --- /dev/null +++ b/021-with-all-your-soul-very.html @@ -0,0 +1,2589 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 021 With All Your Soul & Very | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

021 With All Your Soul & Very

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

21: With All Your Soul & Very

+
7th November 2021 at 6:30pm
+
+ +bema-session-1 + +
+
+

link

Presentation

Exodus 16

  • People grumbling during the wandering
  • Verse 4 - Yahweh promises to bring bread
  • Verse 7 - Moses is harsh with Israel and they are silent (indicated by verse 8 "Moses also said")
  • Verse 8 - Moses brings up meat, which was not promised by Yahweh, but Yahweh will honor Moses' word

omer measurement. Some Israelites gather more, some less. +God uses the manna to test the Israelites - what is really in their heart? Will they trust him or try to gather on the Sabbath? (obviously some try to gather on the Sabbath, just as some gathered too much during the week and it turned bad)

  • Verse 18
    • - 2 ways to read this...
    • First is that everyone gathered whatecer they felt necessary but when they all came back they all ahd the same amount (ie. some miracle)
    • Second is that everyone gathered what they could, and when the total as divided up by the omer, each member of the community had exactly what they needed.

The second way of reading would indicate that Israel is in fact learning some of the lessons we expect them to learn - and yes they'll still fail, even in this very story, but it might indicate that their hearts are being formed and changed by Yahweh

Psalm 78

    • lsrael put God to the test in the wilderness
    • Israel had cattle and stuff when they left Egypt, so they had meat, they had things they wanted. But Psalm 78 makes it clear that they demand specific kinds of food, specific wants of theirs, of Yahweh and test him by demanding those things.

Exodus 17

  • Verse 4 - Moses lets out a Zedka, which is a cry of oppression. He is clearly actually worried for his own life here
  • Vrese 5 - Yahweh's response is to tell Moses to go in front of the people and perform a miracle, kind of submitting to the people's demands actually
  • Verse 5 - Moses and the elders are anywhere from 11-19 miles away from Sinai still, depending on where it is. So he has to walk 10+ miles, on foot, with the elders, to show them something that they're demanding to see... We need to not forget the humanity present in this situation
  • Moses is to "strike" (Viya) the rock, the mountain. This is the same word for when Moses "struck down" the Egyptian. This is Yahweh calling on something in Moses' own story and calling him up
  • God is also telling Moses to strike him - God is putting himself in as the provider/the one who will pay the price on behalf of his people

Amalekites

  • Desert-raiders who attacked wandering groups from the rear. They are judged hard by God throughout the story for how they treat humanity.
  • Israel learns from them and later in the story the weak and marginalized are to be in the middle of othe Israelite caravan, not the rear. The tribe of Dan is responsible for the rear of the pack - it's a way to protect the weak int he community
    • You can tell how obedient a group of Yahweh-loving people are by looking at where the weak and marginalized are within the community

Love the Lord with all your very

Bible Project on Me-od

The third test in this narrative in Exodus 16/17 is about loving God with all your "very", meaning "with all of ourselves" which is evidenced in the Rabbinic teaching of verse 9 where Moses and Joshua do not call men "to fight" but they call men "to fight for [communal] us" - they call for men to fight for the community, for everyone. They are looking for men who will trust the story and protect everyone in the community.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/022-under-the-chuppah.html b/022-under-the-chuppah.html new file mode 100644 index 00000000..577cc509 --- /dev/null +++ b/022-under-the-chuppah.html @@ -0,0 +1,2587 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 022 Under the Chuppah | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

022 Under the Chuppah

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

22: Under the Chuppah

+
7th November 2021 at 6:48pm
+
+ +bema-session-1 + +
+
+

link to podcast

link to presentation

Ancient Eastern Weddings

  • Betrothal (cup of the covenant)
    • After time of contemplation on the family's parts, man and woman's, the man will "propose". The man and his father go to the woman's village and give him a wineskin with wine in it to give to the woman and say exactly what Jesus says at the Last Supper
  • Groom leaves to prepare the house
    • Groom goes back to his father's house to build onto it the place where he and his new wife will live
    • Super patriarchal and familial culture - the woman and man, newlywed, would live in the addition to a multi-family home
    • Groom has no idea how long this part will take, no one does - it's all dependent on when the father says "yep, room's done, let's go get your wife" basically
      • Parable of 10 bridesmaids, 5 with oil and 5 without
  • Arrival of the bridegroom
    • Announced to the family/village
  • Bride is consecrated
    • A bath takes place? Some kind of spiritual preparation too?
  • Shofar is sounded ( bride's entrance)
  • Gather under the chuppah
    • Canopy that symbolizes the presence of God
  • Presentation of the kedubah
    • Covenant prepared by the groom - 7-10 items that represent the tenants of the marriage
  • Consummation of the wedding
    • Special room for consummating the marriage
    • Best man stands at the door waiting for the the marriage to be consummated
    • A bloody cloth, evidencing the bride's virginity, is produced, presented to the best man, and then the village and everyone rejoices
  • Exchange of the wedding gifts
  • "Honeymoon" year (Deut 24: 5)

Exodus 19:5-6

Now if you obey me fully and keep my covenant, then out of all nations you will be my treasured possession. Although the whole earth is mine, you will be for me a kingdom of priests and a holy nation

  • This is wedding talk - the groom called his bride his treasured possession

Exodus and Mt. Sinai

  • Betrothal
    • Abram, leave your father's house
  • Groom leaves to prep;are the house
    • time in Egypt
  • Arrival of the bridegroom
    • Passover
  • Bride is consecrated
    • God tells Moses to consecrate Israel
  • Shofar is sounded
    • Sound of a shofar at Sinai
  • Gather under the chuppah
    • Cloud covering the mountain
  • Presentation of the ketubah
    • 10 commandments
  • Consummation of the wedding
    • Tabernacle
  • Exchange of wedding gifts
    • Torah
  • Honeymoon year
    • Time of wandering in wilderness
    • Jeremiah 22

Jesus

  • John 14 - My father's house has many rooms and I will go away to prepare a place for you
  • Mark 13 - About that day or hour, no one knows, not even the son, only the Father

Exodus 32

When Moses approached the camp and saw the calf and the dancing, his anger burned and he threw the tablets out of his hands, breaking them to pieces at the foot of the mountain. And he took the calf the people had made and he burned it in the fire; then he ground it to powder, scattered it on the water and make the Israelites drink it...

Relationship to Numbers 5 - convicting the woman accused of adultery. +

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/023-falling-on-joyful-faces.html b/023-falling-on-joyful-faces.html new file mode 100644 index 00000000..6991862d --- /dev/null +++ b/023-falling-on-joyful-faces.html @@ -0,0 +1,2591 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 023 Falling on Joyful Faces | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

023 Falling on Joyful Faces

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

23: Falling on Joyful Faces

+
12th November 2021 at 10:58am
+
+ +bema-session-1 + +
+
+

link to podcast

link to presentation

Exodus

The Tabernacle instructions are admittedly not the most exciting pieces of Scripture especially assuming lack of familiarity with the wedding/marriage motif. +The intense detail and repetition should remind us of a newlywed couple talking about all the fine details of the first home together - They'd want everything perfect and would be excited about each detail of the house. That is the Tabernacle, and so this is somewhat like a loving conversation between a bride and groom.

Creation

  • We are called back to creation in the Tabernacle instructions in Exodus 25-31
  • 7 times we have "The LORD said"
  • The 7th occurrence of "The LORD said" in Exodus 31:12-18 is all about Sabbath
  • Exodus 40:33 has Moses finishing the work and resting
    • Israelites finished the work in Exodus 39 and are blessed by Moses afterwards
  • In the middle of the Tabernacle is the ark of the Covenant with the law in it, and in the garden of Eden was 2 Trees - one is the Tree of Life
  • The Holy of Holies is separated with a curtain with Cherubim woven in it, and Cherubim guards the garden.

Tent of Meeting +Tent of מוֹעֵד [mo-ed], same word for "seasons" in Genesis 1, which was the center of a chiasm

Tabernacle is a big mobile Genesis 1 reminder that Israel takes with them

Chiasms

  • Glory of the LORD (24:15–18)
    • Tabernacle and priestly garments (25–30)
      • Bezalel and Oholiab (31:1–11)
        • Sabbath (31:12–18)
        • Sabbath (35:1–3)
      • Bezalel and Oholiab (35:30–35)
    • Tabernacle and priestly garments (36–39)
  • Glory of the LORD (40:34–38)

The Golden Calf story is right in between the two Sabbath points, and the center of the story, the center of the chiasm is:

“The LORD replied, ‘My Presence will go
+with you and I will give you rest.’ ”
+Exodus 33:14
+

Opening of the temples

Opening of the tabernacle

Leviticus 9:23–24 (LEB): 23 Then Moses and Aaron entered the tent of assembly. When they came out, they blessed the people, and Yahweh’s glory appeared to all the people. 24 Then a fire went out from before Yahweh, and it consumed the burnt offering and the fat portions on the altar. And all the people saw it, so they shouted for joy, and they fell on their faces.  
+

Opening of the Temple of Solomon

2 Chronicles 7:1–3 (LEB):  7 And when Solomon finished praying, then fire came down from heaven and consumed the burnt offering and the sacrifices, and the glory of Yahweh filled the house. 2 And the priests were not able to go into the house of Yahweh, for the glory of Yahweh had filled the house. 3 When all the Israelites saw the fire come down and the glory of Yahweh upon the house, they knelt down with their faces to the ground on the pavement and worshiped and gave thanks to Yahweh, for he is good, for his loyal love is everlasting.

+

People resopnd to the opening of God's temple by celebrating and giving thanks to God. +The temple's opening is marked by fire coming out and consuming a sacrifice

In Acts, fire comes out and rests on disciples - we are the new temple.

Q: do people react like in the 2 Biblical stories when they meet us, the new temple?

As a new temple, we should be a mobile reminder of Genesis 1 - inviting others to trust the story of Yahweh

+

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/024-creating-a-space.html b/024-creating-a-space.html new file mode 100644 index 00000000..13ae27e1 --- /dev/null +++ b/024-creating-a-space.html @@ -0,0 +1,2583 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 024 Creating a Space | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

024 Creating a Space

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

24: Creating a Space

+
12th November 2021 at 11:31am
+
+ +bema-session-1 + +
+
+

link to podcast

link to prezi

Recap

We're in a tale of 2 kingdoms - Empire vs Shalom

In Genesis 1 we sort of have God making space and telling creation to fill it - ends badly +Story continues with mankind making some spaces - tabernacle and temple - and God fills it (so much that the priests literally couldn't enter in - see previous episode)

So maybe we need to be creating space, and expect that God will fill it - we are the temple after all

Prezi presentation basically encompassed all relevant notes, I put things I found convicting personally here

Prayer

  • prayer journaling
  • fixed-hour prayer
    • alarm goes off every X hours, say a liturgical prayer
  • contemplative prayer
    • "Jesus Christ, have mercy on me, a sinner, amen"
    • Meditative
  • praying the text

I would never think about segmenting into individual disciplines... I've talked about 3 of these super regularly in my life but I've never really distinguished them as disciplines.

I've been really un-disciplined in verse memory - Marty's technique sounds interesting; just picking a set of verses each week, get them down, and then move on and trust the Holy Spirit to bring them back when appropriate. I've always done the stacking method, put an ever-increasing stack of notecards on a ring and go over all of them every day.

Calendar

I want to rely on a more structured calendar, spiritually structured, and am curious about what has existed in Jewish/Christian history +

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/025-a-kingdom-of-what.html b/025-a-kingdom-of-what.html new file mode 100644 index 00000000..74ab7bff --- /dev/null +++ b/025-a-kingdom-of-what.html @@ -0,0 +1,2597 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 025 A Kingdom of What | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

025 A Kingdom of What

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

25: A Kingdom of What?

+
18th November 2021 at 8:47pm
+
+ +bema-session-1 + +
+
+

link to podcast

link to presentation

Scope: Entire book of Leviticus

Marty said he didn't have a good Leviticus resource for verse by verse - I recommend Naked Bible's series on Leviticus.

Mariage Analogy

Tabernacle is the Honeymoon Suite

Leviticus is like the Owner's Manual for the Tabernacle

Owner's Manual

Exodus 19:5–6 (LEB)
+5And now if you will carefully listen to my voice and keep my covenant, you will be a //treasured possession// for me out of all the peoples, for all the earth is mine, 
+6but you, you will belong to me as a kingdom of priests and a holy nation.’ These are the words that you will speak to the Israelites.”
+

treasured possession is the marriage language that a groom uses to describe his bride

kingdom of priests is interesting language... Israel would be familiar with a kingdom having priests, but being a kingdom of priests is a new concept.

Leviticus

Section 1: Atonement

Chapters 1-7

Section 2: Priesthood

Chapters 8-10 and 21-22

Higher expectations of priests as representatives of people +This helps the Israelites understand why the rules exist - becuase the rules are tighter for priests than layiety, but the rules for laiety are stricter than in other ANE codes

What is a priest?

A priest's role is to help the people know that they are right with God, it's not about getting it right, doing right, living right, making oneself good, etc. It is all about Yahweh communicating with his people that he loves them.

A priest puts God on display

  • Actions/rituals
  • Clothing
  • Place where he works

God's people are to be "holy", "perfect" (bad translation in Greek)... but "Holy" is "Kadesh/Qa-dos".... "qedoshim" are the holy ones - this is was becomes "saints" in the LXX... God's people are to act different, consecrated, holy, perfect... get it? It's not about perfection as we think about it - it's about acting like Yahweh's holy people.

  • Helps the people navigate their atonement
    • Leviticus 16 and day of atonement
    • General atonement rules in 1-5
  • The people also learn from their priest how to interact with God which in turn teaches them how to lead others to rightly interact with Yahweh
  • Intercedes on behalf of others
    • priest stands before God and pleads on behalf of the people (think Abraham protecting Lot et.al in Sodom)
    • Israel is supposed to stand in the gap between Yahweh and the world - we are supposed to bring the world to Yahweh
  • Distributes resources to those in need

Section 3: How to live as a priest

Rules to follow and reasons why

  • images
    • colors
    • materials
    • images in clothing etc.
  • Torah/Kosher
    • no pork
    • no blood

Primary reason is to be set apart - for Yahweh's people to be different

Note that I disagree that this is an all-encompassing explanation

Section 4: How to party

Chapters 23-24

rest

Personally I'm not sure where I land with this being a biblical point... that 'there's a right time to splurge' makes sense... I'm just not sure yet

Section 5: Caring for the oppressed

Chapters 25-27

God puts value on everyone... this is not about God valuing men more than women, or young more than old... he values all at all - many other. all other, ANE codes had zero value on the peoples that God explicitly names in this section

Chiasm

  • Rituals of redemptions (1-7)
    • Priesthood (8-10)
      • Holiness code (11-15)
        • Day of Atonement (16)
      • Holiness code (17-20)
    • Priesthood (21-22)
  • Rituals of Redemption (23-27)

Middle - Day of Atonement

I don't think I'm fully on board with Marty's short summary that sin is being stored up and imputed on the second goat and stuff... I think we have to discuss ritual vs moral impurity before Leviticus makes sense... really for me this just comes down to needing a better/fuller definition of sin

For us

Are we doing what priests did?

  • Do I help others understand atonement?
  • Do I make sure that resources are distributed to those in need?
  • Do I intercede on behalf of others?
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/026-images-of-the-desert.html b/026-images-of-the-desert.html new file mode 100644 index 00000000..522d33c7 --- /dev/null +++ b/026-images-of-the-desert.html @@ -0,0 +1,2593 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 026 Images of the Desert | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

026 Images of the Desert

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

26: Images of the Desert

+
22nd November 2021 at 6:57am
+
+ +bema-session-1 + +
+
+

link to podcast

presentation

"Because the place if demanding it builds character, because it is destructive it builds interdependence, because it's isolating it builds community, because it's the desert it builds nations" Bruce Feiler

mi-bar | מִדְבַּ֥ר is the word for desert +root word is: דבר | dbr

In Hebrew root words are used which are a set of consonants, that form the root of a number of lemmas. There are no vowels but they have breathing marks and its by changing these that we get other words. These lemmas all share something which unites them around the root word.

דברdbr
מִדְבַּ֥רmi-bar
mi-bardesert
da-barword
di-bberto speak
mad-beershepherd
do-berpasture
d'virsheepfold

So what does "to speak" and "word" have to do with the desert?

Desert is where God's people go to become people who listen to God's word.

Pasture and Desert

Pastures in ANE are not like we think of lush green fields. Pastures are the desert because it was too expensive to put sheep where there was lots of green grass. Sheep would be brought in during a 2 week period to graze the stubble of the farmland and fertilize it.

Desert is the place where a shepherd leads their flock, not with a stick but with their voice. +Contrasted with Pharaoh who leads by the stick [by power]

Psalm 23

Psalm 23:1–6 (ESV)
+1The LORD is my shepherd; I shall not want. 
+2He makes me lie down in green pastures. He leads me beside still waters. 
+3He restores my soul. He leads me in paths of righteousness for his name’s sake. 
+4Even though I walk through the valley of the shadow of death, I will fear no evil, for you are with me; your rod and your staff, they comfort me. 
+5You prepare a table before me in the presence of my enemies; you anoint my head with oil; my cup overflows. 
+6Surely goodness and mercy shall follow me all the days of my life, and I shall dwell in the house of the LORD forever.
+

Green pastures are tiny tufts of green grass in the middle of desert land

still waters is the water that's left over after a rainy season, it's muddy but provides just enough - the sheep trust the story as we are to trust Yahweh

valley of shadow of death is a horrible place where you are stuck with the flock but you are in danger

Goodness and mercy -> mercy -> he-sed | faithful love

Misc

Interesting fact: many shepherds, the majority, shepherds were/are always women. It was the norm for the young girl of a family to be the one who takes care of the flock.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/027-images-of-the-desert-rotem-and-acacia.html b/027-images-of-the-desert-rotem-and-acacia.html new file mode 100644 index 00000000..688e3dea --- /dev/null +++ b/027-images-of-the-desert-rotem-and-acacia.html @@ -0,0 +1,2597 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 027 Images of the Desert - Rotem and Acacia | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

027 Images of the Desert - Rotem and Acacia

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

27: Images of the Desert - Rotem and Acacia

+
10th December 2021 at 1:12pm
+
+ +bema-session-1 + +
+
+

link to podcast

presentation

Q: How does everyone feel about the recent focus on "deserts of our own lives"?

Trees

1. Rotem Tree/Bush / Broom Tree

Represent in Scripture often when someone is about to give up.

1 Kings 19:4 (ESV) +4But he himself went a day’s journey into the wilderness and came and sat down under a broom tree. And he asked that he might die, saying, “It is enough; now, O LORD, take away my life, for I am no better than my fathers.” +

Rotem trees don't necessarily grow in a "forest" or any kind, they are rare and singular

2. Shade as Refuge

Judges 9:15 (ESV) +15And the bramble said to the trees, ‘If in good faith you are anointing me king over you, then come and take refuge in my shade, but if not, let fire come out of the bramble and devour the cedars of Lebanon.’ +

Psalm 80:10 (ESV) +10The mountains were covered with its shade, the mighty cedars with its branches. +

Psalm 121:5 (ESV) +5The LORD is your keeper; the LORD is your shade on your right hand. +

Song of Solomon 2:3 (ESV) +3As an apple tree among the trees of the forest, so is my beloved among the young men. With great delight I sat in his shadow, and his fruit was sweet to my taste. +

Isaiah 4:6 (ESV) +6There will be a booth for shade by day from the heat, and for a refuge and a shelter from the storm and rain. +

Isaiah 25:4–5 (ESV) +4For you have been a stronghold to the poor, a stronghold to the needy in his distress, a shelter from the storm and a shade from the heat; for the breath of the ruthless is like a storm against a wall, +5like heat in a dry place. You subdue the noise of the foreigners; as heat by the shade of a cloud, so the song of the ruthless is put down. +

Q: Where do you go to find shade? Do you go to Egypt and Empire or to the Desert?

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/028-images-of-the-desert-ar-ar-and-tamarisk.html b/028-images-of-the-desert-ar-ar-and-tamarisk.html new file mode 100644 index 00000000..b1f7033b --- /dev/null +++ b/028-images-of-the-desert-ar-ar-and-tamarisk.html @@ -0,0 +1,2581 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 028 Images of the Desert - Ar'ar and Tamarisk | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

028 Images of the Desert - Ar'ar and Tamarisk

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

28: Images of the Desert - Ar'ar and Tamarisk

+
20th December 2021 at 7:04pm
+
+ +bema-session-1 + +
+
+

Tamarisk tree takes like 80 years to grow - it's a tree a man plants for his grandchildren

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/030-lead-with-your-voice.html b/030-lead-with-your-voice.html new file mode 100644 index 00000000..ec472ed0 --- /dev/null +++ b/030-lead-with-your-voice.html @@ -0,0 +1,2606 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 030 Lead with Your Voice | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

030 Lead with Your Voice

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

30: Lead with Your Voice

+
3rd January 2022 at 4:50pm
+
+ +bema-session-1 + +
+
+

link to podcast

presentation

Recap

  • 2 Primary narratives - Empire vs Shalom
    • Sacrifice vs Preservation
    • Voice vs Stick/Rod
  • Leviticus teaches Israelites how to be priests
    • Israel was called to be a kingdom of priests

Why doesn't Moses get to go to the Promised Land?

Numbers 20: 1-14 (NET)

20 [a] Then the entire community of Israel[b] entered the wilderness of Zin in the first month,[c] and the people stayed in Kadesh.[d] Miriam died and was buried there.[e]
+

2 And there was no water for the community, and so they gathered themselves together against Moses and Aaron. 3 The people contended[f] with Moses, saying,[g] “If only[h] we had died when our brothers died before the Lord! 4 Why[i] have you brought up the Lord’s community into this wilderness? So that[j] we and our cattle should die here? 5 Why[k] have you brought us up from Egypt only to bring[l] us to this dreadful place? It is no place for grain, or figs, or vines, or pomegranates; nor is there any water to drink!” +Moses Responds

+

6 So Moses and Aaron went from the presence of the assembly to the entrance to the tent of meeting. They then threw themselves down with their faces to the ground, and the glory of the Lord appeared to them. 7 Then the Lord spoke to Moses: 8 “Take the staff and assemble the community, you and Aaron your brother, and then speak[m] to the rock before their eyes. It will pour forth[n] its water, and you will bring water out of the rock for them, and so you will give the community and their beasts water to drink.”

+

9 So Moses took the staff from before the Lord, just as he commanded him. 10 Then Moses and Aaron gathered the community together in front of the rock, and he said to them, “Listen, you rebels,[o] must we bring[p] water out of this rock for you?” 11 Then Moses raised his hand, and struck the rock twice with his staff. And water came out abundantly. So the community drank, and their beasts drank too. +The Lord’s Judgment

+

12 Then the Lord spoke to Moses and Aaron, “Because you did not trust me enough[q] to show me as holy[r] before[s] the Israelites, therefore you will not bring this community into the land I have given them.”[t]

+

13 These are the waters of Meribah, because the Israelites contended with the Lord, and his holiness was maintained[u] among them.

Ideas

  1. He hit the rock the twice
  2. God told him to speak to the rock but he hit it instead
  3. Moses (and Aaron?) took credit for the water from the rock

Moses' Story

  1. Exodus 1-2a: Moses in Egypt with Pharaoh (living under the Stick)
  2. Exodus 2b-3: Moses shaped as a shepherd in the desert - learning how to lead with another kind of stick
  3. Exodus 4-14: Plagues (Battle of the Sticks)
  4. Exodus 15-18: Lessons on leadership
  5. Numbers 10-12: Complaints and rebellion
  6. Numbers 13-14: Spies, report, and rebellion
  7. Numbers 15-18: More complaints and rebellion

Numbers 20 and Midrash

Midrash teaches that Miriam was responsible for bringing water to the people in the desert. Back in Exodus 17, elders took the water from the rock the first time and put it on a cart and when people wanted water Miriam would speak to the rock and it would give water. It's interesting that right after Miriam dies in 20:1 is when people start complaining about water.

1 Corinthians 10: 1-4

For I do not want you to be unaware,[a] brothers and sisters,[b] that our fathers were all under the cloud and all passed through the sea, 2 and all were baptized[c] into Moses in the cloud and in the sea, 3 and all ate the same spiritual food, 4 and all drank the same spiritual drink. For they were all drinking from the spiritual rock that followed them, and the rock was Christ. 

Miriam died and was buried but the people don't seem to mourn her loss, they just start complaining about water.

Location in Numbers 20:1 is "Kadesh", but the end in verse 13 is "Meribah".

The people didn't quarrel with the Lord until verse 13... they quarreled with Moses. So the author is tying Numbers 20 with Exodus 17.

Exodus 17:5-7


+The Lord said to Moses, “Go over before the people;[q] take with you some of the elders of Israel and take in your hand your staff with which you struck the Nile and go. 6 I will be standing[r] before you there on[s] the rock in Horeb, and you will strike[t] the rock, and water will come out of it so that the people may drink.”[u] And Moses did so in plain view[v] of the elders of Israel.

+

7 He called the name of the place Massah and Meribah, because of the contending of the Israelites and because of their testing the Lord,[w] saying, “Is the Lord among us or not?”

Marty repeated this 3 times.... what did I miss?

Marty argues that when Moses "strikes" the rock twice, is that he actually killed 2 people. Numbers says Moses and Aaron "gathered the community together in front of the rock" which is where God was in Exodus 17... but in Exodus 17 God tells Moses to strike him (God) and he will give water, but in Numbers 20 it's the people who are in that position if the stories are laid on top of each other. So Moses might have killed two people, which then totally makes God's judgement of him makes sense.

Moses led with Pharaoh's stick, not with God's voice.

Moses did not "show God as holy", Moses did not demonstrate God's holiness, and because he didn't then God chooses Joshua.

Next story in the narrative is the talking donkey - makes sense to juxtapose a donkey talking with its voice with Moses not leading with his voice.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/034-the-hardest-story-in-the-bible-for-mary.html b/034-the-hardest-story-in-the-bible-for-mary.html new file mode 100644 index 00000000..17518ed3 --- /dev/null +++ b/034-the-hardest-story-in-the-bible-for-mary.html @@ -0,0 +1,2604 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 034 The Hardest Story in the Bible (for Mary) | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

034 The Hardest Story in the Bible (for Mary)

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

34: The Hardest Story in the Bible (for Mary)

+
17th January 2022 at 6:57pm
+
+ +bema-session-2 + +
+
+

link to podcast

link to presentation

Jericho/Conquest

No suitable evidence that Joshua's conquest ever happened...

Conquest Genre

There are ANE stories, example from Ramses 2 where he alone conquers peoples in a battle just in time for his army to show up and see his victory.

Q: Is Joshua doing that in the Biblical conquest narratives?

God Speaking (or not speaking)

Marty questions; the instances of Joshua saying God said something - maybe it's not a safe assumption that Joshua is telling the truth

Only example of God showing up and speaking is Jericho

God tells Joshua to "consecrate" Jericho to him (I think this is Joshua 6:20-21)

Joshua 6:20-21 (NIV)


+20 When the trumpets sounded, the army shouted, and at the sound of the trumpet, when the men gave a loud shout, the wall collapsed; so everyone charged straight in, and they took the city. 21 They devoted the city to the Lord and destroyed with the sword every living thing in it—men and women, young and old, cattle, sheep and donkeys.

Nic's note: I believe what is here is "devoted to destruction" which is explored as a "ha-ram" text... Heiser has LOTS on this. (confirmed ha-ram from blueletterbible)

Method

Marty says that a Jewish perspective on scriptures is eisegetical rather than exegetical... this does make me uncomfortable, but is that because of my own traditions?

Is the conquest narrative actually an allegory?

Observations

  1. God doesn't talk much but Joshua does
  2. Joshua also behaves like pagan kings of the age - ie. puts dead king bodies on display on poles at the city gates
  3. However, Joshua doesn't mock other kings and he disposes of the dead bodies that he had displayed by nightfall to be in line with Torah
  4. Gideonites (Joshua 9)

deceive Israel to joining a Suzerain-Vessel covenant, as the Suzerain but when it's discovered that Israel was deceived they still honor the covenant +# If Joshua is one long chiasm then the center is Joshua 11

Joshua 11:16-20 NIV


+6 So Joshua took this entire land: the hill country, all the Negev, the whole region of Goshen, the western foothills, the Arabah and the mountains of Israel with their foothills, 17 from Mount Halak, which rises toward Seir, to Baal Gad in the Valley of Lebanon below Mount Hermon. He captured all their kings and put them to death. 18 Joshua waged war against all these kings for a long time. 19 Except for the Hivites living in Gibeon, not one city made a treaty of peace with the Israelites, who took them all in battle. 20 For it was the Lord himself who hardened their hearts to wage war against Israel, so that he might destroy them totally, exterminating them without mercy, as the Lord had commanded Moses.

Verse 19 would be the actual center:

19 Except for the Hivites living in Gibeon, not one city made a treaty of peace with the Israelites, who took them all in battle. 

The point then would be that no one is saved except the ones who made covenant with Israel and thus with Yahweh

Another example is Rahab... a pagan is saved because of a treaty with Yahweh's people. IF that's the whole point of Joshua then the conquest narrative is not about conquest, but grace.

Standing stones

Marty hangs a dirty belt in his room...

Q: Do I put any external reminders of where I've come from to remind myself and lead to telling the story of God's grace in my life to others?

Be Strong and Courageous

Joshua 1 (NIV)

Joshua Installed as Leader
+

1 After the death of Moses the servant of the Lord, the Lord said to Joshua son of Nun, Moses’ aide: 2 “Moses my servant is dead. Now then, you and all these people, get ready to cross the Jordan River into the land I am about to give to them—to the Israelites. 3 I will give you every place where you set your foot, as I promised Moses. 4 Your territory will extend from the desert to Lebanon, and from the great river, the Euphrates—all the Hittite country—to the Mediterranean Sea in the west. 5 No one will be able to stand against you all the days of your life. As I was with Moses, so I will be with you; I will never leave you nor forsake you. 6 Be strong and courageous, because you will lead these people to inherit the land I swore to their ancestors to give them.

+

7 “Be strong and very courageous. Be careful to obey all the law my servant Moses gave you; do not turn from it to the right or to the left, that you may be successful wherever you go. 8 Keep this Book of the Law always on your lips; meditate on it day and night, so that you may be careful to do everything written in it. Then you will be prosperous and successful. 9 Have I not commanded you? Be strong and courageous. Do not be afraid; do not be discouraged, for the Lord your God will be with you wherever you go.”

+

10 So Joshua ordered the officers of the people: 11 “Go through the camp and tell the people, ‘Get your provisions ready. Three days from now you will cross the Jordan here to go in and take possession of the land the Lord your God is giving you for your own.’”

+

12 But to the Reubenites, the Gadites and the half-tribe of Manasseh, Joshua said, 13 “Remember the command that Moses the servant of the Lord gave you after he said, ‘The Lord your God will give you rest by giving you this land.’ 14 Your wives, your children and your livestock may stay in the land that Moses gave you east of the Jordan, but all your fighting men, ready for battle, must cross over ahead of your fellow Israelites. You are to help them 15 until the Lord gives them rest, as he has done for you, and until they too have taken possession of the land the Lord your God is giving them. After that, you may go back and occupy your own land, which Moses the servant of the Lord gave you east of the Jordan toward the sunrise.”

+

16 Then they answered Joshua, “Whatever you have commanded us we will do, and wherever you send us we will go. 17 Just as we fully obeyed Moses, so we will obey you. Only may the Lord your God be with you as he was with Moses. 18 Whoever rebels against your word and does not obey it, whatever you may command them, will be put to death. Only be strong and courageous!”

The refrain "Be strong and courageous" is repeated often: +God commands Joshua, Joshua commands the people, the people then turn around and tell Joshua to be strong and courageous

If the conquest is allegory then something that could be being said here is that total conquest is possible when everyone supports each other one tho another.

+

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/035-crossroads-of-destiny.html b/035-crossroads-of-destiny.html new file mode 100644 index 00000000..5940bfa2 --- /dev/null +++ b/035-crossroads-of-destiny.html @@ -0,0 +1,2592 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 035 Crossroads of Destiny | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

035 Crossroads of Destiny

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

35: Crossroads of Destiny

+
23rd January 2022 at 7:01pm
+
+ +bema-session-2 + +
+
+

link to podcast

link to presentation

What is God up to in the conquest?

The big question is not why but where? +God is concerned with a specific piece of land for his people... but why?

There was one highway, the vieamaris, that went through the land God promised his people (Canaan)

If you wanted to control trade, Canaan is the land you needed to occupy.

Abraham

Abraham was told he would bless _all_ nations then strategy would suggest that God puts his people at the center of the world.

Canaan is not a lucious garden like we might picture, a "land flowing with milk and honey". It's still desert land

Israel

Levi is not given land, God is their inheritence and they serve as priests

Joseph's two sons were given in place of Joseph so there are still 12 tribes given a portion of the land

Canaan

The Judah mountains are where God's people would want to be

The coastal lands would not be sought after by God's people - remember water metaphors chaos

The land given to Israel is right between the mountains and the coast. It metaphors God's people needing to be placed in the middle of Yahweh himself and the lost (the coastal peoples).

Yahweh does not want us in a "holy huddle", we are to invade the world with God's good news.

The danger of Christian sub-culture is actually disengaging with the mission of God, by retreating from the world and not fulfilling the mission given to God's people since the beginning.

Tell

Multiple cities over history that are destroyed and built on top of.

Why build on top? Land is precious and idealy around the city is farming land. +Another big thing would be a water source - can't move the city since the current spot is probably where the water flows

City Gates

First function is about defense, but seige only happens once a century...

Gates beome places where people sit, where welfare happens, where city business happens.

So the city gates becomes a symbol of hope for the lowly who are recepients of the wealthy charity

"Daughters of Jerusalem" reference the villages outside the city gates (called 'daughters'). So when Jesus says "Do not weep Daughters of Jerusalem" he's not talking to momen but giving hopeful message to the poor

Mission

The land divied up to the tribes was also related to the tribe's mission.

Dan

Dan received mission of bringing Shalom to Philistine chaos (shown by their original alotment). +But Dan actually receives land way up north because they forsook their mission from God. +Dan's land is not protected at all, and over time the tribe of Dan is beaten out of existence

Lesson: by forsaking God's mission, and working in rebellion, we may eventually push ourselves out of God's story of redemption.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/036-the-redemption-cycle.html b/036-the-redemption-cycle.html new file mode 100644 index 00000000..655d8315 --- /dev/null +++ b/036-the-redemption-cycle.html @@ -0,0 +1,2586 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 036 The Redemption Cycle | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

036 The Redemption Cycle

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

36: The Redemption Cycle

+
24th January 2022 at 7:02pm
+
+ +bema-session-2 + +
+
+

Cycle

Cycle of sin vs cycle of redemption in Judges

Q: Why do we not focus on the long-suffering generosity of God and instead constantly focus on Israel's, completely unsurprising, failure?

The "sin cycle" is a very "Genesis 3" approach to the story, not really a "Genesis 1-50" way of looking at the story.

God has endless patience as you try to figure out following him

Judges

  1. Israel does good in the eyes of the Lord
  2. Peace reigns for some number of years
  3. Israel does evil in the eyes of the Lord as they do not remember Yahweh
  4. Yahweh punishes Israel by bringing foreign rulers to oppress them
  5. Israel raises a Judge who frees Israel
  6. Repeat

Questions

  1. Deborah and the role of women in leadership
  2. Why is the story so fast until Gideon, then the story slows down a lot.
  3. Jephthah - did he really sacrifice his daughter? What is the greater oath?

The Story

God has endless patience when we try to figure it out +With knowledge of God's calling, and the choice to work against it, that's when God is forced to take action. Working against God leads to others crying out to God and that is who God will come to rescue.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/037-a-love-story.html b/037-a-love-story.html new file mode 100644 index 00000000..f942195f --- /dev/null +++ b/037-a-love-story.html @@ -0,0 +1,2600 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 037 A Love Story | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

037 A Love Story

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

37: A Love Story

+
31st January 2022 at 6:46pm
+
+ +bema-session-2 + +
+
+

link to podcast

Ruth

Time period: During the Judges

Recall that this is a story of redemption cycles, not necessarily just about sin and wickedness

There is a famine in the land so some Israelites go to Moab....

Moab

Maybe Israel is during to idols?

Remember that Egypt is where everyone goes during famine since the Nile always floods. But Israel was not to go to Egypt so the next option for resources would be Moab.

So when it comes to Naomi we have to kind of take 2 ideas - either she is being rebellious in going to Moab or she's following Yahweh, not going to Egypt, and looking for provision anywhere that makes sense.

Naomi

Naomi loses her husband and 2 sons after moving to Moab - so she's left with her 2 daughters in law. Orpa and Ruth.

Naomi tries to look after Orpa and Ruth because she knows there is no real place in Israel for Moabites - they are explicitly listed as a people group banned from the land "to the 10th generation".

Naomi eventually changes her name to mara.

Mara

Can mean _bitter_, but remember that _mara_ can also mean rebellious. In the OT a _mara_ son is stoned to death. So maybe Naomi is having a moment of reflection regarding her family's choice to move to Moab in the first place and she is seeking forgiveness from God?

Orpa

Orpa takes Naomi's offer and returns

Ruth

Ruth knows the Israel law and still shows loyalty to Naomi (and to Yahweh?) by following Naomi back to Israel

Boaz

Ruth

Boaz is taken with Ruth basically immediately in the story and protects her in all kinds of ways.

He knows Ruth is a Moabite woman but treats her like a righteous individual anyways because he knows how she has treated and been loyal to Naomi.

Fields

Boaz tells Ruth to glean the good stuff basically

Fields are not dozens or hundreds of acres - Boaz's field might be a couple acres tops.

Ruth is given _threshed grain_, not the un-threshed raw wheat. So Naomi catches immediately that someone is caring well for Ruth

Kinsmen redeemer

Back to Leviticus 27, a chapter dedicated to redemption, we see Israel's code given by Yahweh to lead righteous people to welcome in even the outsider if they act in accordance with Yahweh's character. +

Naomi makes a plan with Ruth to ask Boaz to redeem them.

Ruth "uncovers Boaz's feet" after a night of work. There are euphemisms here, but not overly sexualized.

Hebrew way of thinking we see Ruth uncover Boaz's circumcision then lays at his feet, so when he is woken up he looks through the sign of the covenant upon an alien in his land - she is reminding him of God's favor on Israel and call to bless all nations.

City Gates

Boaz meets with elders at the city gates to handle the kinsmen redemption "ritual" since there is a closer kinsmen. Boaz cleverly gets the nearest guardian redeemer to give up his right to redemption and Boaz agrees to marry Ruth and redeem Naomi's family line.

Eventually David and thus Jesus follow from this family line.

Summary

This is not just a love story between Ruth and Boaz... we see a type for Jesus redeeming the outsider - this is a love story about Yahweh and creation.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/038-a-donkey-herder-to-lead-us.html b/038-a-donkey-herder-to-lead-us.html new file mode 100644 index 00000000..5b953d68 --- /dev/null +++ b/038-a-donkey-herder-to-lead-us.html @@ -0,0 +1,2590 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 038 A Donkey Herder to Lead Us | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

038 A Donkey Herder to Lead Us

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

38: A Donkey Herder to Lead Us

+
30th January 2022 at 1:22pm
+
+ +bema-session-2 + +
+
+

link to podcast

Remember that Judges ends with a story that looks exactly like Sodom. The author shows that Israel isn't just broken people struggling to follow God but they are now in the seat of the oppressor, not looking out for the wanderer or marginalized. They are oppressing even their own nation and it's from there that the biblical narrative roles into the time of the kings.

Deuteronomy 17

14 When you enter the land the Lord your God is giving you and have taken possession of it and settled in it, and you say, “Let us set a king over us like all the nations around us,” 15 be sure to appoint over you a king the Lord your God chooses. He must be from among your fellow Israelites. Do not place a foreigner over you, one who is not an Israelite.

God doesn't find the request for a king in 1 Samuel 8 to be a problem

1 Samuel 8

4 So all the elders of Israel gathered together and came to Samuel at Ramah. 5 They said to him, “You are old, and your sons do not follow your ways; now appoint a king to lead[b] us, such as all the other nations have.”
+

6 But when they said, “Give us a king to lead us,” this displeased Samuel; so he prayed to the Lord. 7 And the Lord told him: “Listen to all that the people are saying to you; it is not you they have rejected, but they have rejected me as their king. 8 As they have done from the day I brought them up out of Egypt until this day, forsaking me and serving other gods, so they are doing to you. 9 Now listen to them; but warn them solemnly and let them know what the king who will reign over them will claim as his rights.”

+

10 Samuel told all the words of the Lord to the people who were asking him for a king. 11 He said, “This is what the king who will reign over you will claim as his rights: He will take your sons and make them serve with his chariots and horses, and they will run in front of his chariots. 12 Some he will assign to be commanders of thousands and commanders of fifties, and others to plow his ground and reap his harvest, and still others to make weapons of war and equipment for his chariots. 13 He will take your daughters to be perfumers and cooks and bakers. 14 He will take the best of your fields and vineyards and olive groves and give them to his attendants. 15 He will take a tenth of your grain and of your vintage and give it to his officials and attendants. 16 Your male and female servants and the best of your cattle[c] and donkeys he will take for his own use. 17 He will take a tenth of your flocks, and you yourselves will become his slaves. 18 When that day comes, you will cry out for relief from the king you have chosen, but the Lord will not answer you in that day.”

+

19 But the people refused to listen to Samuel. “No!” they said. “We want a king over us. 20 Then we will be like all the other nations, with a king to lead us and to go out before us and fight our battles.”

+

21 When Samuel heard all that the people said, he repeated it before the Lord. 22 The Lord answered, “Listen to them and give them a king.” +

Notice verse 19 is particularly striking - Israel wants to be like the other nations. Not only that but they say they want a king "to lead us and to go out before us and fight our battles" which is exactly what Yahweh had done for Israel all throughout Abraham to Moses to Joshua.

Saul

Saul is the man tho "looks impressive to the eye". He's the kind of king that Israel, as they want to be like other nations, would want.

There are many lessons here.

  1. Saul is a donkey herder for one, who has kind of lost his donkeys and needs to go to the prophet/seer in order to find them
  2. Israel is supposed to be sheep with a shepherd, but Israel is acting like freaking donkeys so God gives them a king who is not a shepherd but a donkey herder
  3. Saul is also from the most despised tribe to this point in history from Israel - Benjamin.

David

David is not the kind of man who would be chosen as king... He's the youngest of 8, tending to sheep (probably out with his older sisters). Marty assumes David is 8 years old here.

David is the youngest of 8, a shepherd from the tribe of Judah, who God picks from the "bottom" to lead his people. Yahweh teaches that he alone is the true King, it is not the human king who truly leads the people - the king should lead according to following Yahweh just like the priests were to lead Israel such that Israel could lead the nations back to Yahweh.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/039-a-king-after-god-s-own-heart.html b/039-a-king-after-god-s-own-heart.html new file mode 100644 index 00000000..dea8f1b7 --- /dev/null +++ b/039-a-king-after-god-s-own-heart.html @@ -0,0 +1,2587 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 039 A King After God's Own Heart | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

039 A King After God's Own Heart

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

39: A King After God's Own Heart

+
6th February 2022 at 1:02pm
+
+ +bema-session-2 + +
+
+

link to episode

link to relevant TED talk

1 Samuel 17

Philistines camp makes a large horseshoe

Saul and army have been facing the Philistines for 40 days. This is testing (number 4). So God has tested them to reveal what's in their hearts and what they find is fear.

Observations

Saul and company have camped for 40 days and done nothing

David shows up a few hours and is ready to go do something - he'll stand up for Yahweh to Goliath's defiance.

David calls Goliath the "uncircumcised Philistine" - drawing attention to Israel's covenant

Goliath

Goliath has "scale-like" armor +Goliath is 6 cubits tall, 6 fingers (1 Chronicles), his spear head weighed 600 shekels

There are illusions to wickedness (666), and the serpent back in Genesis 3. +David shows up a *type* for Jesus

Tribe of Benjamin in Judges 20

Benjamin mobilizes 700 well-trained sling-men (Judges 20:15).

Saul is from the tribe of Benjamin. Saul should have been the one facing Goliath with the sling.

David

"Golden-age" of Israel when David was king

David is concerned not with his own name but with keeping God's name holy

David cares about "restorative justice", not conquering.

Discussion videl

  1. What do we think of David as a person? The ark of his life - not just as a boy, or not just focusing on the sin with Bathsheba - keeping all in mind what do we think of David as the king after God's own heart?
  2. What does it mean to be a leader in the context of competing kingdoms (empire vs shalom)? What are tangible things we are doing or can do to demonstrate God's loving kindness to everyone?
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/040-one-story-two-sources.html b/040-one-story-two-sources.html new file mode 100644 index 00000000..fdf4afda --- /dev/null +++ b/040-one-story-two-sources.html @@ -0,0 +1,2587 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 040 One Story, Two Sources | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

040 One Story, Two Sources

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

40: One Story, Two Sources

+
6th February 2022 at 12:56pm
+
+ +bema-session-2 + +
+
+

link to podcast

link to presentation

Narrative

A tale of 2 kingdoms: Empire v. Shalom

  1. Exodus: Rescue, Marriage, Tabernacle
  2. Leviticus: Atonement ( we are right with God ), Priesthood in Israel and Israel as the priesthood
  3. Numbers: Honeymoon in the desert
  4. Deuteronomy: Remember where we came from, recall Isarel's humble beginnings and partner with God to bring other nations into redemption
  5. Joshua: Crossroads of the Earth/Canaan given to Israel
  6. Judges: Redemption cycle of Israel's faulting but Yahweh's rescue
    1. Ruth: Love story between righteous parties

TaNaKh

Jesus often refers to the "law" and "prophets" which are the Torah (law) and Nevi'im ( prophets ). The Ketuvim (writings) was still being canonized in Jesus' day.

Christian canon has the OT in a different order than the Tanakh is... many reasons probably. One is genre and Western groupings of books, which makes sense. Another might be some anti-semitism. Tanakh ends with Chronicles however the Christian OT ends with Malacai (ends with a curse) which might be that way to setup Jesus in the NT?

2 Sources for 1 Story

1 Source is Samuel and Kings (In the Jewish Nevi'im). The other source is Chronicles (In the Jewish Ketuvim). These sources tell the same story but different versions of the same stories.

Scholars debate authorship and time of writing all the time - Marty generalizes this a bit, doesn't want to get into the weeds and instead stay at a level we can enter into more easily.

Perspectives

Samuel/Kings can be read from Northern Israel's perspective. It reads more like headlines of events rather than reflective writing of historical events.

Eastern history is not as concerned with getting every fact correct as we are in the West - rather the Easterner is more concerned with telling details in a way that spurs action and sends a message.

Chronicles was written more from the perspective of Judah. Chronicles is much less "agenda-driven headlines" and instead is much more a "documentary perspective" from Judah.

Both sources are talking about the same period of history - the stories of Saul, David, and Solomon down through the rest of the kings.

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/041-the-story-behind-the-story.html b/041-the-story-behind-the-story.html new file mode 100644 index 00000000..830edc70 --- /dev/null +++ b/041-the-story-behind-the-story.html @@ -0,0 +1,2594 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 041 The Story Behind the Story | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

041 The Story Behind the Story

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

41: The Story Behind the Story

+
20th February 2022 at 1:42pm
+
+ +bema-session-2 + +
+
+

link to podcast

link to presentation

Viewpoint

  1. Samuel and Kings written very close to the actual events
    1. The information reads like agenda-driven headlines
  2. Chronicles is much later
    1. Written from Judah (southern split) perspective
    2. Reads more like a documentary

Flyby of Samuel/Kings

  1. Saul is selected and eventually rejected
  2. David is chosen after going against Goliath
  3. Saul pursues David for 10 chapters
    1. David refuses to not "qa-dosh he-shem" (hallow the name)
  4. Everything David does to establish his throne is done in service of hallowing God's name
  5. David's military approach is super counter-intuitive
    1. He'll mourn the death of enemies
    2. He threatens to kill his own men when they try to kill foreign kings
    3. David is all about the Shalom in Empire vs Shalom
  6. Story turns to Bathesheba after David's defeat of the Ammorites
  7. Then the story takes a turn for the worst
  8. David is overthrown and chased by his son Absalom (perhaps a repeat of the Saul narrative?)
    1. His family is in ruins
    2. Second Samuel ends after David counts his men (major sin in God's eyes)
  9. 1 Kings begins with Solomon establishing his own kingdom
  10. Solomon is visited by Queen of Sheba
    1. Her gift is said to weight 666 shekels
    2. This foreshadows the downward spiral of David's family
  11. Solomon enters into several treaties with foreign kings each including a foreign wife
  12. Solomon eventually amasses 700 wives

The King's Downfall

  1. David's immorality with Bathsheba is the turning point in his life and kingdom crumbling
  2. Solomon's immorality in marriage (sex) and nation-alliance leads to his downfall
    1. He is led into idolotry by his wives

The Point

Source 1 (Kings and Samuel) tells us that God's leaders sin and cannot be trusted. They lead God's people astray via their disobedience of Yahweh's way.

Is this accurate? yes

Flyby of Chronicles

  1. No effort is spent putting David's morality on display, only his pedigree
  2. No discussion about his exclusion of Saul or his warfare tactivs
  3. Bathsheba episode is totally forgone in Chronicles
  4. David's kingdom falls for more than the moral failure of a leader according to the Chronicler...
  5. Likewise Solomon's wickedness is also not discussed (wives, treaties, etc)

The Point

Source 2 (Chronicles) tells the story behind the story, written retrospectively, to make the point that it's not just sexual shortcoming or unrighteous behavior that leads God's people to fall. Chronicles makes an effort to discuss the injustice in Israel's kingdom.

Is this also accurate? yes

Temple

Temple is not absent in Kings/Solomon but it is the focal point of Chronicles. David's request to build God's house is the hinge-point of his reign in Chronicles (contrasted with Kings/Solomon accounts having the Bathsheba episode as the hinge-point)

David asks to build the temple because he feels guilty about his own life style... "Why should I live in a house of cedar while my Lord lives in a tent"

God's response is that he doesn't need a house basically - tent is mobile, that's God's MO - to get on the move blessing people

Empire vs Shalom

David, according to the Chronicler, is all about honoring God but in a very "empire-y" way made clear by the temple. +David passes this onto Solomon who accumulates all kinds of riches and goes on to make the temple more grand than David had originally designed.

Solomon's acquisition of resources, treaties, money, etc. is in direct contrast to Deut. 17. Chronicler makes Solomon out to be the king who disobeyed literally every law for kings in Torah.

The Real Point

The story is not just about morality and disobedience. It's about seeing what goes on behind our immorality and what leads to our disobedience.

David counting his men

Parallel passages here...

2 Samuel 24:1 (LEB):  24 Again Yahweh was angry with Israel, and he incited David against them, saying, “Go count Israel and Judah.” 
+
1 Chronicles 21:1 (LEB):  21 Then Satan stood against Israel and urged David to count Israel. 
+
  1. Is it Satan or Yahweh who has David take the census?
    1. So Kings/Samuel (narrative about immorality) highlights that David is doing something that makes Yahweh angry.
    2. Chronicler highlights David's lust after Empire and ties that back to the Satan
  2. In Chronicles there is an added response from Joab to David regarding David bringing guilt onto Israel...
    1. There is retrospective present here from the Chronicler
  3. In ancient times a census was usually accompanied by a tax...
    1. David wants to build the temple, so his motive for the census is pretty hard to nail down but maybe he's trying to amass resources like Solomon will do for the purposes of the temple
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/042-the-fire-of-elijah.html b/042-the-fire-of-elijah.html new file mode 100644 index 00000000..8f8c7888 --- /dev/null +++ b/042-the-fire-of-elijah.html @@ -0,0 +1,2583 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 042 The Fire of Elijah | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

042 The Fire of Elijah

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

42: The Fire of Elijah

+
21st February 2022 at 11:12am
+
+ +bema-session-2 + +
+
+

Link to podcast

We can't make any individual in the Bible a hero or villian... David is complicated, Solomon is complicated, etc etc.
Golden calf (Jeroboam) makes a ton of sense from the viewpoint of a king seeking for political power and peace - the bull was the sign of Baal... the surrounding nation's god

Elijah

Biblical Text: 1 Kings 17

  • There is very little info about Elijah - he comes from Tishbe
  • Elijah calls for no rain before the word of Yahweh comes to him
    • Might show that Elijah has some hutz-pah
    • Deuteronomy 11: 16-18
    • Deuteronomy 11:16–18 (LEB): 16 Take care so that your heart is not easily deceived, and you turn away, and you serve other gods, and you bow down to them. 17 And then the anger of Yahweh will be kindled against you, and he will shut up the heavens, and there shall not be rain, and so the ground will not give its produce, and you will perish quickly from the good land that Yahweh is giving to you. 18 “And you shall put these, my words, on your heart and on your inner self, and you shall bind them as a sign on your hand and let them be as an emblem between your eyes. +
    • Elijah knows the Bible and calls king Ahab out for his disobedience
  • Yahweh gives Elijah some instructions
    • Sustained by crows
    • Women and dying son sustain him
  • Yahweh gives another word 3-3.5 years later in 1 Kings 18
  • Yahweh tells Elijah to tell Ahab it's going to rain but not how to tell Ahab it's going to rain
    • Elijah in his hutz-pah decides to make a show of it (I like this point)
    • Elijah goes with Yahweh against Baal
      • The contest is full of strikes against Baal and their mythology
      • Baal and Ashera were lovers and once a year Baal would pursue Ashera and just before their sexual relationship reaches climax Ashera pulls away and the rain on the harvest is Baal's seed.
      • Elijah baits the Baal priests in all kinds of trash-talking ways
    • Elijah repairs the existing altar to Yahweh
      • The drenching of the altar is not Elijah making it more difficult - this is a very modern take
      • Elijah is calling back on the festival of succot. At the end of succot there is a water ceremony where you pour water on the altar to ask Yahweh to answer the prayer for rain. Elijah pours the water 3 times (one for every year without rain?) to petition Yahweh to answer
+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/043-go-in-peace.html b/043-go-in-peace.html new file mode 100644 index 00000000..dc095824 --- /dev/null +++ b/043-go-in-peace.html @@ -0,0 +1,2588 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 043 Go in Peace | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

043 Go in Peace

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

43: Go in Peace

+
12th March 2022 at 6:34am
+
+ +bema-session-2 + +
+
+

link to podcast

Review

  1. Prefix in Genesis 1-11
    1. We are invited to trust the story, trust that God is good
    2. People suck, people are afraid and we see a narrative of self-preservation throughout 1-11
  2. Introduction Genesis 12-50
    1. This family leans into believing that Yahweh is putting hte world back together
    2. They aren't perfect either but the hutz-pah present in that family is something God works with
  3. Empire vs Shalom
    1. How will God get Egypt out of his people?
    2. Marriage ceremony at Sinai after the Exodus
  4. Priesthood
    1. Leviticus and the Tabernacle given to the people
    2. Israel is to be a kingdom of priests
    3. We are right with God before we go anywhere
    4. Priests modeled to Israel how they were to bring the nations back to God
  5. Festivals
    1. Parties to remember that the story is good
  6. Desert Honeymoon
    1. In the wandering that follows the Exodus, which according to the marriage ceremony should be the honeymoon, the people of Israel learn what it means to follow Yahweh
  7. Conquest
    1. God puts his people in the middle of the action
    2. Redemption cycle in Judges puts God's mercy and patience on display
  8. Judges
    1. Book of Ruth demonstrates a love story between God and his people
    2. Boaz is acting like a priest how Leviticus says to
  9. Two stories
    1. Story A, new headlines, in Samuel and Kings
    2. Story B, reflection, in Chronicles
    3. The split between north (Israel) and south (Judah)

Story of Naaman

2 Kings 5

Naaman is a "great man". 'great' is גָּדוֹל (gi-dol) related to the word for glory. glory, in the eastern mindset, isn't light/shining it is a personal feeling of weight. When Naaman walks into a room people feel it, you know when he arrive. However Naaman has leprocy.

Servant girl tells Naaman to talk to the man of God, but they go to the king first... Interesting note that this is an "unnamed king" of Isreal... it help put the story into perspective and who it's about. It's about Yahweh and Naaman.

Naaman is told by Elisha's servant to wash in the Jordan (a non-impressive river in the first place). +Naaman is offended but his servant tells him to at least try it.

This experience converts Naaman to a Yahweh follower!

The dirt tells us that Naaman knows who to worship and he asks for forgiveness that it's impossible to do Torah where he lives, and Elisha says "go in peace" - He says to Naaman "I know where your loyalty lies, so go in peace"

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/044-our-harps-in-the-trees.html b/044-our-harps-in-the-trees.html new file mode 100644 index 00000000..9d2b5eeb --- /dev/null +++ b/044-our-harps-in-the-trees.html @@ -0,0 +1,2602 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 044 Our Harps in the Trees | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

044 Our Harps in the Trees

+ + + + + +
+ + + + + +
+

<!doctype html>

+ + + + + + + +Personal — Theology and Tech + General Stuff +
+

+
+ + + +
+ +

44: Our Harps in the Trees

+
26th March 2022 at 6:14am
+
+ +bema-session-2 + +
+
+

link to podcast

Psalms

Mostly credited to David, several are written by others.

Expressions

  1. remind us of history and where we come from
  2. express anger over injustice
  3. encourage us to join in community
  4. aid in lamenting

Lament

Psalm 12:title–8 (LEB): +

12 For the music director; on the Sheminith. A psalm of David.  1 Save, O Yahweh, for the pious have ceased to be;  for the faithful have vanished  from among the children of humankind.  2 They speak falseness to each other.  With flattering lips,  with a double heart they speak.  3 May Yahweh cut off all flattering lips,  the tongue speaking great boasts—  4 those who say, “With our tongue we will prevail.  Our lips are on our side.  Who is master over us?”  5 “Because of the oppression of the afflicted,  because of the groaning of the poor,  now I will rise up,” Yahweh says.  “I shall put them in the safety for which they long.”  6 The words of Yahweh are pure words  like silver refined in the crucible on the ground,  refined seven times.  7 You, O Yahweh, will protect them.  You will preserve him  from this generation always.  8 The wicked prowl about  when vileness is exalted among the children of humankind.  

Harris, W. H., III, Ritzema, E., Brannan, R., Mangum, D., Dunham, J., Reimer, J. A., & Wierenga, M., eds. (2012). The Lexham English Bible (Ps 12:title–8). Lexham Press.

Thanskgiving

Psalm 8:title–9 (LEB): 8 For the music director, on the Gittith. A psalm of David. +

1 Yahweh, our Lord, how majestic is your name in all the earth,  who put your splendor above the heavens.  2 From the mouth of children and infants you have founded strength  on account of your enemies,  to silence the enemy and the avenger.  3 When I look at your heavens, the work of your fingers,  the moon and the stars which you set in place—  4 what is a human being that you think of him?  and a child of humankind that you care for him?  5 And you made him a little lower than heavenly beings,  and with glory and with majesty you crowned him.  6 You make him over the works of your hands;  all things you have placed under his feet:  7 sheep and cattle, all of them,  and also the wild animals of the field,  8 the birds of the sky and the fish of the sea,  everything that passes along the paths of seas.  9 Yahweh, our Lord,  how majestic is your name in all of the earth!  

Hymnic

Psalm 150:1–6 (LEB): 150 Praise Yah. +

 Praise God in his sanctuary;  praise him in his mighty firmament.  2 Praise him for his mighty deeds;  praise him according to the abundance of his greatness.  3 Praise him with blast of horn;  praise him with harp and lyre.  4 Praise him with tambourine and dancing;  praise him with strings and flute.  5 Praise him with sounding cymbals;  praise him with clashing cymbals.  6 Every breathing thing,  let it praise Yah.  Praise Yah. 

Harris, W. H., III, Ritzema, E., Brannan, R., Mangum, D., Dunham, J., Reimer, J. A., & Wierenga, M., eds. (2012). The Lexham English Bible (Ps 150:1–6). Lexham Press.

Distress

Psalm 120:title–7 (LEB): 120 A song of ascents. +

1 In my distress I called to Yahweh,  and he answered me.  2 “Deliver my life, O Yahweh, from lying lips,  from a deceitful tongue.”  3 What shall be given to you,  and what more shall be done to you,  deceitful tongue?  4 The sharpened arrows of a warrior,  with burning charcoals from broom trees.  5 Woe to me, that I sojourn in Meshech,  that I dwell among the tents of Kedar.  6 Too long my soul has had its dwelling  near one who hates peace.  7 I am for peace, but when I speak,  they are for war.  

Harris, W. H., III, Ritzema, E., Brannan, R., Mangum, D., Dunham, J., Reimer, J. A., & Wierenga, M., eds. (2012). The Lexham English Bible (Ps 120:title–7). Lexham Press.

Psalm 128:title–6 (LEB): 128 A song of ascents. +

1 Blessed is everyone who fears Yahweh,  who walks in his ways.  2 You will indeed eat of the labor of your hands;  you will be happy and it will be well with you.  3 Your wife will be like a fruitful vine  within your house.  Your children will be like olive shoots  about your table.  4 Look, for thus shall a man be blessed  who fears Yahweh.  5 May Yahweh bless you from Zion,  that you may see the good of Jerusalem  all the days of your life,  6 and that you may see your children’s children.  May peace be upon Israel.  

Harris, W. H., III, Ritzema, E., Brannan, R., Mangum, D., Dunham, J., Reimer, J. A., & Wierenga, M., eds. (2012). The Lexham English Bible (Ps 128:title–6). Lexham Press.

Imprecatory

Psalms where you call out for vengenve

Psalm 109:title–31 (LEB): 109 For the music director. A psalm of David. +

1 O God of my praise, do not keep silent,  2 for wicked and deceitful mouths  have opened against me.  They speak to me with a lying tongue.  3 They also surround me with words of hate,  and fight me without cause.  4 In return for my love they accuse me,  though I am in prayer.  5 So they inflicted evil against me in return for good  and hatred in return for my love.  6 Appoint over him a wicked man,  and let an accuser stand at his right hand.  7 When he is judged, let him come out guilty,  and let his prayer become as sin.  8 Let his days be few;  let another take his office.  9 Let his children be orphans,  and his wife a widow,  10 and let his children wander aimlessly and beg,  and let them plead from their ruins.  11 Let the creditor seize all that is his,  and let strangers plunder his property.  12 Let there be none who extend to him loyal love,  nor any who pities his orphans.  13 Let his descendants be cut off.  Let their name be blotted out in the next generation.  14 Let the iniquity of his ancestors be remembered before Yahweh,  and let the sin of his mother not be blotted out.  15 Let them be before Yahweh continually,  that he may cut off their memory from the earth,  16 because he did not remember to show loyal love,  but he pursued anyone, poor or needy  or brokenhearted, to slay them.  17 Because he loved cursing, let it come upon him.  Because he did not delight in blessing,  let it be far from him.  18 Because he wore a curse as his robe,  let it enter his body like water,  and into his bones like oil.  19 May it be for him like a garment in which he wraps,  and a belt he continually wears.  20 Let this be the punishment for my accusers from Yahweh,  even those who speak evil against my life.  21 But you, O Yahweh my Lord,  deal with me for your name’s sake.  Because your loyal love is good, deliver me,  22 for I am poor and needy,  and my heart is wounded within me.  23 Like a lengthening shadow I am passing away;  I am shaken off like a locust.  24 My knees buckle from fasting,  and my body grows lean without fat.  25 And so I am a disgrace to them;  when they see me, they shake their heads.  26 Help me, O Yahweh my God;  save me according to your loyal love,  27 that they may know that this is your hand,  that you, O Yahweh, you have done it.  28 Let them curse, but you bless.  When they arise, let them be put to shame,  that your servant may be glad.  29 Let my accusers put on disgrace,  and let them cover themselves with their shame as with a robe.  30 I will give thanks to Yahweh exceedingly with my mouth,  and in the midst of many I will praise him,  31 for he stands at the right hand of the needy,  to save him from those judging his life.  

Harris, W. H., III, Ritzema, E., Brannan, R., Mangum, D., Dunham, J., Reimer, J. A., & Wierenga, M., eds. (2012). The Lexham English Bible (Ps 109:title–31). Lexham Press.

Notes on Psalm 109

Psalm 109:20 (LEB): 20 Let this be the punishment for my accusers from Yahweh,  even those who speak evil against my life.  

Q: reward is used in ESB, punishment in LEB... totally different connotations?

Psalm 109:20 (ESV): 20 May this be the reward of my accusers from the Lord,  of those who speak evil against my life!  

Goofy Hebrew here - could be translated This is what my accusers want Adonai to do, those who speak evil against me

Verses 1-5: multiple enemies are mentioned

Verse 6: David asked for a wicked man (someone evil) to oppose his enemy... now there's one enemy and David is asking for aid from evil?

It's like the Psalm is from David's perspective in the first paragraph, then from 6-20 the perspective switches to that of David's enemies against himself. This would make the Jewish translation of verse 20 makes sense since... It's about what Yahweh's enemies want Yahweh to do to his people (ie. David).

Marty's take is that this Psalm is of David reflecting on the Nabal and Abigail incident. Maybe it's David reflecting on how he wanted his enemies destroyed but in hindsight he sees that his enemies in that scenario had a case against him

+
+ +
+ + + +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/074-silent-years-synagogue.html b/074-silent-years-synagogue.html new file mode 100644 index 00000000..dae123b6 --- /dev/null +++ b/074-silent-years-synagogue.html @@ -0,0 +1,397 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 074 - Silent Years - Synagogue | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

074 - Silent Years - Synagogue

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Link to presentation

+

Judaism

+

Modern Judaism is very different from Jesus' Judaism which was distinct from +David's Judaism, etc... We, as modern westerners, need to be aware of the +religious evolution and history of Judaism to properly understand the +Scriptures.

+

Synagogue

+

Synagogue started with groups of people at homes, not in a big building, +after Exile, exploring a way to express their faith. Synagogue has 7 main +elements. But note that all 7 are not found in every Synagogue building, but +the 7 show up consistently

+

Mikveh

+

Basically a baptistry.

+

Synagogue was never meant to replace the Temple

+

Prior to AD 70, the doors to a Synagogue never faced Jerusalem in order to keep +in mind that Temple was distinct. However, after AD 70 doors to Synagogues were +built to face Jerusalem as a means of mourning the loss of the Temple

+

Mikveh was a ritualistic cleansing (not a conversion like baptism) basically +every day, every time before you enter Synagogue.

+

Basilica

+

The pillared section of the Synagogue which held up the roof.

+
    +
  1. They didn't have the technology to span the desired length of the roof, so the columns/pillars were structural
  2. +
  3. Had embedded windows to allow light into the center of the Synagogue in order to read God's light by God's light (sunlight)
  4. +
+

Bema

+

Dead center is the Bema seat. (Bay-mah or Bee-mah but this isn't the bima seat of judgement in the NT)

+

Usually was just a slightly raised platform that someone would stand on as they read the text.

+

The Bema seat starts to move closer to a side of the room, as a stage, as +Synagogues are influenced by Western culture. But in the Second Temple period +the seat was always at the center so that God's people gather around the +text.

+

Modern day churches have us gather more as an audience to see a performer +rather than to gather around the text

+

Chief Seats

+

Everyone sat on the floor to hear God's word, but around the perimeter were +seats for those who were "seasoned", "wise"... really it's that they were older +and known as wise men in the community

+

Torah Closet

+

Where Torah was kept. Modern times there were more expensive and ornate art put +here - the Torah Closet was the place where the valuable things were kept

+

This was introduced because prior to Exile the Jews might have been a people +who didn't know the rules... yes they didn't follow them, but there wasn't a +great system for making sure everyone knew them. So the Torah Closet existed to +keep God's law safe and accessible by all of God's people

+

timestamp: 21 ish minutes - need to listen to Moses Seat again

+ +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/075-silent-years-welcome-to-hellenism.html b/075-silent-years-welcome-to-hellenism.html new file mode 100644 index 00000000..d95be7cb --- /dev/null +++ b/075-silent-years-welcome-to-hellenism.html @@ -0,0 +1,506 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 075 Silent Years - Welcome to Hellenism | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

075 Silent Years - Welcome to Hellenism

+ + + + + +
+ + + + + +
+

Hellenism

+
+

For the first time in history, Greeks redefined worldfiew to be cenetered +around the individual. Prior to Hellenism, worldviews centered around +pleasing the gods

+
+

Alexander the Great had his own gospel (εὐαγγέλιον - euangelion: predates biblical authors. "Good news to share" as an idea is not uniquely biblical)

+

He conqoured the world, not with a huge army but with 4 things:

+
    +
  1. Education
  2. +
  3. Healthcare
  4. +
  5. Entertainment
  6. +
  7. Athletics
  8. +
+

These 4 things pull on basically all people's values, Andrew the Great used them to control people...

+
    +
  1. Education - control what people know
  2. +
  3. Healthcare - make people dependent on the state's provision
  4. +
  5. Entertainment - control what people do with their time (theater was invented in this time)
  6. +
  7. Athletics - similar to entertainment - this becomes a pillar of culture
  8. +
+

Jewish History

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
yearevent
586 BCBabylonian captivity of Judah
538 BCReturn to Israel (Decree of Cyrus)
332 BCAlexander the Great conquers Palestine
330–198 BCRule of Hellenistic Ptolemies over Jews
198–167 BCOppression under Hellenistic Seleucids
167 BCMaccabean revolt
167–63 BCHasmonean (Maccabean) kingdom
63 BCRoman conquest of Judea
37 BCReign of Herod begins
c. 6 BCBirth of Jesus
4 BCHerod’s death
4 BC–AD 6Rule of Archelaus
4 BC–AD 39Rule of Antipas
c. AD 27–30Jesus’s public ministry
c. AD 30Crucifixion of Jesus
AD 66–73First Jewish revolt against Rome
AD 70Destruction of Jerusalem/Temple
AD 73Masada falls
AD 131–135Bar Kochba Revolt (Second Jewish revolt)
+

Post-Alexander the Great's death

+

4 rulers take over the Greek kingdom

+
    +
  1. Synichus
  2. +
  3. ?
  4. +
  5. Seleucis
  6. +
  7. Ptolemy
  8. +
+

Ptolemy rules the Jewish region

+

Leadership style - very Hellenistic

+

Some Jews dove in, others remained faithful to Judaism... Psolemy made it just simply ahrd to not be Greek

+

Selucids take over Psolemies and Jewish region

+

Selucis sacrifices a pig on the altar in Judea - ruthless take over of Jewish +land which leads to the Maccabean revolt (Hanukkah)

+

Hanukkah

+

Jews wins the Maccabean revolts, story of Hanukkah arises

+

Hasmonean rule

+

Maccabean's are people of the text and see that Yahweh wanted priests to rule, +not kings. So they hand the kingdom over to the Hasmoneans (priests), and their +Yahweh-centric rule eventually turns back to Hellenism

+

Josephus (perhaps a little hyperbolically) said at this time there weren't enough priests to run Sabbath services cause they were all at the naked mud wrestling tournaments

+

Hasadim

+

Maccabeans who leave the Hasmonean group, go north, and build a fundamentalist Jewish culture in Galilee which is where Jesus grew up and did his ministry

+

They split into 2 groups - Zealots who use the sword, Pharisees who obedience to the text

+

Rome

+

Jews (Saducees) persue Herod the Great in order to work things in light of Roman conquest, to remain good for the Jews

+

Herod and Ceasar end up having a tight political relationship

+

Herod's kingdom

+

Herod split his kingdom to his sons after his death

+
    +
  1. Herod Archelaus (rules for a short time and is replaced by Pontius Pilot)
  2. +
  3. Herod Philip 2
  4. +
  5. Herod Antipad
  6. +
+

Sometime in this period, Jesus was born

+

Post-Herod

+

Jesus' public ministry is during this time

+

Jews eventually revolt against Rome which leads to destruction of Jerusalem and the Temple

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/076-silent-years-sadducees.html b/076-silent-years-sadducees.html new file mode 100644 index 00000000..7fab00f7 --- /dev/null +++ b/076-silent-years-sadducees.html @@ -0,0 +1,443 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 076 Silent Years - Sadducees | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

076 Silent Years - Sadducees

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Link to presentation

+

Sadducees

+

>Often we in the modern time totally conflate Sadducees and Pharisees but they +>are as Republicans and Democrats today... very much not the same

+

Origin

+

Back in the Davidic kingdom they are the group that sought to restore the +priesthood by way of lineage. A goal was figuring out who the High Priest was. +Lots are cast and Zaddok is chosen at some point - his line becomes the +Jesus-era Saducees. They are the zaddokim (Hebrew pronounciation) which when +somwhat anglosized becomes sadducees.

+

Hasmonean

+

During Seleucids destruction of the Temple the Maccabeans revolt and expel +Selecuis and Ptolemies. The Hasmonean kingdom follows this, which are priests +that the Maccabeans turned the kingdom over to in an effort to be 'people of +the text'

+

Hasmoneans are 7 famlies that have descended from Zaddok. Over the course of +2-3 decades they become entirely Hellenistic. These ones are known in the +Gospels as the Chief Priests which is a different group than teachers of the Law

+
+

The Chief Priests are a corrupt religious Mafia

+
+

Originally "Saducee" referred to direct descendents of Zaddok, which are a +subset of Levitical descendents. Come Jesus-time Saduccee becomes anyone who +agrees with the priestly system... Not all priests were Saducees (See Zachariah

+
    +
  • father of John the Baptist. He was a righteous priest which didn't exist in +their day - he was not a Saducee, he was faithful to Torah not Hellenism)
  • +
+

Rome's Influence

+

Herod essentially controlled the world's wealth due to his own position as king +(of where?). Hasmonean's persued Herod and asked him to marry a Hasmonean +daughter in order to be called Jewish. Hasmoneans did this as they saw their +time coming to an end with the rising power of Rome. Herod saw the opportunity, +took it, and then he extends an olive branch to Caesar - and Caesar accepts the +partnership which turns Herod into basically a puppet king of Judea

+

Herod then begins to auction off the High Priesthood - furthering priestly +corruption. Annas (Caiphas is Annas' son) is the one who buys the priesthood - +and the priesthood stays with this family until the destruction of Jerusalem in +AD 70.

+

Timeline

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
yearthing
586 BCBabylonian captivity of Judah
538 BCReturn to Israel (Decree of Cyrus)
332 BCAlexander the Great conquers Palestine
330–198 BCRule of Hellenistic Ptolemies over Jews
198–167 BCOppression under Hellenistic Seleucids
167 BCMaccabean revolt
167–63 BCHasmonean (Maccabean) kingdom
63 BCRoman conquest of Judea
37 BCReign of Herod begins
c. 6 BCBirth of Jesus
4 BCHerod’s death
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/077-silent-years-herodians.html b/077-silent-years-herodians.html new file mode 100644 index 00000000..7accb9bd --- /dev/null +++ b/077-silent-years-herodians.html @@ -0,0 +1,353 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 077 Silent Years - Herodians | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

077 Silent Years - Herodians

+ + + + + +
+ + + +
+

Herodians show up twice in the Gospels, Josephus talks about them a bit as +well. There is a lot of hsitorical debate that surrounds the Herodians.

+
+

Like Republicans and Democracts meant one thing in American history, but +those positions and words mean something different today - the same is true +in history, and with Herodians.

+
+

They were believed to be the political party, however formal, to be alligned with Kind Herod.

+

We are also, presently, very hellenistic and even herodian. We are into the +luxury, we like convenience, we have entertainment/theaters. There's nothing +wrong with luxury, entertainment, plumbing, wealth, etc... The Saducees misused +Hellenism to their own detrement - they turned amoral Hellenism into a +worldview that pushed Yahweh out of the center and put human and self into the +center of the worldview

+
+

Herodians toed the line between reluctantly becoming hellenistic and +corrupting their worship with hellenism

+
+

!!! warning +I am (hopefully reluctantly) hellenistic as well...

+

Embracing hellenism is not black and white, it is amoral... To spend money on +life, enjoy entertainment, decorate our homes, etc... can we appreciate +luxuries without compromising on Yahweh worship?

+

timestamp: 21:45

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/078-silent-years-essenes.html b/078-silent-years-essenes.html new file mode 100644 index 00000000..cbd4d241 --- /dev/null +++ b/078-silent-years-essenes.html @@ -0,0 +1,416 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + 078 Silent Years - Essenes | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

078 Silent Years - Essenes

+ + + + + +
+ + + + + +
+

link to presentation

+

Hellenism

+

During the "silent years" Hellenism was on the rise, even among several Jewish circles.

+

Essenes

+

Another Jewish group (like Pharisees, Herodians, etc.) with a lot of debate +surrounding them. They were largely men, maybe a few women (which is +confusing), that were largely driven by priests. They claim God has abandoned +the system the corrupt Pharisees had come to adopt and so they went out into +the desert (very sepratist) and basically just prepared for the end times. They +condemned the Temple system - because of the corruption - however some Essenes +continued to serve in the Temple because they felt they couldn't abandon God's +calling on their lives

+

Scripture

+

!!! scripture

+
16  Thus says the Lord: 
+  “Stand by the roads, and look, 
+and ask for the ancient paths, 
+  where the good way is; and walk in it, 
+and find rest for your souls. 
+  But they said, ‘We will not walk in it.’ 
+
+The Holy Bible: English Standard Version (Je 6:16). (2016). Crossway Bibles.
+
+

Dead Sea Scrolls

+

Essenes are credeited with writing the DSS.

+

These served to validate basically all of what we have in our modern translated Bibles

+

Living Water

+

Can only come from a spring or rain. Living water is what must be used to +fill the baptistrys that the Essenes used. So they would dig canals from wadis +(pools of water in the desert) to fill their mikvahs (baptistrys).

+

Scripture

+

Another passage Essenes hold to is Isaiah 40:

+

!!! scripture

+
40 Comfort, comfort my people, says your God. 
+ 2  Speak tenderly to Jerusalem, 
+and cry to her 
+  that her warfare is ended, 
+that her iniquity is pardoned, 
+  that she has received from the Lord’s hand 
+double for all her sins. 
+ 3  A voice cries: 
+  “In the wilderness prepare the way of the Lord; 
+make straight in the desert a highway for our God. 
+ 4  Every valley shall be lifted up, 
+and every mountain and hill be made low; 
+  the uneven ground shall become level, 
+and the rough places a plain. 
+ 5  And the glory of the Lord shall be revealed, 
+and all flesh shall see it together, 
+for the mouth of the Lord has spoken.” 
+
+The Holy Bible: English Standard Version (Is 40:1–5). (2016). Crossway Bibles.
+
+

!!! note John the Baptist

+
Likely that Zacharia had connections to Essenes movement, and that John was
+dedicated to the LORD via being raised in an Essene community. The only
+non-Essene thing he really did was to _go out_ and baptize people whereas
+Essene-like action is to wait for other to come to them
+
+

Sepratists

+

Unlike Herodians who went out and engaged the world (not that everything they +did was good), this is in stark contrast to the Essenes community which is that +they are out in the desert, away from everyone, no "crossroads of the earth" +idea, and did not go out into the world - one of the negatives

+ +
+ +
+ + +
+ +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/404.html b/404.html new file mode 100644 index 00000000..06e507b3 --- /dev/null +++ b/404.html @@ -0,0 +1,238 @@ + + + + + + + + + + + + + + + + + + + + + + + + + Not Found | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + + + +

Not Found

+
+ +
+ + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/about.html b/about.html new file mode 100644 index 00000000..4ac31d46 --- /dev/null +++ b/about.html @@ -0,0 +1,260 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + About | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

About

+ + + + + +
+ + + +
+

I write about things I find interesting in tech and theology

+ +
+ +
+ + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/abraham-and-melchizedek.html b/abraham-and-melchizedek.html new file mode 100644 index 00000000..d8c98543 --- /dev/null +++ b/abraham-and-melchizedek.html @@ -0,0 +1,520 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Abraham and Melchizedek | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Abraham and Melchizedek

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

link to study

+

Video

+

Priests

+

God creates Eden in which he places humans to be his royal image - priests. God +sets humans up to receive his blessing but humans choose their own way. The +promise is for a priest and a sacrifice to come in Jesus.

+

God chooses Abraham and Sarah as the first royal priesthood as they are chosen +by God to bless all the nations.

+

Melchizedek

+

A priestly king of Salem. Melchizedek recognizes Yahweh as the God of gods - +Abraham tithes to him and that's about the end of the story

+

Salem is ancient short name for Jerusalem. +Abraham's tithe to Melchizedek is just like the Israelite call to tithe to the +Levites (priests) to support them.

+

Royal Family

+

Abraham and Sarah are promised their own children but they take amtters into +their own hands by scheming with Hagar. Eventually Sarah is given her own son, +Issac, who God then calls for his life as a test of Abraham - it represents God +challenging Abraham to trust him with his own promise, and to not go his own +way with Sarah

+

DUring the Isaac sacrifice narrative a ram is given in place and Abraham names the place "God will provide".

+

Types

+

The story of God's call to sacrifice Isaac is much like the story of Abraham +meeting Melchizedek. In the Melchizedek story Abraham meets a priest on a high +place and gives him an offering. In the Isaac story Abraham acts as the priest +and a ram is given to him by the LORD that covers the sins of Abraham's family.

+

!!! note "Atonement and Covering"

+
Covering the sin in this case looks much more like redemption and resolve
+rather than payment for gult, similar to a small-scale apology can cover a
+grievance even though no payment is made to make anything 'right', the
+'covering' is simply a sign of forgiveness
+
+

Questions

+

!!! note "1"

+
Shalem, or Salem, is later known as Jerusalem. Moriah, a mountainous region in
+Jerusalem, is later called the “mount of the LORD” (Genesis 22:14) and the
+“temple mount” (2 Chronicles 3:1). With all of this in mind, compare Genesis
+14:17-20 with Genesis 22:1-14 . How do you see God providing for Abraham in
+these similar settings?
+
+

!!! scripture "Genesis 22:14"

+
14Abraham called the name of that place The Lord Will Provide, as it is
+said to this day, “In the mount of the Lord it will be provided.”
+
+

!!! scripture "2 Chronicles 3:1"

+
The Temple Construction in Jerusalem
+
+1Then Solomon began to build the house of the Lord in Jerusalem on Mount
+Moriah, where the Lord had appeared to his father David, at the place that
+David had prepared on the threshing floor of Ornan the Jebusite.
+
+

!!! scripture "Genesis 14:17-20"

+
God’s Promise to Abram
+
+17Then after his return from the defeat of Chedorlaomer and the kings who
+were with him, the king of Sodom went out to meet him at the valley of
+Shaveh (that is, the King’s Valley). 18And Melchizedek king of Salem
+brought out bread and wine; now he was a priest of God Most High. 19He
+blessed him and said,
+
+“Blessed be Abram of God Most High,
+
+Possessor of heaven and earth;
+
+20And blessed be God Most High,
+
+Who has delivered your enemies into your hand.”
+
+He gave him a tenth of all.
+
+

!!! scripture "Genesis 22:1-14"

+
The Offering of Isaac
+
+1Now it came about after these things, that God tested Abraham, and said to
+him, “Abraham!” And he said, “Here I am.” 2He said, “Take now your son,
+your only son, whom you love, Isaac, and go to the land of Moriah, and
+offer him there as a burnt offering on one of the mountains of which I will
+tell you.” 3So Abraham rose early in the morning and saddled his donkey,
+and took two of his young men with him and Isaac his son; and he split wood
+for the burnt offering, and arose and went to the place of which God had
+told him. 4On the third day Abraham raised his eyes and saw the place from
+a distance. 5Abraham said to his young men, “Stay here with the donkey, and
+I and the lad will go over there; and we will worship and return to you.”
+6Abraham took the wood of the burnt offering and laid it on Isaac his son,
+and he took in his hand the fire and the knife. So the two of them walked
+on together. 7Isaac spoke to Abraham his father and said, “My father!” And
+he said, “Here I am, my son.” And he said, “Behold, the fire and the wood,
+but where is the lamb for the burnt offering?” 8Abraham said, “God will
+provide for Himself the lamb for the burnt offering, my son.” So the two of
+them walked on together. 
+
+9Then they came to the place of which God had told
+him; and Abraham built the altar there and arranged the wood, and bound his
+son Isaac and laid him on the altar, on top of the wood. 10Abraham
+stretched out his hand and took the knife to slay his son. 11But the angel
+of the Lord called to him from heaven and said, “Abraham, Abraham!” And he
+said, “Here I am.” 12He said, “Do not stretch out your hand against the
+lad, and do nothing to him; for now I know that you fear God, since you
+have not withheld your son, your only son, from Me.” 13Then Abraham raised
+his eyes and looked, and behold, behind him a ram caught in the thicket by
+his horns; and Abraham went and took the ram and offered him up for a burnt
+offering in the place of his son. 14Abraham called the name of that place
+The Lord Will Provide, as it is said to this day, “In the mount of the Lord
+it will be provided.”
+
+

!!! success ""

+
5Abraham said to his young men, “Stay here with the donkey, and I and the
+lad will go over there; and we will worship and return to you.”
+
+ + + + + + + + + + + + + + + + + +
Genesis 14Genesis 22
Melchizedek provides bread and wineYahweh provides the ram
Yahweh gave Abram victory over ChedorlaomerYahweh gave Abraham Isaac's safety
+

!!! note "3"

+
As you review Hebrews 7 , notice how the author assures their audience that
+Jesus is better than any other priest. What are some of the reasons the
+author provides? How is this good news for everyone?
+
+

!!! scripture "Hebrews 7"

+
Melchizedek’s Priesthood Like Christ’s
+
+1For this Melchizedek, king of Salem, priest of the Most High God, who met Abraham as he was returning from the slaughter of the kings and blessed him, 2to whom also Abraham apportioned a tenth part of all the spoils, was first of all, by the translation of his name, king of righteousness, and then also king of Salem, which is king of peace. 3Without father, without mother, without genealogy, having neither beginning of days nor end of life, but made like the Son of God, he remains a priest perpetually.
+
+4Now observe how great this man was to whom Abraham, the patriarch, gave a tenth of the choicest spoils. 5And those indeed of the sons of Levi who receive the priest’s office have commandment in the Law to collect a tenth from the people, that is, from their brethren, although these are descended from Abraham. 6But the one whose genealogy is not traced from them collected a tenth from Abraham and blessed the one who had the promises. 7But without any dispute the lesser is blessed by the greater. 8In this case mortal men receive tithes, but in that case one receives them, of whom it is witnessed that he lives on. 9And, so to speak, through Abraham even Levi, who received tithes, paid tithes, 10for he was still in the loins of his father when Melchizedek met him.
+
+11Now if perfection was through the Levitical priesthood (for on the basis of it the people received the Law), what further need was there for another priest to arise according to the order of Melchizedek, and not be designated according to the order of Aaron? 12For when the priesthood is changed, of necessity there takes place a change of law also. 13For the one concerning whom these things are spoken belongs to another tribe, from which no one has officiated at the altar. 14For it is evident that our Lord was descended from Judah, a tribe with reference to which Moses spoke nothing concerning priests. 15And this is clearer still, if another priest arises according to the likeness of Melchizedek, 16who has become such not on the basis of a law of physical requirement, but according to the power of an indestructible life. 17For it is attested of Him,
+
+“You are a priest forever
+
+According to the order of Melchizedek.”
+
+18For, on the one hand, there is a setting aside of a former commandment because of its weakness and uselessness 19(for the Law made nothing perfect), and on the other hand there is a bringing in of a better hope, through which we draw near to God. 20And inasmuch as it was not without an oath 21(for they indeed became priests without an oath, but He with an oath through the One who said to Him,
+
+“The Lord has sworn
+
+And will not change His mind,
+
+‘You are a priest forever’ ”);
+
+22so much the more also Jesus has become the guarantee of a better covenant.
+
+23The former priests, on the one hand, existed in greater numbers because they were prevented by death from continuing, 24but Jesus, on the other hand, because He continues forever, holds His priesthood permanently. 25Therefore He is able also to save forever those who draw near to God through Him, since He always lives to make intercession for them.
+
+26For it was fitting for us to have such a high priest, holy, innocent, undefiled, separated from sinners and exalted above the heavens; 27who does not need daily, like those high priests, to offer up sacrifices, first for His own sins and then for the sins of the people, because this He did once for all when He offered up Himself. 28For the Law appoints men as high priests who are weak, but the word of the oath, which came after the Law, appoints a Son, made perfect forever.
+
+
    +
  1. Melchizedek was "king of righteousness" and "kind of peace", Jesus is a priest according to "the order of Melchizedek" and so seems to be that Jesus is the continued reigning king of righteousness and peace
  2. +
  3. Melchizedek was priest of God Most High - the priestly order changed to Levi with the giving of the Law... Jesus represents, and is, another change in the priesthood which necessitates another change in law (verse 12). Jesus' kingship and priesthood is more similar to Melchizek's than Levi's (who was no king anyways).
  4. +
  5. Levitical priesthood was not bound by an oath - but Jesus' priesthood is bound by Yahweh's oath to not change his mind, Jesus is priest forever
  6. +
  7. Former priests, Levites, changed due to death, but Jesus persists forever (Melchizedek also presumably died)
  8. +
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/abstract-base-class.html b/abstract-base-class.html new file mode 100644 index 00000000..4cb76b6e --- /dev/null +++ b/abstract-base-class.html @@ -0,0 +1,383 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Abstract-Base-Class | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Abstract-Base-Class

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

ABCMeta

+

I don't do a lot of OOP currently, but I have been on a few heavy OOP projects and this ABCMeta and abstractmethod from abc would've been super nice to know about!

+

If you are creating a library with classes that you expect your users to extend, but you want to ensure that any extension has explicit methods defined then this is for you!.

+
from abc import ABCMeta, abstractmethod
+class Family(metaclass=ABCMeta):
+    @abstractmethod
+    def get_dad(self):
+        """Any extension of the Family class must implement a `get_dad` method"""
+
+class MyFamily(Family):
+    pass
+
+
+

If I try to instantiate MyFamily I will not be allowed:

+

+❯ my_fam = MyFamily()
+╭─────────────────────────────── Traceback (most recent call last) ────────────────────────────────╮
+│ <ipython-input-8-ecb8e21ce815>:1 in <module>                                                     │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────╯
+TypeError: Can't instantiate abstract class MyFamily with abstract methods get_dad
+
+
+

Alt text
abcmeta

+

In order for me to extend Family I have to implement the method get_dad

+
class MyFamily(Family):
+    def get_dad(self):
+        return "Me"
+
+

Now everything works as expected and I can sleep well knowing no one can extend my base class without creating methods I know they need.

+

+my_fam = MyFamily()
+
+my_fam.get_dad()
+'Me'
+
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/adblock-coverage.html b/adblock-coverage.html new file mode 100644 index 00000000..f05f623c --- /dev/null +++ b/adblock-coverage.html @@ -0,0 +1,341 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Adblock-Coverage | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Adblock-Coverage

+ + + + + +
+ + + +
+

I run pi-hole at home for ad blocking and some internal DNS/DHCP handling.

+

pi hole posts on the way

+

One thing I've never put too much thought in is asking "how well am I doing at blocking?" +There's lots of ways to measure that depending on what you care about but I just learned of adblock tester. +It's awesome and gave me a quick glimpse into how my pi-hole is performing on keeping my webpages clean and my DNS history private!

+

Credits to d3ward for the awesome tool!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/add-colored-indicators-to-your-dataframes-html-representation.html b/add-colored-indicators-to-your-dataframes-html-representation.html new file mode 100644 index 00000000..46eaa017 --- /dev/null +++ b/add-colored-indicators-to-your-dataframes-html-representation.html @@ -0,0 +1,492 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Add colored indicators to your dataframes html representation | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Add colored indicators to your dataframes html representation

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Mike Driscoll recently tweeted about making +colored out with pandas DataFrames and I just had to try it for myself

+

Use Case

+

First though... why? +My biggest use case is a monitoring pipeline of mine... The details aside, the +output of my pipeline is a dataframe where each row has information about a +failed pipeline that I need to go look into. I dump that result to a simle html +file that's hosted on an internal site and the file is updated every couple of +hours. Adding some colored indicators automatically to the rows to help me +assess severity of each record would be a handy way to quickly get an +understanding the state of our pipelines.

+

How?

+

The docs for the applymap method state simply:

+
Apply a CSS-styling function elementwise.
+
+Updates the HTML representation with the result.
+
+
+

So we can write a function that returns color: {color} based on the dataframe +values and when we drop that dataframe to html we'll have some simple css +styling applied automagically!

+

By default the function will be applied to all columns of the dataframe, but +that's not useful if the columns are different types which is usually the case. +Luckily there is a subset keyword to only apply to the columns you need!

+

Consider my example

+
sandbox   main via 3.8.11(sandbox) ipython
+❯ df = pd.read_csv("cars.csv")
+
+sandbox   main via 3.8.11(sandbox) ipython
+❯ def mpg_color(val: float):
+...:     color = "red" if val < 21 else "green"
+...:     return f"color: {color}"
+
+sandbox   main via 3.8.11(sandbox) ipython
+❯ df.style.applymap(mpg_color, subset="mpg").to_html("color.html")
+
+

I want to quickly see if the mpg is any good for the cars in the cars dataset +and I'll define "good" as better than 21 mpg (not great I know but just for the +sake of discussion...)

+

The function returns an appropriate css string and after I style.applymap on just the mpg column we get this!

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
 Unnamed: 0mpgcyldisphpdratwtqsecvsamgearcarb
0Mazda RX421.0000006160.0000001103.9000002.62000016.4600000144
1Mazda RX4 Wag21.0000006160.0000001103.9000002.87500017.0200000144
2Datsun 71022.8000004108.000000933.8500002.32000018.6100001141
3Hornet 4 Drive21.4000006258.0000001103.0800003.21500019.4400001031
4Hornet Sportabout18.7000008360.0000001753.1500003.44000017.0200000032
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/add-space-to-your-lvm-on-ubuntu.html b/add-space-to-your-lvm-on-ubuntu.html new file mode 100644 index 00000000..46a28dc2 --- /dev/null +++ b/add-space-to-your-lvm-on-ubuntu.html @@ -0,0 +1,373 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Add space to your LVM on Ubuntu | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Add space to your LVM on Ubuntu

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I ran out of space on the SSD in my server when doing some file transfers but only 100GB was used of a 256 GB SSD?

+

LVM

+

When installing Ubuntu live server the default option for how to partition the +disk (in my experience) has been to setup an LVM group that defaults to less +than the available space. Most recently I put Ubuntu server on a 256 GB SSD but +the main partition was formatted as an LVM group with 100GB of storage... I +didn't think anything of this even though I'm mostly used to EXT4.

+

I think the reason for LVMs is performance, but in hindsight, I don't really +care much about the performance differences, I really just want all my storage +that's fast enough

+

Extending the LVM

+

A moment of googling brought me to Ubuntu's wiki and I +learned that I can expand my LVM to the space I need...

+

sudo lvdisplay and sudo pvdisplay show detailed views of the logical volumes and physical volumes respectively.

+

Take a look at those and find the volume you need to extend. For me I found this:

+
  --- Logical volume ---
+  LV Path                /dev/ubuntu-vg/ubuntu-lv
+  LV Name                ubuntu-lv
+  VG Name                ubuntu-vg
+  LV Write Access        read/write
+  LV Status              available
+  ...
+
+

There's more that you'll see but this is what's relevant - I need to extend the +ubuntu-lv logical volume in the ubuntu-vg volume group.

+

sudo lvextend -L +50g ubuntu-vg/ubuntu-lv gives me 50 more GB of storage which should be enough for at least tonight 🤓

+

RTFM

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/adding-docker-daemon-json-broke-docker.html b/adding-docker-daemon-json-broke-docker.html new file mode 100644 index 00000000..93a24c9b --- /dev/null +++ b/adding-docker-daemon-json-broke-docker.html @@ -0,0 +1,333 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Adding docker daemon.json broke docker | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Adding docker daemon.json broke docker

+ + + + + +
+ + + +
+

in /lib/systemd/system/docker.service there is an ExecStart command that got placed there when I setup Docker with Ansible - it threw the -H flag which told the daemon what hosts to setup. But I added the "hosts" key in my daemon.json and it broke - so removing the -H flag from the systemd unit fixed it

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/adding-ip-camera-to-motioneye-on-home-assistant-os.html b/adding-ip-camera-to-motioneye-on-home-assistant-os.html new file mode 100644 index 00000000..5f4a4f25 --- /dev/null +++ b/adding-ip-camera-to-motioneye-on-home-assistant-os.html @@ -0,0 +1,336 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Adding IP Camera to motionEye on Home Assistant OS | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Adding IP Camera to motionEye on Home Assistant OS

+ + + + + +
+ + + +
+
    +
  1. Dropdown menue in upper left - doesn't look like one but just click the name of the current device.
  2. +
  3. URL will be rtsp://<ip address> <- this was the ticket for me
  4. +
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/advent-2024-peace.html b/advent-2024-peace.html new file mode 100644 index 00000000..c74ae7e3 --- /dev/null +++ b/advent-2024-peace.html @@ -0,0 +1,360 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Advent 2024 - Peace | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Advent 2024 - Peace

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Scripture

+

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

+

Edification

+

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

+

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

+

You all know we messed that up, Shalom was broken and humanity was exiled.

+

But we have a Great Healer.

+

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

+

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

+

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

+

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

+

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

+

Finally I pray we may all be given, and accept, the conviction of Paul -

+

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

+

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/and-vs.html b/and-vs.html new file mode 100644 index 00000000..1db4d766 --- /dev/null +++ b/and-vs.html @@ -0,0 +1,555 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + And-vs-& | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

And-vs-&

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I often struggle to remember the correct way to do and type comparisons when working in pandas.

+

I remember learning long long ago that and and & are different, the former being lazy boolean evaluation whereas the latter is a bitwise operation.

+

I learned a lot from this SO post

+

Lists

+

Python list objects can contain unlike elements - ie. [True, 'foo', 1, '1', [1,2,3]] is a valid list with booleans, strings, integers, and another list. +Because of this, we can't use & to compare two lists since they can't be combined in a consistent and meaningful way.

+

However we can use and since it doesn't do bitwise operations, it just evaluates the boolean value of the list (basically if it's non-empty then bool(my_list) evaluates to True)

+

Here's an example:

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ my_list = [1, "2", "foo", [True], False]
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ bool(my_list)
+True
+
+

If we compare my_list with another_list using and then the comparision will go:

+
if bool(my_list):
+    if bool(another_list):
+       <operation> 
+    else:
+       break
+
+

Let's see another example:

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ another_list = [False, False]
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ my_list and another_list
+[False, False]
+
+

bool(my_list) evaluated to True, and bool(another_list) also evaluated to True even though it's full of False values because the object is non-empty.

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if my_list and another_list:
+...:     print("foo")
+foo
+
+

So using and in this case results in a True conditional, so the print statement is executed.

+

Feels kind of counter-intuitive at first glance, to me anyways...

+

However, we can't use & because there isn't a meaningful to do bitwise operations over these two lists:

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ my_list & another_list
+╭─────────────────────────────── Traceback (most recent call last) ────────────────────────────────╮
+│ <ipython-input-19-a2a16cebb3da>:1 in <cell line: 1>                                              │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────╯
+TypeError: unsupported operand type(s) for &: 'list' and 'list'
+
+
+

Numpy

+

numpy arrays are special and they have a lot of fancy vectorization utilities built-in which make them great and fast for mathematical operations but now our logical comparisons need to be handled with a different kind of care.

+

First thing though - without some trickery they do not hold mixed data types like a list does (necessary, I think, for the vectorized optimization that numpy is built on top of)

+

With that out of the way here's the main thing for this post, we can't just evaluate the bool of an array - numpy says no no no.

+

+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ arr = np.array(["1", 2, True, False])
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ arr
+array(['1', '2', 'True', 'False'], dtype='<U21')
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ bool(arr)
+╭─────────────────────────────── Traceback (most recent call last) ────────────────────────────────╮
+│ <ipython-input-25-4e8c5dd85b93>:1 in <cell line: 1>                                              │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────╯
+ValueError: The truth value of an array with more than one element is ambiguous. Use a.any() or a.all()
+
+
+
+

This means that using and with numpy arrays doesn't really make sense because we probably care about the truth value of each element (bitwise), not the truth value of the array.

+
+

Notice that when I print arr all the elements are a string - and the dtype is <U21 for all elements.

+

This is not how I instantiated the array so be aware of that behavior with numpy.

+
+

<U21 is a dtype expressing the values are 'Little Endian', Unicode, 12 characters. See here for docs for docs

+
+

So for logical comparisions we should look at the error message then... +Our handy error message says to try any or all

+

Because the datatypes in this example are basically strings, using arr.any() will result in an error that I do not fully understand, but any(arr) and all(arr) work...

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if arr.any():
+...:     print("foo")
+╭─────────────────────────────── Traceback (most recent call last) ────────────────────────────────╮
+│ <ipython-input-48-25ecac52db96>:1 in <cell line: 1>                                              │
+│ /home/u_paynen3/personal/sandbox/.venv/sandbox/lib/python3.8/site-packages/numpy/core/_methods.p │
+│ y:57 in _any                                                                                     │
+│                                                                                                  │
+│    54 def _any(a, axis=None, dtype=None, out=None, keepdims=False, *, where=True):               │
+│    55 │   # Parsing keyword arguments is currently fairly slow, so avoid it for now              │
+│    56 │   if where is True:                                                                      │
+│ ❱  57 │   │   return umr_any(a, axis, dtype, out, keepdims)                                      │
+│    58 │   return umr_any(a, axis, dtype, out, keepdims, where=where)                             │
+│    59                                                                                            │
+│    60 def _all(a, axis=None, dtype=None, out=None, keepdims=False, *, where=True):               │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────╯
+UFuncTypeError: ufunc 'logical_or' did not contain a loop with signature matching types (None, <class 'numpy.dtype[str_]'>) -> None
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+
+❯ if all(arr):
+...:     print("foo")
+foo
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if any(arr):
+...:     print("foo")
+foo
+
+

Let's change the example to just use integers and see what happens:

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ arr2 = np.array([1, True, False])
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ arr2
+array([1, 1, 0])
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if arr2.any():
+...:     print("foo")
+foo
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if arr2.all():
+...:     print("foo")
+
+
+

Ah, now some sanity... +First, the booleans are stored as integers, which based on this discussion makes sense. +Next we check if any values (this is a bitwise operation) are True, which we see they are so the conditional evaluates to True. +Howver, if we check that all values are True we see they aren't, the last value is False or 0 so the conditional fails.

+

This is a different way to evaluate logical conditions than with lists and it's because of the special nature of numpy arrays that allows them to be compared bitwise but on the flip side, there isn't a meaningful way to evaluate the truth value of an array.

+

Pandas

+

Now for pandas, which under the hood is a lot of numpy but not fully. +pandas.Series objects can hold mixed data types like lists, however to logically evaluate truth values we have to treat them like numpy arrays.

+

+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ s = pd.Series([1, "foo", True, False])
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ s
+
+0        1
+1      foo
+2     True
+3    False
+dtype: object
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ bool(s)
+╭─────────────────────────────── Traceback (most recent call last) ────────────────────────────────╮
+│ <ipython-input-60-68e48e81da14>:1 in <cell line: 1>                                              │
+│ /home/u_paynen3/personal/sandbox/.venv/sandbox/lib/python3.8/site-packages/pandas/core/generic.p │
+│ y:1527 in __nonzero__                                                                            │
+│                                                                                                  │
+│    1524 │                                                                                        │
+│    1525 │   @final                                                                               │
+│    1526 │   def __nonzero__(self):                                                               │
+│ ❱  1527 │   │   raise ValueError(                                                                │
+│    1528 │   │   │   f"The truth value of a {type(self).__name__} is ambiguous. "                 │
+│    1529 │   │   │   "Use a.empty, a.bool(), a.item(), a.any() or a.all()."                       │
+│    1530 │   │   )                                                                                │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────╯
+ValueError: The truth value of a Series is ambiguous. Use a.empty, a.bool(), a.item(), a.any() or a.all().
+
+
+

Just like with numpy, we can't evaluate the truth value of the series in a meaningful way, but bitwise operations make perfect sense...

+

+❯ if s.any():
+...:     print("foo")
+foo
+
+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ if s.all():
+...:     print("foo")
+
+
+

I thought this was about and and &...

+

Right, so recall that and is a lazy boolean evaluation (ie. it evaluates the 'truth value' an object) whereas & does bitwise comparison.

+

What we see then with pandas and numpy is that if we want to do logical comparisons, we need to do them bitwise, ie. use &.

+

Keep in mind though that the data types make a big deal - we can't use & with strings because the bitwise operation isn't supported, for strings we need to use the boolean evaluation.

+

The Original Point

+

My main use case for this is finding elements in a dataframe/series based on 2 or more columns aligning row values...

+

Say I have a dataframe like this:

+

+sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ df
+
+   s s2   s3
+0  1  0  foo
+1  1  a  bar
+2  1  b  baz
+3  2  a  fee
+4  2  0   fi
+
+

Example use case is I want to get the values in s3 where s is 1 and s2 is 'a'. ie. I'm just after bar for now...

+

Up until now I've always just tried df.s3[(df.s == 1) and (df.s2 == "a")] the first time and every single time I've gotten this error that I just haven't ever fully understood:

+
ValueError: The truth value of a Series is ambiguous. Use a.empty, a.bool(), a.item(), a.any() or a.all().
+
+

But after this deep dive I think I've grasped that and doesn't actually do what I want here, and in order to do the bitwise comparision I need to use &

+
sandbox NO VCS  via 3.8.11(sandbox) ipython
+❯ df.s3[(df.s == 1) & (df.s2 == "a")]
+
+1    bar
+Name: s3, dtype: object
+
+

End

+

Hopefully this set of ramblings brings some clarity to and and & and you can Google one less error in the future in your logical comparison workflows 😄

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/append-string-to-list-of-files-with-xarg.html b/append-string-to-list-of-files-with-xarg.html new file mode 100644 index 00000000..6e82944e --- /dev/null +++ b/append-string-to-list-of-files-with-xarg.html @@ -0,0 +1,331 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Append string to list of files with xarg | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Append string to list of files with xarg

+ + + + + +
+ + + +
+

❯ find . -name "requirements.in" -print0 | xargs -0 sh -c 'for arg in "$@"; do echo "awscli" >>"$arg"; done'

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/archive-2022-1.html b/archive-2022-1.html new file mode 100644 index 00000000..7c892bc8 --- /dev/null +++ b/archive-2022-1.html @@ -0,0 +1,438 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 1
+
+ + + + + +
+
+
+
+

Modal labs

+ +
+

+ + +Playing around with Modal Labs +One of the first things I tried was a regular cron job... +@stub.function( + schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret") +) +def say_hi(): + now = time.ctime() + sec ... + read more → +

+ +
+ + +
+ +

+ + +I have a bash script called syncoid-job which boils down to a barebones - +#!/bin/bash + +syncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas + +I want to run this script hourly but a ... + read more → +

+ +
+ +
+ +

+ + +I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as +an example... I'll want to play with something but if I don't start Neovim as +root then I get in trouble making edits I can't save! So +suda.vim gives me +:SudaWrite which ... + read more → +

+ +
+ +
+ +

+ + +AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entry ... + read more → +

+ +
+ +
+ +

+ + +I wanted to break down some long lines in a Markdown table cell to make it look +nicer on my blog but \n didn't do anything for me... turns out is the +magic sauce + + + +Column 1 +Column 2 + + + + +Key +Doggo ipsum many pats. Borkdrive borking doggo doing me a ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-10.html b/archive-2022-10.html new file mode 100644 index 00000000..ef57735c --- /dev/null +++ b/archive-2022-10.html @@ -0,0 +1,427 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 10 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 10
+
+ + + + + +
+
+
+ +

+ + +My moonlander is great, and I just recently added CAPS LOCK back to my keymapping but I've moved it... +At present it is where the ESC kep usually is however I'm trying to match my general moonlander usage with a keymap that fits on a planck. +Because ... + read more → +

+ +
+
+ +

+ + +My current homelab setup is not great but it works... +Proxmox on PowerEdge R610 +I boot off an SD card and have 1 SSD and 5 HDDs configured as a JBOD array using a Dell H700 SAS controller. +I cannot boot from a disk using this controller and I can't ... + read more → +

+ +
+
+
+

And-vs-&

+ +
+

+ + +I often struggle to remember the correct way to do and type comparisons when working in pandas. +I remember learning long long ago that and and & are different, the former being lazy boolean evaluation whereas the latter is a bitwise operation. +I ... + read more → +

+ +
+
+
+

File-length

+ +
+

+ + +I have a specific need for counting the number of lines in a file quickly. +At work we use S3 for data storage during our Kedro pipeline development, and in the development process we may end up orphaning several datasets. +In order to keep our worksp ... + read more → +

+ +
+
+ +

+ + +I have a post on starship where I have some notes on how I use starship to make my zsh experience great with a sweet terminal prompt. +Now... I spend quite a bit of time in ipython every day and I got kind of sick of the vanilla experience and wanted ... + read more → +

+ +
+
+ +

+ + +Did you know you can spell check in Vim?! + + + + Vim Spell check + + + Without... + Here is a missspelled word. + <h3>With!</h3> + <p>Here is a <u>missspelled</u> word.</p> + + + +What is this magi ... + read more → +

+ +
+
+
+

Polybar-01

+ +
+

+ + +polybar is an awesome and super customizable status bar for your desktop environment. +I use it with i3-gaps on Ubuntu for work and it makes my day just that much better to have a clean and elegant bar with the things in it that I care about. +The Git ... + read more → +

+ +
+
+
+

Deques

+ +
+

+ + +I am working on a project to create a small system monitoring dashboard using the python psutil library. +The repo is here (if you want actual system monitoring please use netdata). +I'm using streamlit and plotly for the webserver, design, and plotti ... + read more → +

+ +
+
+ +

+ + +Streamlit +I use streamlit for any EDA I ever have to do at work. +It's super easy to spin up a small dashboard to filter and view dataframes in, live, without the fallbacks of Jupyter notebooks (kernels dying, memory bloat, a billion "Untitled N ... + read more → +

+ +
+
+
+

Starship

+ +
+

+ + +If you spend time in the terminal then you'll want it to look somewhat pleasing to the eye. +I used to ssh into servers with no customization, use vi to edit a file or two, then get back to my regularly scheduled programming in VS C**e... +One of the ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-11.html b/archive-2022-11.html new file mode 100644 index 00000000..68be6737 --- /dev/null +++ b/archive-2022-11.html @@ -0,0 +1,421 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 11 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 11
+
+ + + + + +
+
+
+ +

+ + +Self-hosting 1 or several media servers is another common homelab use-case. +Getting content for your media servers is up to you, but I'll show a few ways here to get content somewhat easily! +YouTube Disclaimer at Bottom +you-get +you-get is a nice cli ... + read more → +

+ +
+
+
+

Skimpy

+ +
+

+ + +EDA +I work with data a lot, but the nature of my job isn't to dive super deep into a small amount of datasets, +I'm often jumping between several projects every day and need to just get a super quick glance at some tables to get a high level view. +Wh ... + read more → +

+ +
+
+ +

+ + +NAS +One of the most common use cases for self-hosting anything is a file share system. +I have been a fan of TrueNAS for a while. +I currently use TrueNAS Core at home, and plan to consider transitioning to TrueNAS Scale soon. +Blog post forthcoming on ... + read more → +

+ +
+
+
+

Pyclean

+ +
+

+ + +I like to keep my workspace clean and one thing that I don't personally love looking at is the __pycache__ directory that pops up after running some code. +The *.pyc files that show up there are python bytecode and they are cached to make subsequent ... + read more → +

+ +
+
+
+

Psutil-01

+ +
+

+ + +Mike Driscoll has been posting some awesome posts about psutil lately. +I'm interested in making my own system monitoring dashboard now using this library. +I don't expect it to compete with Netdata or Glances but it'll just be for fun to see how Pyth ... + read more → +

+ +
+
+
+

Mu

+ +
+

+ + +If you work with a template for several projects then you might sometimes need to do the same action across all repos. +A good example of this is updating a package in requirements.txt in every project, or refactoring a common module. +If you have sev ... + read more → +

+ +
+
+
+

Wireguard

+ +
+

+ + +VPN +Virtual Private Networks are a big deal, and this shouldn't be considered anything even close to a guide on using them. +Here are just my notes and some setup for how I use wireguard at home. +Wireguard +Wireguard is an awesome peer-to-peer VPN tun ... + read more → +

+ +
+
+ +

+ + +Git +Hopefully if you write code you are using git, if not go learn the basics of commit, pull, push, and pull request/merge request like... right now. +Assuming you are at least familiar with git then you probably work the same way I have since I've ... + read more → +

+ +
+
+ +

+ + +ABCMeta +I don't do a lot of OOP currently, but I have been on a few heavy OOP projects and this ABCMeta and abstractmethod from abc would've been super nice to know about! +If you are creating a library with classes that you expect your users to exte ... + read more → +

+ +
+
+ +

+ + +Being lazy +I almost exclusively use Python for my job and have been eye-balls deep in it for almost 5 years but I really lack in-depth knowledge of builtins. +I recently learned of an awesome builtin called calendar that has way more than I know abo ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-12.html b/archive-2022-12.html new file mode 100644 index 00000000..11167b73 --- /dev/null +++ b/archive-2022-12.html @@ -0,0 +1,417 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 12 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 12
+
+ + + + + +
+
+
+ +

+ + +I am personally trying to use logger instead of print in all of my code, +however I learned from [@Python-Hub] that you can align printouts using print with f-strings!. +This little python script shows how options in the f-string can format the printo ... + read more → +

+ +
+
+ +

+ + +I have often wanted to dive into memory usage for pandas DataFrames when it comes to cloud deployment. +If I have a python process running on a server at home I can use glances or a number of other tools to diagnose a memory issue... +However at work ... + read more → +

+ +
+
+ +

+ + +I run pi-hole at home for ad blocking and some internal DNS/DHCP handling. +pi hole posts on the way +One thing I've never put too much thought in is asking "how well am I doing at blocking?" +There's lots of ways to measure that depending on ... + read more → +

+ +
+
+ +

+ + +I host a lot of services in my homelab, but they're mostly dockerized applications so I have never had to care much about how content gets served up. +Today I had several little concepts click into place regarding webservers, and it was a similar exp ... + read more → +

+ +
+
+
+

Tree

+ +
+

+ + +I wanted a quick way to generate an index.html for a directory of html files that grows by 1 or 2 files a week. +I don't know any html (the files are exports from my tiddlywiki)... +tree is just the answer. +Say I have a file structure like this: +./htm ... + read more → +

+ +
+
+
+

Traefik-01

+ +
+

+ + +Traefik +If you don't know about traefik and you need a reverse-proxy then you might want to check it out. +I used to use nginx for my reverse proxy but the config was over my head, and once it was working I was afraid to touch it. +Traefik brings a lo ... + read more → +

+ +
+
+ +

+ + +On my team we often have to change data types of columns in a pandas.DataFrame for a variety of reasons. +The main one is it tends to be an artifact of EDA whereby a file is read in via pandas but the data types are somewhat wonky (ie. dates show up ... + read more → +

+ +
+
+
+

Tiddly-wiki

+ +
+

+ + +Tiddly Wiki is a great note taking utility for organizing non-linear notes. +I used it to replace my OneNote workflow and my only complaint is I don't have an easy way to access and edit my tiddlers (posts) if I'm not at home. +The tiddlywiki is just ... + read more → +

+ +
+
+ +

+ + +I ran into an issue where I had some copy-pasta markdown tables in a docstring but the generator I used to make the table gave me tabs instead of spaces in odd places which caused black to throw a fit. +Instead of manually changing all tabs to spaes, ... + read more → +

+ +
+
+
+

Stow-target

+ +
+

+ + +Check out stow for a brief introduction to stow +What if I want to stow a package somewhere else? +Boom, that's where -t comes in... +Maybe I don't like having my dotfiles repo at $HOME and instead I want it in ~/git or ~/personal just to stay organize ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-13.html b/archive-2022-13.html new file mode 100644 index 00000000..37c62de1 --- /dev/null +++ b/archive-2022-13.html @@ -0,0 +1,544 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 13 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 13
+
+ + + + + +
+
+
+ +

+ + +After carefully staging only lines related to a specific change and comitting I suddenly realized I missed one... darn, what do I do? +Old me would have soft reset my branch to the previous commit and redone all my careful staging... what a PIA... +Ne ... + read more → +

+ +
+
+
+

Stow

+ +
+

+ + +Stow is a great tool for managing dotfiles. My usage looks like cloning my dotfiles to my home directory, setting some environment variables via a script, then stowing relevant packages and boom my config is good to go... +cd ~ +git clone <my dotfi ... + read more → +

+ +
+
+ +

+ + +Sometimes I need to manually set a static IP of a Linux machine. I generally run the latest version of Ubuntu server in my VMs at home. +In Ubuntu 20 I'm able to change up /etc/netplan/<something>.yml +network: + version: 2 + ethernets: + enp0 ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-14.html b/archive-2022-14.html new file mode 100644 index 00000000..befab160 --- /dev/null +++ b/archive-2022-14.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 14 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 14
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-15.html b/archive-2022-15.html new file mode 100644 index 00000000..8bbb3b72 --- /dev/null +++ b/archive-2022-15.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 15 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 15
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-16.html b/archive-2022-16.html new file mode 100644 index 00000000..63a86ada --- /dev/null +++ b/archive-2022-16.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 16 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 16
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-17.html b/archive-2022-17.html new file mode 100644 index 00000000..ce071e55 --- /dev/null +++ b/archive-2022-17.html @@ -0,0 +1,365 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 17 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 17
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-2.html b/archive-2022-2.html new file mode 100644 index 00000000..8f07cf52 --- /dev/null +++ b/archive-2022-2.html @@ -0,0 +1,429 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 2
+
+ + + + + +
+
+ + +
+ +

+ + +Class link +Classroom notes (Must be on home network) +01 The Shape of the Hebrew Bible +Session 1: What on Earth is the Hebrew Bible? +This class is not so much a survey of the HB, it is Tim's attempt to distil the +most helpful things for understanding ... + read more → +

+ +
+ +
+
+

Faithful

+ +
+

+ + +Link +Notes +!!! Exodusds 34:6 +Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness + +Faithfulness - Emet (can be translated 'Truth') +Related to "Amen" which is untranslated Hebrew expression meaning "t ... + read more → +

+ +
+
+ +

+ + +zfs list has a flag -r, but if you use zfs driver for docker then you'll get +flooded with every docker volume in the world. zfs list -r -d N will limit the +dept of the print out, so zfs list -r -d 2 gives me tank, tank/encrypted, +tank/encrypted/dock ... + read more → +

+ +
+ +
+
+

Sabbath

+ +
+

+ + +Link to study +Creation +Brougt to completion on the seventh day in Genesis 1. It is the only day that +does not end with 'there evening and there was morning, the Nth day' +Humans were meant to rest with God in his creation forever, but in their +reblli ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-3.html b/archive-2022-3.html new file mode 100644 index 00000000..2215963d --- /dev/null +++ b/archive-2022-3.html @@ -0,0 +1,438 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 3 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 3
+
+ + + + + +
+
+
+ +

+ + +!!! note "Babyblue v2" +Ryzen 5700x + 32 GB 3200 CL16 RAM + +<a href="https://www.passmark.com/baselines/V10/display.php?id=503041456656"><img src="https://www.passmark.com/baselines/V10/media/503041456656.png" al ... + read more → +

+ +
+ +
+
+

Chara-joy

+ +
+

+ + +link +Chara / Joy +There are several words for similar feelings - example like joy has several synonyms. +Sources +Genesis tells us creation and life bring joy +Psalm 104 - A good bottle of wine is God's gift to bring joy to people's hearts +P#lm 65 - Bea ... + read more → +

+ +
+ + +
+ +

+ + +link to study +Video +Priests +God creates Eden in which he places humans to be his royal image - priests. God +sets humans up to receive his blessing but humans choose their own way. The +promise is for a priest and a sacrifice to come in Jesus. +God cho ... + read more → +

+ +
+ +
+
+

Tree of life

+ +
+

+ + +Video +Eden +Biblical story begins in a garden, which is presented as a type of Temple. The +top (center) is the Tree of Life, which represents God's life and creative +power. Humans were supposed to eat from the Tree of Life but there's +another tree, t ... + read more → +

+ +
+
+ +

+ + +study link +Peace +!!! note "" +generally means absnese of war + +In Hebrew the word is Shalom (Greek: Eirene). Basic biblical meeting of +Shalom is "complete" or "whole". ie. a stone with no cracks, or stone wall with +nogaps ... + read more → +

+ +
+
+ +

+ + +I use Tmux and Vim for most of my workflow, but I end up with a lot of dangling +tmux sessions that dont' really need to persist... but killing them one at a +time is a pain so I wrote a little script-kitty nonsense to pipe multiple +choices from fzf i ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-4.html b/archive-2022-4.html new file mode 100644 index 00000000..00dcabfa --- /dev/null +++ b/archive-2022-4.html @@ -0,0 +1,443 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 4 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 4
+
+ + + + + +
+
+
+ +

+ + +link to presentation +Hellenism +During the "silent years" Hellenism was on the rise, even among several Jewish circles. +Essenes +Another Jewish group (like Pharisees, Herodians, etc.) with a lot of debate +surrounding them. They were largely ... + read more → +

+ +
+ +
+ +

+ + +Herodians show up twice in the Gospels, Josephus talks about them a bit as +well. There is a lot of hsitorical debate that surrounds the Herodians. + +Like Republicans and Democracts meant one thing in American history, but +those positions and words me ... + read more → +

+ +
+
+ +

+ + +Link to presentation +Sadducees +>Often we in the modern time totally conflate Sadducees and Pharisees but they +>are as Republicans and Democrats today... very much not the same +Origin +Back in the Davidic kingdom they are the group that sought t ... + read more → +

+ +
+
+ +

+ + +Hellenism + +For the first time in history, Greeks redefined worldfiew to be cenetered +around the individual. Prior to Hellenism, worldviews centered around +pleasing the gods + +Alexander the Great had his own gospel (εὐαγγέλιον - euangelion: predates b ... + read more → +

+ +
+ +
+ +

+ + +Link to presentation +Judaism +Modern Judaism is very different from Jesus' Judaism which was distinct from +David's Judaism, etc... We, as modern westerners, need to be aware of the +religious evolution and history of Judaism to properly understand the ... + read more → +

+ +
+
+ +

+ + +Intro +Session 1: Torah +Session 2: Prophets and Writings +Review +Torah +Big idea: partnership + +Basis of partnership / meet the characters (Genesis) +God chooses a partner / the partner chooses God (Exodus) +God defines the partnership (Leviticus) +God sha ... + read more → +

+ +
+
+ +

+ + +Intro +I use ZFS at home in my homelab for basically all of my storage... Docker uses +ZFS backend, all my VMs have their .qcow2 images in their own zfs datasets, +and all my shares are ZFS datasets. I love ZFS but my home hardware presently +is the opp ... + read more → +

+ +
+ + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-5.html b/archive-2022-5.html new file mode 100644 index 00000000..0dc855ea --- /dev/null +++ b/archive-2022-5.html @@ -0,0 +1,440 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 5 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 5
+
+ + + + + +
+
+
+
+

Screwtape

+ +
+

+ + +Chapters +Below are just quick notes or quotes from each chapter as a reminder of what to +go back to chat about. This isn't intended to be in-depth by any stretch. +Chapter 1 +"Your man has been accustomed, ever since he was a boy, to have a dozen ... + read more → +

+ +
+ +
+ +

+ + +Steps +sudo fdisk -l +then look for the device and partition +get the Type column +mount +Example + +dumbledore in /media NO PYTHON VENV SET +❯ sudo fdisk -l + +... + +Device Boot Start End Sectors Size Id Type +/dev/sdk1 * 2048 60371951 ... + read more → +

+ +
+ + + + + + +
+ +

+ + +man can be a pain to read... and there's lots of alternatives out there and one I've just started playing with is cheat +man man will give you this plus a billion more lines of docs, which is useful when you need it... +MAN(1) ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-6.html b/archive-2022-6.html new file mode 100644 index 00000000..47ef3e02 --- /dev/null +++ b/archive-2022-6.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 6 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 6
+
+ + + + + +
+
+
+ +

+ + +I got into a pickle where I encrypted the ssh keys I use for my SSH connections on LAN, but then I couldn't run my ansible playbook on my server! ssh-keygen -p and leave the new passphrase blank saved my day (although password protected key files ar ... + read more → +

+ +
+ + + + +
+ +

+ + +TIL that when setting up download clients for +radarr/sonarr/lidarr/readarr/bazarr/prowlarr that you can utilize internal DNS +and instead of hardcoding an IP address of your download client server, can use +just the CNAME record (ie. instead of 172.10 ... + read more → +

+ +
+
+ +

+ + +I ran out of space on the SSD in my server when doing some file transfers but only 100GB was used of a 256 GB SSD? +LVM +When installing Ubuntu live server the default option for how to partition the +disk (in my experience) has been to setup an LVM gr ... + read more → +

+ +
+
+ +

+ + +When working with tdarr remote nodes, they need to have access not only to the +same libraries but also the same transcode cache as the server otherwise the +transcodes will fail... +Network Setup +To explain I'll give a brief overview of my home setup + ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-7.html b/archive-2022-7.html new file mode 100644 index 00000000..a840e2c4 --- /dev/null +++ b/archive-2022-7.html @@ -0,0 +1,422 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 7 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 7
+
+ + + + + +
+
+ + + + + + + +
+ +

+ + +As I was cleaning up my NAS recently I noticed that I ran out of storage even +though my disk usage looked pretty low... turns out I was keeping a mega-ton of +ZFS snapshots and due to my own ignorance at the time didn't realize the +storage cost of th ... + read more → +

+ +
+ +
+ +

+ + +I started my homelab journey being super naive about ZFS and how to manage the +filesystem... that bit me in the butt when transfering a ton of files out of +folders and into datasets because ZFS is copy on write so I was essentially +duplicating my st ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-8.html b/archive-2022-8.html new file mode 100644 index 00000000..8825f74a --- /dev/null +++ b/archive-2022-8.html @@ -0,0 +1,443 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 8 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 8
+
+ + + + + +
+
+ +
+ +

+ + +I've had Plug 'hrsh7th/cmp-path' in my plugins for ever but didn't notice +until recently that I wasn't getting any filepath completion in vim! +Fuller setup instructions below the TLDR +TL;DR +Turns out I need to not be a dope and configure nvim-cmp to ... + read more → +

+ +
+
+ +

+ + +I just started using FastAPI for a home project and needed to pass back a +dynamic number of values from a form rendered with jinja... +Dynamic Values +The jinja templating for rendering HTML based on something like a python iterable is nice and easy + + ... + read more → +

+ +
+ +
+ +

+ + +If you use vim-plug for managing your vim plugins, do yourself a favor and snapshot your plugins before upgrading! +:PlugSnapshot creates a vim.snapshot file that you can use to restore your plugin versions with vim -S snapshot.vim +The snapshot file ... + read more → +

+ +
+ +
+ +

+ + +TODO + +import os + +import boto3 +import pytest +from moto import mock_s3 + +MY_BUCKET = "bucket" +# BAD PREFIX +MY_PREFIX = "bucket/project/data/layer/dataset/" + + +@pytest.fixture(scope="function") +def aws_credentials(): + &qu ... + read more → +

+ +
+
+ +

+ + +I wrote up a little on exporting DataFrames to markdown and html here +But I've been playing with a web app for with lists and while I'm toying around I learned you can actually give your tables some style with some simple css classes! +To HTML +Remind ... + read more → +

+ +
+
+ +

+ + +Pandas +pandas.DataFrames are pretty sweet data structures in Python. +I do a lot of work with tabular data and one thing I have incorporated into some of that work is automatic data summary reports by throwing the first few, or several relevant, rows ... + read more → +

+ +
+
+ +

+ + +Amazon has crossed the line with me just one too many times now so we are looking to drop them like every other Big Tech provider.... +However, one key feature of Amazon that has been so useful for us is Lists... We can just maintain a list for each ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022-9.html b/archive-2022-9.html new file mode 100644 index 00000000..fbf1a8bc --- /dev/null +++ b/archive-2022-9.html @@ -0,0 +1,429 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' - 9 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022' - 9
+
+ + + + + +
+
+
+
+

Git-bisect

+ +
+

+ + +I try to commit a lot, and I also try to write useful tests appropriate for the scope of work I'm focusing on, but sometimes I drop the ball... +Whether by laziness, ignorance, or accepted tech debt I don't always code perfectly and recently I was do ... + read more → +

+ +
+
+ +

+ + +TL;DR +pandas.Series.str.contains accepts regular expressions and this is turned on by default! +Use case +We often need to filter pandas DataFrames based on several string values in a Series. + +Notice that sweet pyflyby import 😁! + +sandbox  main via 3 ... + read more → +

+ +
+ +
+
+

Htop

+ +
+

+ + +htop is a common command line tool for seeing interactive output of your system resource utilization, running processes, etc. +I've always been super confused about htop showing seemingly the same process several times though... +The Fix... +Just hit H ... + read more → +

+ +
+
+ +

+ + +Unpacking iterables in python with * is a pretty handy trick for writing code that is just a tiny bit more pythonic than not. +arr: Tuple[Union[int, str]] = (1, 2, 3, 'a', 'b', 'c') + + +print(arr) +>>> (1, 2, 3, 'a', 'b', 'c') + +# the * unpacks ... + read more → +

+ +
+
+
+

Pipx

+ +
+

+ + +pipx is a tool I've been using to solve a few problems of mine... + +pinning formatting tools like black, flake8, isort, etc. to the same version for all my projects +keeping virtual environments clean of things like cookiecutter +python utilities I wan ... + read more → +

+ +
+
+
+

Fx-json

+ +
+

+ + +fx is an interactaive JSON viewer for the terminal. +It's a simple tool built with Charmcli's Bubble Tea. +Installation +The installation with go was broken for me - both via the link and direct from the repo. +Now I'm not a gopher so I don't really kno ... + read more → +

+ +
+
+ +

+ + +I use Jellyfin at home for serving up most of our media - movies and shows etc. +My dream is to have a GPU capable of transcoding any and all of our media for smooth playback on any device... +Now, I thought I'd have that by now with my Nvidia Quadro ... + read more → +

+ +
+
+
+

Typeddict

+ +
+

+ + +Type hinting has helped me write code almost as much, if not more, than unit testing. +One thing I love is that with complete type hinting you get a lot more out of your LSP. +Typing dictionaries can be tricky and I recently learned about TypedDict to ... + read more → +

+ +
+
+
+

Terraform-01

+ +
+

+ + +I've started using Terraform to manage Snowflake infrastructure at work. +I'm still a noobie but I've got a workflow that I think makes sense... +Here's the directory setup for a simple project with some databases, schemas, and tables to manage. +terra ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022.html b/archive-2022.html new file mode 100644 index 00000000..b2463742 --- /dev/null +++ b/archive-2022.html @@ -0,0 +1,438 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2022' | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2022'
+
+ + + + + +
+
+
+
+

Modal labs

+ +
+

+ + +Playing around with Modal Labs +One of the first things I tried was a regular cron job... +@stub.function( + schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret") +) +def say_hi(): + now = time.ctime() + sec ... + read more → +

+ +
+ + +
+ +

+ + +I have a bash script called syncoid-job which boils down to a barebones - +#!/bin/bash + +syncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas + +I want to run this script hourly but a ... + read more → +

+ +
+ +
+ +

+ + +I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as +an example... I'll want to play with something but if I don't start Neovim as +root then I get in trouble making edits I can't save! So +suda.vim gives me +:SudaWrite which ... + read more → +

+ +
+ +
+ +

+ + +AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entry ... + read more → +

+ +
+ +
+ +

+ + +I wanted to break down some long lines in a Markdown table cell to make it look +nicer on my blog but \n didn't do anything for me... turns out is the +magic sauce + + + +Column 1 +Column 2 + + + + +Key +Doggo ipsum many pats. Borkdrive borking doggo doing me a ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2022.json b/archive-2022.json new file mode 100644 index 00000000..01653c9d --- /dev/null +++ b/archive-2022.json @@ -0,0 +1,337 @@ +{ + "version": "https://jsonfeed.org/version/1", + "title": "Pype.dev", + "home_page_url": "https://pype.dev", + "feed_url": "https://pype.dev/archive-2022.json", + "description": "my mental data-lake", + "items": [ + { + "id": "https://pype.dev/modal-labs.html", + "url": "https://pype.dev/modal-labs.html", + "title": "Modal Labs", + "content_html": "\n

Playing around with Modal Labs

\n

One of the first things I tried was a regular cron job...

\n
@stub.function(\n    schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret")\n)\ndef say_hi():\n    now = time.ctime()\n    secret = os.environ.get("dummy-secret")\n    print(f"Hello {os.environ.get('USER', 'Rodney')} at {now}")\n    print(f"{secret=}")\n\n
\n

This can get deployed with modal deploy --name <app name> <path to .py file with the stub and function defined in it>

\n

This function gets deployed as an app that I conveniently call say_hi (as far\nas I can tell the app name can be anything - as I add functions to this same\napp and deploy with the same name to get a new version)

\n

Notice that this also is an example of giving access to a secret - defined in the Modal Labs dashboard

\n

We can take a look at the apps running at https://modal.com/apps

\n

I then added another function to experiment with custom container images and\nsaw then that Modal will just slap a new version on anything provisioned with\nthe same name (intuitive enough for sure) so when I add functions to my .py\nscript and run modal deploy --name say_hi myscript.py over and over, the app\ncalled say_hi in the Modal apps dashboard just gets a new version

\n

This means I can spin up several instances of functionally the same app but with different names/versions etc...\nQ: Maybe there's gitops or policy stuff builtin to app names then?

\n

I needed to take down an app I deployed as a duplicate but you don't stop apps\nby name, you stop them by an id... see below

\n
\nmodal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)\n✗ modal app stop --help\n\n Usage: modal app stop [OPTIONS] APP_ID\n\n Stop an app.\n\n╭─ Arguments ──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╮\n│ *    app_id      TEXT  [default: None] [required]                                                                                                │\n╰──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╯\n╭─ Options ────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╮\n│ --help          Show this message and exit.                                                                                                      │\n╰──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╯\n\n\nmodal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)\n❯ modal app list\n┏━━━━━━━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━━━━━━━┓\n┃ App ID                    ┃ Description         ┃ State    ┃ Creation time             ┃ Stop time                 ┃\n┡━━━━━━━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━━━━━━━┩\n│ ap-lzy1AAuVy7POFkUcDKRxpQ │ print_info          │ deployed │ 2022-12-28 20:59:07-06:00 │                           │\n│ ap-qYjE45dciqgT3C3CpNp3RL │ say_hi              │ deployed │ 2022-12-28 19:49:22-06:00 │                           │\n│ ap-X7FYneUeYV5IKHcyirSb87 │ link-scraper        │ stopped  │ 2022-12-28 15:39:02-06:00 │ 2022-12-28 15:39:04-06:00 │\n│ ap-UOXTUU4uSRx2UZypJOcAsk │ example-get-started │ stopped  │ 2022-12-28 15:17:47-06:00 │ 2022-12-28 15:17:49-06:00 │\n└───────────────────────────┴─────────────────────┴──────────┴───────────────────────────┴───────────────────────────┘\n\nmodal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)\n❯ modal app stop ap-lzy1AAuVy7POFkUcDKRxpQ\n\n
\n

Git warning!

\n

I ran modal deploy ... after comitting some stuff I wanted to try BUT I had\nchanges in my file I didn't want to deploy... some git safety would be nice for\ndeployment!

\n
\n

git stash && modal deploy .. && git stash pop

\n
\n

Question for Modal team - in my modal sandbox repo at commit:

\n
aab6162 (HEAD -> main) HEAD@{1}: commit: print base version of my own image to prove it to me\n 1 file changed, 2 insertions(+)\n\n
\n

An environment variable, BASE_VERSION that I expect to be in my base image\nwas not available to the python function in my Modal app... hopefully the log\nis still\nhere

\n\n", + "summary": "", + "date_published": "2022-12-28T21:01:52-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "python", + "cli", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reminder-about-ssh-copy-id-for-ssh-and-ansible.html", + "url": "https://pype.dev/reminder-about-ssh-copy-id-for-ssh-and-ansible.html", + "title": "Reminder about ssh-copy-id for SSH and Ansible", + "content_html": "\n

ssh-copy-id -i my.key.pub <hostname probably from tailscale>\nthis makes sure I can run ansible from my desktop against VMs on my server\neasily if they have tailscale for the hostname - otherwise use the IP

\n\n", + "summary": "", + "date_published": "2022-12-28T13:33:07-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/nextcloud-docker-upgrade-error.html", + "url": "https://pype.dev/nextcloud-docker-upgrade-error.html", + "title": "Nextcloud Docker Upgrade Error", + "content_html": "\n

https://nicolasbouliane.com/blog/nextcloud-docker-upgrade-error

\n\n", + "summary": "", + "date_published": "2022-12-28T09:39:27-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/systemd-timer-for-syncoid.html", + "url": "https://pype.dev/systemd-timer-for-syncoid.html", + "title": "Systemd timer for syncoid", + "content_html": "\n

I have a bash script called syncoid-job which boils down to a barebones -

\n
#!/bin/bash\n\nsyncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas\n
\n

I want to run this script hourly but as my user (notice the no-privilege-elevation flag)

\n

First - create a systemd unit file at /etc/systemd/system/syncoid-replication.service

\n
[Unit]\nDescription=ZFS Replication With Syncoid\n\n[Service]\nType=oneshot\nExecStart=/$HOME/dotfiles/syncoid-job\nUser=$USER\nGroup=$GROUP\n\n[Install]\nWantedBy=multi-user.target\n\n
\n

Then we save the unit file, enable the service, and then start it

\n
systemctl enable syncoid-replication.service\nsystemctl start syncoid-replication.service\n\n
\n
\n

Note this will run that script... so be ready for syncoid to do its thing

\n
\n

Now for the timer... We create /etc/systemd/system/syncoid-replication.timer

\n
[Unit]\nDescription=Run syncoid-replication every hour\n\n[Timer]\nOnCalendar=hourly\n\n[Install]\nWantedBy=timers.target\n\n
\n

Hit it with a systemctl enable syncoid-replication.timer and you're in business!

\n\n", + "summary": "", + "date_published": "2022-12-21T11:38:27-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "zfs", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/adding-docker-daemon-json-broke-docker.html", + "url": "https://pype.dev/adding-docker-daemon-json-broke-docker.html", + "title": "Adding docker daemon.json broke docker", + "content_html": "\n

in /lib/systemd/system/docker.service there is an ExecStart command that got placed there when I setup Docker with Ansible - it threw the -H flag which told the daemon what hosts to setup. But I added the "hosts" key in my daemon.json and it broke - so removing the -H flag from the systemd unit fixed it

\n\n", + "summary": "", + "date_published": "2022-12-21T10:02:25-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/suda-vim-for-sudo-access-to-files.html", + "url": "https://pype.dev/suda-vim-for-sudo-access-to-files.html", + "title": "suda.vim for sudo access to files", + "content_html": "\n

I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as\nan example... I'll want to play with something but if I don't start Neovim as\nroot then I get in trouble making edits I can't save! So\nsuda.vim gives me\n:SudaWrite which let's me write that buffer with sudo privileges even though\nI'm Neovim is running with my login user!

\n\n", + "summary": "", + "date_published": "2022-12-21T09:45:34-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "vim", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/pipe-to-a-pager-to-preserve-console-output-in-ssh-session.html", + "url": "https://pype.dev/pipe-to-a-pager-to-preserve-console-output-in-ssh-session.html", + "title": "Pipe to a pager to preserve console output in SSH session", + "content_html": "\n

I'm playing with my ansible playbook in a remote tmux session, and I'm no wiz\nso I don't know the ins and outs, but I can't scroll up to get any console log\noutput that's not already visible on my screen. So I'm starting to end my\ncommands with | less so I can page through the console output!

\n

ansible-playbook plays.yml -v --tags mytag | less

\n\n", + "summary": "", + "date_published": "2022-12-18T15:04:02-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "cli", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/cron-for-nextcloud-in-docker.html", + "url": "https://pype.dev/cron-for-nextcloud-in-docker.html", + "title": "Cron for Nextcloud in Docker", + "content_html": "\n

AJAX wasn't cutting it, traditional crontab in containers doesn't make much\nsense to me, webcron is recommended but I don't want to register with anything\noutside my LAN... Turns out you can just spin up an identical container with a\ndifferent entrypoint to /cron.sh that does what you need!

\n
\n

Note that this is a task in an Ansible playbook - but the docker-compose is straight forward

\n
\n

So the only thing you need to make sure of is that all the configuration\noptions - data volumes, user permissions, etc. are identical between the\ncontainers running the cron job and the one actually hosting NextCloud. This\nensures that the container running cron has proper access to the database and\nfilesystem - or at least the same access as NextCloud proper.

\n
- name: Nextcloud Cron Docker Container\n  docker_container:\n    name: nextcloud-cron\n    image: "{{ nextcloud_image }}"\n    pull: true\n    links:\n      - nextcloud-mysql:mysql\n    entrypoint: /cron.sh\n    volumes:\n      - "{{ nextcloud_data_directory }}/nextcloud:/var/www/html:rw"\n    env:\n      MYSQL_HOST: "mysql"\n      MYSQL_DATABASE: "nextcloud"\n      MYSQL_USER: "{{ nextcloud_sql_user }}"\n      MYSQL_PASSWORD: "{{ nextcloud_sql_password }}"\n      NEXTCLOUD_TRUSTED_DOMAINS: "{{ nextcloud_hostname }}.{{ ansible_nas_domain }}"\n      PUID: "{{ nextcloud_user_id }}"\n      PGID: "{{ nextcloud_group_id }}"\n      TZ: "{{ ansible_nas_timezone }}"\n    restart_policy: unless-stopped\n    memory: "{{ nextcloud_memory }}"\n\n
\n\n", + "summary": "", + "date_published": "2022-12-13T06:43:45-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/call-basicconfig-to-get-python-log-messages-in-ipython.html", + "url": "https://pype.dev/call-basicconfig-to-get-python-log-messages-in-ipython.html", + "title": "Call basicConfig to get Python log messages in iPython", + "content_html": "\n

Logging instead of printing

\n

I am trying to adopt logger.debug instead of print but ran into a confusing\nthing in ipython during Advent of Code... I riddled by script with\nlogger.debug (yes after setting logging.setLevel('DEBUG')) but in ipython\nnone of my log messages showed up!

\n
import logging\n\nlogger = logging.getLogger(__name__)\nlogger.setLevel("DEBUG")\n\n
\n

Turns out what I was missing was a call to basicConfig

\n
import logging\n\n# forget this and your messages are in the ether! or at least not seen in ipython...\nlogging.basicConfig()\n\nlogger = logging.getLogger(__name__)\nlogger.setLevel("DEBUG")\n
\n

Bonus

\n

Want your new messages to show up while iterating on something without killing\nthe ipython kernel?

\n
from importlib import reload\nreload(logging) # to make sure you get new log messages you add while developing!\n\n
\n\n", + "summary": "", + "date_published": "2022-12-10T14:04:23-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "python", + "cli", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/new-lines-in-markdown-tables.html", + "url": "https://pype.dev/new-lines-in-markdown-tables.html", + "title": "New lines in Markdown tables", + "content_html": "\n

I wanted to break down some long lines in a Markdown table cell to make it look\nnicer on my blog but \\n didn't do anything for me... turns out
is the\nmagic sauce

\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
Column 1Column 2
KeyDoggo ipsum many pats. Borkdrive borking doggo doing me a frighten doggorino, noodle horse heckin. what a nice floof. Pupper borking doggo you are doing me a frighten, much ruin diet.
------
\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
Column 1Column 2
KeyDoggo ipsum many pats.
Borkdrive borking doggo doing me a frighten doggorino, noodle horse heckin.
what a nice floof.
Pupper borking doggo you are doing me a frighten, much ruin diet.
------
\n\n", + "summary": "", + "date_published": "2022-11-25T13:35:05-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "vim", + "webdev", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/description-of-my-proposed-vimconf-2022-talk.html", + "url": "https://pype.dev/description-of-my-proposed-vimconf-2022-talk.html", + "title": "Description of my proposed vimconf 2022 talk", + "content_html": "\n

Switching to Vim opened a whole new world to me for interacting with a computer\nand for getting things done. Before I adopted Vim I used GUIs for everything\nbecause I thought that's how it had to be done... Notes in OneNote, code using\na GUI editor, different notes in TiddlyWiki, slides for work in PowerPoint,\nslides for church using Logos, etc... Adopting Vim allowed me to disconnect a\nspecific tool from the problem that tool is solving - because usually I just\nneed to write text (notes, code, slides, etc.). Now, very nearly everything I\ndo is from a text-based and git-based workflow... I put all my notes on\nbasically anything just in my blog, which is all markdown and deployed to GH\nwith Markata on every push (living dangerously pushing to main) - and that's\nall done easily from Vim with nice syntax highlighting, fast response,\nintegrated git-plugins, etc.. I keep project-specific task lists just in\nmarkdown files and I have Vim/tmux shortcuts to quickly add todos for any\nproject (todo list is done with markata todoui) and I can get there fast\nbecause my Vim workflow dovetails with Tmux nicely. Also I can pull that list\nup right from the terminal, which I'm already in because Vim.... Vim also\npushed me into the cli more - because Vim is so easily extended with cli tools\nand I'm already in the terminal... The builtin functionality also made things\nmake more sense - no more right-click, find "refactor all" or "rename symbol"\n(for some stupid reason)... Vim find-replace is so intuitive and if I need it\nextended then I learned what sed was because of Vim. Moving quickly in Vim also\nenables me to do my job incredibly fast because I hop into several projects a\nday in a coaching role - if I was bound by GUIs I'd be waiting forever for\nstartup, would lose which GUI instance was which project, etc... Being in the\nterminal also made Tmux a trivial choice - now I have 90 tmux sessions, all\nnamed appropriately, ready for me to jump back to and all while keeping the\nmajority of RAM still free for Chrome. Vim as my IDE also forced me to learn\nway more about Python (I'm a python developer primarily), how LSP works, how to\nconfigure a development environment, etc... things I took for granted in my GUI\nworkflows, or never knew, or worse - thought I knew but deeply misunderstood.\nNow that I understand them better, I can coach my peers more effectively even\nif they are still in a GUI-based ecosystem.

\n

Basically, (Neo)Vim actually did change my life and I'm really thankful for it\n(maybe that should be the title?)

\n\n", + "summary": "", + "date_published": "2022-11-12T19:39:19-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "vim", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/make-a-series-of-directories-fast.html", + "url": "https://pype.dev/make-a-series-of-directories-fast.html", + "title": "Make a series of directories fast!", + "content_html": "\n

mkdir s{1..10} will make directories s1, s2, ... s10 in one command!

\n\n", + "summary": "", + "date_published": "2022-11-10T15:27:50-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "cli", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/hebrew-bible-full-class.html", + "url": "https://pype.dev/hebrew-bible-full-class.html", + "title": "Hebrew Bible Full Class", + "content_html": "\n

Class link\nClassroom notes (Must be on home network)

\n

01 The Shape of the Hebrew Bible

\n

Session 1: What on Earth is the Hebrew Bible?

\n

This class is not so much a survey of the HB, it is Tim's attempt to distil the\nmost helpful things for understanding it in a consumable way for laypeople.

\n

A chunk of this is the other people giving some of their own background. One\nlady said something that might be helpful for ministry - "Maybe that thing that\nI saw as 'you don't love me' is 'I don't know how to love you'"

\n

!!! note "how to love"

\n
Maybe that thing that I saw as 'you don't love me' is 'I don't know how to love you'\n
\n

!!! danger "Christian coping strategy for the Olt Testament"

\n
1. Hero-example model\n    * Stories get isolated and distilled down into a simple moral model, where the hero is just the hero.\n    * Veggie-Tales is uber-guilty of this nonsense\n    * There's something correct about this - but the oversimplification usually comes out of a massive re-writting of the stories, then anyone raised on those versions of the story is scaldalized when they read it for real\n\n2. Poltical-authority source\n    * Political parties hijacking "The Bible says X about Y" as a means to harvest authority from a book that many people claim is authoritative.\n\n3. Theology answer book model\n    * Treating the Bible like a dictionary of key/value pairs where keys are questions and values are simple answers.\n    * This ignores narrative, and general literacy.\n    * The instinct may be right - the Bible should profoundly shape my view of everything, but it isn't simple\n\n4. Inspirational-heart-warming model\n    * Verse-a-day calendars\n    * Jermiah 29:11\n
\n

!!! warning ""

\n
Are we imposing a set of questions that are foreign to what the authors are\ntrying to communicate? do we need to set our cultural agendas aside to just\nlisten?\n
\n

A result of asking the wrong questions is the common story of people's faith being dismantled by reading the Bible

\n

!!! note "DL Baker - Two Testaments - One Bible"

\n
One of the most fundamental questions which has faced theology and the\nChurch in every age... is whether or not Christianity also needs an Old\nTestament. Is the Old Testament to be thrown away as obsolete, or pre-\nserved as a relic from days of yore, or treasured as a classic and read by\nscholars, or used occasionally as a change from the New Testament, or\nkept in a box in case it should be needed some day? Or is the Old Testa-\nment an essential part of the Christian Bible, with continuing validity along-\nside the New Testament? —\n
\n

Session 2: How Jesus and the Apostle ReadTheir Bibles

\n

The Bible most often refers to itself as the Writings

\n

!!! note "Road to Emmaus"

\n
Jesus confronts a couple guys walking to Emmaus after he is resurrected and\nmore or less calls them idiots/fools for not understanding that the\nWritings point to an annointed king who will suffer death for the sake of\nredemption. He's recognized by them once their eyes are opened then he vanishes\n
\n

Weird stuff

\n

Paul and Timothy

\n

Paul assumes when writing to Timothy that he, and probably believers in general, are in a community of people who are regularly learning about Yahweh through the Scriptures as a family

\n

!!! scripture "2 Timothy 3:15-16"

\n
... and that from childhood you ahve known the sacred writings which are\nable to give you the wisdom that leas to salvation through faith which is\nin Christ Jesus. All Scripture is inspired by God and profitable for\nteaching, for reproof, for correction, for training in righteousness\n
\n

!!! success ""

\n
For Paul, the `Scriptures` here are our OT, the Hebrew Bible. For Paul, the HB\nis entirely _wisdom literature_ that leads to salvation through Jesus\n
\n

The question of "What are the Scriptures?" is covered in the next session

\n

To answer the question 'How do we read the HB?' we have to ask the question\n'Whose book is the HB?'

\n

Session 3: Shape of the Scriptures

\n

Old Testament is the Christian term for a set of writings that comprise about\n3/4 of the Christian Bible. The authors themselves though refer to those\nwritings as the Scriptures. One time it is called the Old Covenant by Paul\n, but he's talking about Synagogue readings of the Torah portion in synagogues.\nTHe phrase Hebrew Bible is a modern term that is a bit more neutral.

\n
\n

So, what is our Bible?

\n
\n

!!! scripture "Luke 24:25-27"

\n
25 And he said to them, “O foolish ones, and slow of\nheart to believe all that the prophets have spoken! 26 Was it not necessary\nthat the Christ should suffer these things and enter into his glory?”\n27 And beginning with Moses and all the Prophets, he interpreted to them in\nall the Scriptures the things concerning himself.\n
\n
\n

Moses and the Prophets

\n
\n

TaNaK

\n

Jweish reference to the books in our OT, in the Hebrew Bible, but the arangement is different...

\n

!!! note "TaNaK"

\n
1. T = Torah (first 5 books)\n2. N - Nevi'im (Prophets: Joshua - Kings) [Christians often call these the 'historial books']\n3. K - Ketuvim\n\n| **Torah** | **Pentateuch** |\n| --- | --- |\n| Genesis - Exodus - Leviticus - Numbers Deuteronomy | Genesis - Exodus - Leviticus - Numbers - Deuteronomy |\n| **Nevi'im - The Prophets** | **History** |\n| *Former Prophets* <br/> Joshua - Judges - Samueal - Kings | Joshua - Judges - Ruth <br/> 1-2 Samuel - 1-2 Kings <br/> 1-2 Chronicles <br/> Ezra - Nehemiah - Ester |\n| *Later Prophets* <br/> Isaiah - Jeremiah - Ezekiel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi | **Poetry** <br/> Job - Psalms - Proverbs - Ecclesiastes - Song of Solomon |\n| **Kethuvim - The Writings** | **Prophets** |\n| Psalms - Job - Proverbs <br/> Ruth - Song of Songs - Ecclesiastes - Lamentations - Esther [The Megillot] <br/> Daniel - Ezra - Nehemiah - Chronicles | Isiah - Jeremiah - Lamentations <br/> Ezekiel - Daniel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi |\n
\n

!!! scripture "Luke 11:49–51 (ESV) "

\n
49 Therefore also the Wisdom of God said, ‘I will send them prophets and\napostles, some of whom they will kill and persecute,’ 50 so that the blood\nof all the prophets, shed from the foundation of the world, may be charged\nagainst this generation, 51 from the blood of Abel to the blood of\nZechariah, who perished between the altar and the sanctuary. Yes, I tell\nyou, it will be required of this generation.\n
\n
\n

Blood of Abel to the blood of Zechariah...

\n
\n

Why would Jesus pick these two events? Abel is murdered on page 4, Zechariah is\nmurdered in the last part of Chronicles, which in the TaNaK is significant...\nJesus is saying that all the prophets from the beginning of the Scriptures to\nthe end... All the prophets from A-Z so to speak

\n

!!! note "Scriptures"

\n
"Books" as we know it, bound papers with writing on it, called a 'codex'\nwasn't a thing until a couple hundred years post-Jesus... so when the\nauthors say "The Scriptures" we need to keep in mind that Jews had the\nscriptures in their minds and hearts, not on paper (save for a couple very\nexpensive scrolls). So the structure of the scriptures is also apart of the\nJewish being... This interaction with the Scriptures is _very very very\ndifferent than how we interact with the Bible_\n
\n

!!! note "4QMMT"

\n
"The scrolls of Moses, the words of the prophets, and of David."\n
\n

!!! note "Philo of Alexandria"

\n
The laws and the oracles given by inspiration through the prophets and the\nPsalms, and the other scrolls whereby knowledge and piety are increased and\ncompleted...\n\n- De Vita Contemplatetiva, 25\n
\n

Melito of Sardis

\n\n

Session 4 - Seams between Texts in the Dead Sea Scrolls

\n

Around 100-200 AD there was a split in the Jewish community over things like\nhow the Temple and sacrifices were to be run, etc. A group got kicked out, so\nthey grabbed some scrolls and went to start what we'd think of as a Monastic\ncommunity. Qumran community is where they went, and the scrolls this group\nmanaged are called the Dead Sea Scrolls.

\n

Out of DSS we have some of the oldest biblical scrolls, they have their own\nwritings and liturgies since they were all priests basically too.

\n

The scrolls were hidden in caves before the Romans marched on Qumran. They were\nfound in the 1940s by a bunch of shepherds. A few showed up online for sale and\nthat's how we found out about their exitence.... These scrolls give us\npre-Christian Jewish Bible nerds...

\n

Qumran community didn't know about Jesus - they thought the Messiah would be a\nman called The Teacher of Righteousness

\n

Scroll-making

\n

The DSS preserved for us, not only ancient biblical texts, but also the method\nby which scrolls were created. They were well-preserved papyrus that was\nstiched together - literal stitches. We also have obvious additions from Qumran\ncommunity as well as notes from priests and corrections from missed\ntranscribing.

\n

Our Bible

\n

The DSS scrolls, being the oldest stitched together set of scrolls, teach us\nhow scrolls and collections of ancient holy texts were put together. We need to\nkeep this in mind when we think about where our Christian Bible came from

\n

The beginning and ending of our books might/are filled with hyperlinks that\ncall a reader's mind back to other stories. It's the way of linking context and\nstories to one another before the writings are in a codex

\n
\n

Hyperlinks - language/syntax that remind a reader of antoher scroll - help us\nunderstand the structure of the Hebrew Bible

\n
\n

!!! note "A favorite quote from Tim"

\n
So, you can see I'm interested in a historical question of like the\ncollection [Hebrew Bible] was produced by a group of people. What did they\nmean by it? And we can actually know a lot about what they meant and locate\nthem and read it the way they wanted us to read it, and pick up what\nthey're saying. And, lo and behold, you know, I hope to convince you\nthat—and this is all pre-Christian—what's happening here and what this all\npoints to and means, fits hand in glove with how Jesus and Paul and the\napostles talk about these texts.\nSo that's different from saying nobody\nknew what these texts meant. The events of Jesus happen, and then we go\nreread it, and it has a whole new meaning that no one has ever imagined. It\nseems to me what actually happened in history was a little more interesting\nand complicated than that.  [17:30-18:21]\n
\n\n", + "summary": "", + "date_published": "2022-11-05T06:27:40-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/case-insensitive-search-in-vim.html", + "url": "https://pype.dev/case-insensitive-search-in-vim.html", + "title": "Case-insensitive search in Vim", + "content_html": "\n

/mysearch\\c will match mysearch, MYSEARCH, mYSeArCh...

\n\n", + "summary": "", + "date_published": "2022-10-21T06:40:21-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "vim", + "vim", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/faithful.html", + "url": "https://pype.dev/faithful.html", + "title": "Faithful", + "content_html": "\n

Link

\n

Notes

\n

!!! Exodusds 34:6

\n
Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness\n
\n

Faithfulness - Emet (can be translated 'Truth')\nRelated to "Amen" which is untranslated Hebrew expression meaning "that's truth"

\n

Stability

\n

Moses has to hold his hands up when Israel faces the Amalekites. Joshua (and another) bring Moses a rock to sit on and hold is hands up so they could be Emet.

\n

People

\n

Describs trustiworthiness

\n

Exodus 18:21 - Moses apoints leaders are to be "Emet"

\n

God and promises

\n

God is a rock - he is faithful, just, and upright

\n

Hebrew word for trust is He'Emin which is the verb form of Emet

\n

Abraham considers God Emet, he He'Emin's God and God blesses this by creating Isreal.

\n

Israel, In Exodus 14:31, He'Emin's God (until they see the gians in Canaan that is)

\n

1 Kings 1:6 says David walked in Emet with God

\n

2 Samuel 7:16, God blesses David and says his kingdom will have Emet

\n

Romans 15:8-9 says Jesus came on behalf of God's faithfulness.

\n

Questions

\n

!!! note "1"

\n
The Hebrew word “emet” is translated with words like “faithful,”\n“reliable,” “sure,” “trustworthy,” and “amen.” Read aloud Psalm 36:5-6 ,\nPsalm 19:7 , and Psalm 41:13 and discuss what the psalmists are\ncommunicating in these passages when they use the word “emet.”\n
\n

!!! scripture "Psalms 36:5-6"

\n
5Your lovingkindness, O Lord, extends to the heavens,\n\nYour faithfulness reaches to the skies.\n\n6Your righteousness is like the mountains of God;\n\nYour judgments are like a great deep.\n\nO Lord, You preserve man and beast.\n
\n

!!! scripture "Psalms 19:7"

\n
7The law of the Lord is perfect, restoring the soul;\n\nThe testimony of the Lord is sure, making wise the simple.\n
\n

!!! scripture "Psalms 41:13"

\n
13Blessed be the Lord, the God of Israel,\n\nFrom everlasting to everlasting.\n\nAmen and Amen.\n
\n

I think the lesson here is pretty simple - God is faithful, full stop. His\nfaithfulness doesn't look necessarily like how we might want... when I was a\nkid I would be upset if my parents didn't respond to me in the way I wanted,\nand my kids will certainly share that disappointment. But I am faithful to my\nchildren - sometimes the main issue is a child's outlook on a situation or\nworldview. I think that metaphor holds true in relation to humans and Yahweh -\nhe sees the whole world, we see a part of it so we cannot understand\nfaithfulness fully, in the same way that my children can't understand my\nfaithfulness to them fully - even to the point of being upset or thinking that\nI'm not being faithful

\n

!!! note "2"

\n
God promised the Israelites that he would give them a king of peace that\nwould rule forever and ever (e.g. 2 Samuel 7:16). However, Israel’s kingdom\ncollapsed and they found themselves without a home or a king. Compare the\nbeginning of Psalm 89 (vv. 1-10) with the way it closes (vv. 46-52). What\ndo you think it practically looks like to trust God when all seems lost?\n
\n

!!! scripture "2 Samuel 7:16"

\n
16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”\n
\n

!!! scripture "PSALM 89"

\n
The Lord’s Covenant with David, and Israel’s Afflictions.\n\nA Maskil of Ethan the Ezrahite.\n\n1I will sing of the lovingkindness of the Lord forever;\n\nTo all generations I will make known Your faithfulness with my mouth.\n\n2For I have said, “Lovingkindness will be built up forever;\n\nIn the heavens You will establish Your faithfulness.”\n\n3“I have made a covenant with My chosen;\n\nI have sworn to David My servant,\n\n4I will establish your seed forever\n\nAnd build up your throne to all generations.” Selah.\n\n5The heavens will praise Your wonders, O Lord;\n\nYour faithfulness also in the assembly of the holy ones.\n\n6For who in the skies is comparable to the Lord?\n\nWho among the sons of the mighty is like the Lord,\n\n7A God greatly feared in the council of the holy ones,\n\nAnd awesome above all those who are around Him?\n\n8O Lord God of hosts, who is like You, O mighty Lord?\n\nYour faithfulness also surrounds You.\n\n9You rule the swelling of the sea;\n
\n

!!! note "3"

\n
Ultimately, God answers the psalmist’s cries in the person of Jesus. Compare 2 Samuel 7:16\n2 Samuel 7:16\n\n16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”\n\nto Hebrews 1:8-9\nHebrews 1:8-9\n\n8But of the Son He says,\n\n“Your throne, O God, is forever and ever,\n\nAnd the righteous scepter is the scepter of His kingdom.\n\n9You have loved righteousness and hated lawlessness;\n\nTherefore God, Your God, has anointed You\n\nWith the oil of gladness above Your companions.”\n\n. How does King Jesus embody and fulfill the ancient promises of God (e.g. John 1:14\nJohn 1:14\n\nThe Word Made Flesh\n\n14And the Word became flesh, and dwelt among us, and we saw His glory, glory as of the only begotten from the Father, full of grace and truth.\n\n, Hebrews 3:5-6\nHebrews 3:5-6\n\n5Now Moses was faithful in all His house as a servant, for a testimony of those things which were to be spoken later; 6but Christ was faithful as a Son over His house—whose house we are, if we hold fast our confidence and the boast of our hope firm until the end.\n\n, and Romans 15:8-9\nRomans 15:8-9\n\n8For I say that Christ has become a servant to the circumcision on behalf of the truth of God to confirm the promises given to the fathers, 9and for the Gentiles to glorify God for His mercy; as it is written,\n\n“Therefore I will give praise to You among the Gentiles,\n\nAnd I will sing to Your name.”\n\n)?\n
\n

!!! note "4"

\n
Read Hebrews 10:22-25\nHebrews 10:22-25\n\n22let us draw near with a sincere heart in full assurance of faith, having our hearts sprinkled clean from an evil conscience and our bodies washed with pure water. 23Let us hold fast the confession of our hope without wavering, for He who promised is faithful; 24and let us consider how to stimulate one another to love and good deeds, 25not forsaking our own assembling together, as is the habit of some, but encouraging one another; and all the more as you see the day drawing near.\n\n, Hebrews 11\nHebrews 11\n\nThe Triumphs of Faith\n\n1Now faith is the assurance of things hoped for, the conviction of things not seen. 2For by it the men of old gained approval.\n\n3By faith we understand that the worlds were prepared by the word of God, so that what is seen was not made out of things which are visible. 4By faith Abel offered to God a better sacrifice than Cain, through which he obtained the testimony that he was righteous, God testifying about his gifts, and through faith, though he is dead, he still speaks. 5By faith Enoch was taken up so that he would not see death; and he was not found because God took him up; for he obtained the witness that before his being taken up he was pleasing to God. 6And without faith it is impossible to please Him, for he who comes to God must believe that He is and that He is a rewarder of those who seek Him. 7By faith Noah, being warned by God about things not yet seen, in reverence prepared an ark for the salvation of his household, by which he condemned the world, and became an heir of the righteousness which is according to faith.\n\n8By faith Abraham, when he was called, obeyed by going out to a place which he was to receive for an inheritance; and he went out, not knowing where he was going. 9By faith he lived as an alien in the land of promise, as in a foreign land, dwelling in tents with Isaac and Jacob, fellow heirs of the same promise; 10for he was looking for the city which has foundations, whose architect and builder is God. 11By faith even Sarah herself received ability to conceive, even beyond the proper time of life, since she considered Him faithful who had promised. 12Therefore there was born even of one man, and him as good as dead at that, as many descendants as the stars of heaven in number, and innumerable as the sand which is by the seashore.\n\n13All these died in faith, without receiving the promises, but having seen them and having welcomed them from a distance, and having confessed that they were strangers and exiles on the earth. 14For those who say such things make it clear that they are seeking a country of their own. 15And indeed if they had been thinking of that country from which they went out, they would have had opportunity to return. 16But as it is, they desire a better country, that is, a heavenly one. Therefore God is not ashamed to be called their God; for He has prepared a city for them.\n\n17By faith Abraham, when he was tested, offered up Isaac, and he who had received the promises was offering up his only begotten son; 18it was he to whom it was said, “In Isaac your descendants shall be called.” 19He considered that God is able to raise people even from the dead, from which he also received him back as a type. 20By faith Isaac blessed Jacob and Esau, even regarding things to come. 21By faith Jacob, as he was dying, blessed each of the sons of Joseph, and worshiped, leaning on the top of his staff. 22By faith Joseph, when he was dying, made mention of the exodus of the sons of Israel, and gave orders concerning his bones.\n\n23By faith Moses, when he was born, was hidden for three months by his parents, because they saw he was a beautiful child; and they were not afraid of the king’s edict. 24By faith Moses, when he had grown up, refused to be called the son of Pharaoh’s daughter, 25choosing rather to endure ill-treatment with the people of God than to enjoy the passing pleasures of sin, 26considering the reproach of Christ greater riches than the treasures of Egypt; for he was looking to the reward. 27By faith he left Egypt, not fearing the wrath of the king; for he endured, as seeing Him who is unseen. 28By faith he kept the Passover and the sprinkling of the blood, so that he who destroyed the firstborn would not touch them. 29By faith they passed through the Red Sea as though they were passing through dry land; and the Egyptians, when they attempted it, were drowned.\n\n30By faith the walls of Jericho fell down after they had been encircled for seven days. 31By faith Rahab the harlot did not perish along with those who were disobedient, after she had welcomed the spies in peace.\n\n32And what more shall I say? For time will fail me if I tell of Gideon, Barak, Samson, Jephthah, of David and Samuel and the prophets, 33who by faith conquered kingdoms, performed acts of righteousness, obtained promises, shut the mouths of lions, 34quenched the power of fire, escaped the edge of the sword, from weakness were made strong, became mighty in war, put foreign armies to flight. 35Women received back their dead by resurrection; and others were tortured, not accepting their release, so that they might obtain a better resurrection; 36and others experienced mockings and scourgings, yes, also chains and imprisonment. 37They were stoned, they were sawn in two, they were tempted, they were put to death with the sword; they went about in sheepskins, in goatskins, being destitute, afflicted, ill-treated 38(men of whom the world was not worthy), wandering in deserts and mountains and caves and holes in the ground.\n\n39And all these, having gained approval through their faith, did not receive what was promised, 40because God had provided something better for us, so that apart from us they would not be made perfect.\n\n, and Hebrews 12:1-3\nHebrews 12:1-3\n\nJesus, the Example\n\n1Therefore, since we have so great a cloud of witnesses surrounding us, let us also lay aside every encumbrance and the sin which so easily entangles us, and let us run with endurance the race that is set before us, 2fixing our eyes on Jesus, the author and perfecter of faith, who for the joy set before Him endured the cross, despising the shame, and has sat down at the right hand of the throne of God.\n\n3For consider Him who has endured such hostility by sinners against Himself, so that you will not grow weary and lose heart.\n\n. After reading these passages, name one example of what it looks like to put our trust in God.\n
\n\n", + "summary": "", + "date_published": "2022-10-21T06:31:33-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + } + ] +} \ No newline at end of file diff --git a/archive-2022.rss b/archive-2022.rss new file mode 100644 index 00000000..a7b369a8 --- /dev/null +++ b/archive-2022.rss @@ -0,0 +1,689 @@ +Pype.devhttps://pype.devmy mental data-lakeWed, 28 Dec 2022 21:01:52 GMTFri, 06 Dec 2024 21:33:06 GMTmarmiteModal Labshttps://pype.dev/modal-labs.htmlnicpaynepythonclitechhttps://pype.dev/modal-labs.htmlWed, 28 Dec 2022 21:01:52 GMTarchive-2022 +

Playing around with Modal Labs

+

One of the first things I tried was a regular cron job...

+
@stub.function(
+    schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret")
+)
+def say_hi():
+    now = time.ctime()
+    secret = os.environ.get("dummy-secret")
+    print(f"Hello {os.environ.get('USER', 'Rodney')} at {now}")
+    print(f"{secret=}")
+
+
+

This can get deployed with modal deploy --name <app name> <path to .py file with the stub and function defined in it>

+

This function gets deployed as an app that I conveniently call say_hi (as far +as I can tell the app name can be anything - as I add functions to this same +app and deploy with the same name to get a new version)

+

Notice that this also is an example of giving access to a secret - defined in the Modal Labs dashboard

+

We can take a look at the apps running at https://modal.com/apps

+

I then added another function to experiment with custom container images and +saw then that Modal will just slap a new version on anything provisioned with +the same name (intuitive enough for sure) so when I add functions to my .py +script and run modal deploy --name say_hi myscript.py over and over, the app +called say_hi in the Modal apps dashboard just gets a new version

+

This means I can spin up several instances of functionally the same app but with different names/versions etc... +Q: Maybe there's gitops or policy stuff builtin to app names then?

+

I needed to take down an app I deployed as a duplicate but you don't stop apps +by name, you stop them by an id... see below

+

+modal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)
+✗ modal app stop --help
+
+ Usage: modal app stop [OPTIONS] APP_ID
+
+ Stop an app.
+
+╭─ Arguments ──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╮
+│ *    app_id      TEXT  [default: None] [required]                                                                                                │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╯
+╭─ Options ────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╮
+│ --help          Show this message and exit.                                                                                                      │
+╰──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────╯
+
+
+modal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)
+❯ modal app list
+┏━━━━━━━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━━━━━━━┳━━━━━━━━━━━━━━━━━━━━━━━━━━━┓
+┃ App ID                    ┃ Description         ┃ State    ┃ Creation time             ┃ Stop time                 ┃
+┡━━━━━━━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━━━━━━━╇━━━━━━━━━━━━━━━━━━━━━━━━━━━┩
+│ ap-lzy1AAuVy7POFkUcDKRxpQ │ print_info          │ deployed │ 2022-12-28 20:59:07-06:00 │                           │
+│ ap-qYjE45dciqgT3C3CpNp3RL │ say_hi              │ deployed │ 2022-12-28 19:49:22-06:00 │                           │
+│ ap-X7FYneUeYV5IKHcyirSb87 │ link-scraper        │ stopped  │ 2022-12-28 15:39:02-06:00 │ 2022-12-28 15:39:04-06:00 │
+│ ap-UOXTUU4uSRx2UZypJOcAsk │ example-get-started │ stopped  │ 2022-12-28 15:17:47-06:00 │ 2022-12-28 15:17:49-06:00 │
+└───────────────────────────┴─────────────────────┴──────────┴───────────────────────────┴───────────────────────────┘
+
+modal-sandbox/modal_sandbox   main   ×1  ×9 via   v3.10.6(modal-sandbox)
+❯ modal app stop ap-lzy1AAuVy7POFkUcDKRxpQ
+
+
+

Git warning!

+

I ran modal deploy ... after comitting some stuff I wanted to try BUT I had +changes in my file I didn't want to deploy... some git safety would be nice for +deployment!

+
+

git stash && modal deploy .. && git stash pop

+
+

Question for Modal team - in my modal sandbox repo at commit:

+
aab6162 (HEAD -> main) HEAD@{1}: commit: print base version of my own image to prove it to me
+ 1 file changed, 2 insertions(+)
+
+
+

An environment variable, BASE_VERSION that I expect to be in my base image +was not available to the python function in my Modal app... hopefully the log +is still +here

+ +]]>
Reminder about ssh-copy-id for SSH and Ansiblehttps://pype.dev/reminder-about-ssh-copy-id-for-ssh-and-ansible.htmlnicpaynehomelablinuxtechhttps://pype.dev/reminder-about-ssh-copy-id-for-ssh-and-ansible.htmlWed, 28 Dec 2022 13:33:07 GMTarchive-2022 +

ssh-copy-id -i my.key.pub <hostname probably from tailscale> +this makes sure I can run ansible from my desktop against VMs on my server +easily if they have tailscale for the hostname - otherwise use the IP

+ +]]>
Nextcloud Docker Upgrade Errorhttps://pype.dev/nextcloud-docker-upgrade-error.htmlnicpaynehomelablinuxtechhttps://pype.dev/nextcloud-docker-upgrade-error.htmlWed, 28 Dec 2022 09:39:27 GMTarchive-2022 +

https://nicolasbouliane.com/blog/nextcloud-docker-upgrade-error

+ +]]>
Systemd timer for syncoidhttps://pype.dev/systemd-timer-for-syncoid.htmlnicpaynezfshomelabtechhttps://pype.dev/systemd-timer-for-syncoid.htmlWed, 21 Dec 2022 11:38:27 GMTarchive-2022 +

I have a bash script called syncoid-job which boils down to a barebones -

+
#!/bin/bash
+
+syncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas
+
+

I want to run this script hourly but as my user (notice the no-privilege-elevation flag)

+

First - create a systemd unit file at /etc/systemd/system/syncoid-replication.service

+
[Unit]
+Description=ZFS Replication With Syncoid
+
+[Service]
+Type=oneshot
+ExecStart=/$HOME/dotfiles/syncoid-job
+User=$USER
+Group=$GROUP
+
+[Install]
+WantedBy=multi-user.target
+
+
+

Then we save the unit file, enable the service, and then start it

+
systemctl enable syncoid-replication.service
+systemctl start syncoid-replication.service
+
+
+
+

Note this will run that script... so be ready for syncoid to do its thing

+
+

Now for the timer... We create /etc/systemd/system/syncoid-replication.timer

+
[Unit]
+Description=Run syncoid-replication every hour
+
+[Timer]
+OnCalendar=hourly
+
+[Install]
+WantedBy=timers.target
+
+
+

Hit it with a systemctl enable syncoid-replication.timer and you're in business!

+ +]]>
Adding docker daemon.json broke dockerhttps://pype.dev/adding-docker-daemon-json-broke-docker.htmlnicpaynelinuxlinuxtechhttps://pype.dev/adding-docker-daemon-json-broke-docker.htmlWed, 21 Dec 2022 10:02:25 GMTarchive-2022 +

in /lib/systemd/system/docker.service there is an ExecStart command that got placed there when I setup Docker with Ansible - it threw the -H flag which told the daemon what hosts to setup. But I added the "hosts" key in my daemon.json and it broke - so removing the -H flag from the systemd unit fixed it

+ +]]>
suda.vim for sudo access to fileshttps://pype.dev/suda-vim-for-sudo-access-to-files.htmlnicpaynevimlinuxtechhttps://pype.dev/suda-vim-for-sudo-access-to-files.htmlWed, 21 Dec 2022 09:45:34 GMTarchive-2022 +

I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as +an example... I'll want to play with something but if I don't start Neovim as +root then I get in trouble making edits I can't save! So +suda.vim gives me +:SudaWrite which let's me write that buffer with sudo privileges even though +I'm Neovim is running with my login user!

+ +]]>
Pipe to a pager to preserve console output in SSH sessionhttps://pype.dev/pipe-to-a-pager-to-preserve-console-output-in-ssh-session.htmlnicpaynelinuxclitechhttps://pype.dev/pipe-to-a-pager-to-preserve-console-output-in-ssh-session.htmlSun, 18 Dec 2022 15:04:02 GMTarchive-2022 +

I'm playing with my ansible playbook in a remote tmux session, and I'm no wiz +so I don't know the ins and outs, but I can't scroll up to get any console log +output that's not already visible on my screen. So I'm starting to end my +commands with | less so I can page through the console output!

+

ansible-playbook plays.yml -v --tags mytag | less

+ +]]>
Cron for Nextcloud in Dockerhttps://pype.dev/cron-for-nextcloud-in-docker.htmlnicpaynehomelabhomelabtechhttps://pype.dev/cron-for-nextcloud-in-docker.htmlTue, 13 Dec 2022 06:43:45 GMTarchive-2022 +

AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entrypoint to /cron.sh that does what you need!

+
+

Note that this is a task in an Ansible playbook - but the docker-compose is straight forward

+
+

So the only thing you need to make sure of is that all the configuration +options - data volumes, user permissions, etc. are identical between the +containers running the cron job and the one actually hosting NextCloud. This +ensures that the container running cron has proper access to the database and +filesystem - or at least the same access as NextCloud proper.

+
- name: Nextcloud Cron Docker Container
+  docker_container:
+    name: nextcloud-cron
+    image: "{{ nextcloud_image }}"
+    pull: true
+    links:
+      - nextcloud-mysql:mysql
+    entrypoint: /cron.sh
+    volumes:
+      - "{{ nextcloud_data_directory }}/nextcloud:/var/www/html:rw"
+    env:
+      MYSQL_HOST: "mysql"
+      MYSQL_DATABASE: "nextcloud"
+      MYSQL_USER: "{{ nextcloud_sql_user }}"
+      MYSQL_PASSWORD: "{{ nextcloud_sql_password }}"
+      NEXTCLOUD_TRUSTED_DOMAINS: "{{ nextcloud_hostname }}.{{ ansible_nas_domain }}"
+      PUID: "{{ nextcloud_user_id }}"
+      PGID: "{{ nextcloud_group_id }}"
+      TZ: "{{ ansible_nas_timezone }}"
+    restart_policy: unless-stopped
+    memory: "{{ nextcloud_memory }}"
+
+
+ +]]>
Call basicConfig to get Python log messages in iPythonhttps://pype.dev/call-basicconfig-to-get-python-log-messages-in-ipython.htmlnicpaynepythonclitechhttps://pype.dev/call-basicconfig-to-get-python-log-messages-in-ipython.htmlSat, 10 Dec 2022 14:04:23 GMTarchive-2022 +

Logging instead of printing

+

I am trying to adopt logger.debug instead of print but ran into a confusing +thing in ipython during Advent of Code... I riddled by script with +logger.debug (yes after setting logging.setLevel('DEBUG')) but in ipython +none of my log messages showed up!

+
import logging
+
+logger = logging.getLogger(__name__)
+logger.setLevel("DEBUG")
+
+
+

Turns out what I was missing was a call to basicConfig

+
import logging
+
+# forget this and your messages are in the ether! or at least not seen in ipython...
+logging.basicConfig()
+
+logger = logging.getLogger(__name__)
+logger.setLevel("DEBUG")
+
+

Bonus

+

Want your new messages to show up while iterating on something without killing +the ipython kernel?

+
from importlib import reload
+reload(logging) # to make sure you get new log messages you add while developing!
+
+
+ +]]>
New lines in Markdown tableshttps://pype.dev/new-lines-in-markdown-tables.htmlnicpaynevimwebdevtechhttps://pype.dev/new-lines-in-markdown-tables.htmlFri, 25 Nov 2022 13:35:05 GMTarchive-2022 +

I wanted to break down some long lines in a Markdown table cell to make it look +nicer on my blog but \n didn't do anything for me... turns out
is the +magic sauce

+ + + + + + + + + + + + + + + + + +
Column 1Column 2
KeyDoggo ipsum many pats. Borkdrive borking doggo doing me a frighten doggorino, noodle horse heckin. what a nice floof. Pupper borking doggo you are doing me a frighten, much ruin diet.
------
+ + + + + + + + + + + + + + + + + +
Column 1Column 2
KeyDoggo ipsum many pats.
Borkdrive borking doggo doing me a frighten doggorino, noodle horse heckin.
what a nice floof.
Pupper borking doggo you are doing me a frighten, much ruin diet.
------
+ +]]>
Description of my proposed vimconf 2022 talkhttps://pype.dev/description-of-my-proposed-vimconf-2022-talk.htmlnicpaynelinuxvimtechhttps://pype.dev/description-of-my-proposed-vimconf-2022-talk.htmlSat, 12 Nov 2022 19:39:19 GMTarchive-2022 +

Switching to Vim opened a whole new world to me for interacting with a computer +and for getting things done. Before I adopted Vim I used GUIs for everything +because I thought that's how it had to be done... Notes in OneNote, code using +a GUI editor, different notes in TiddlyWiki, slides for work in PowerPoint, +slides for church using Logos, etc... Adopting Vim allowed me to disconnect a +specific tool from the problem that tool is solving - because usually I just +need to write text (notes, code, slides, etc.). Now, very nearly everything I +do is from a text-based and git-based workflow... I put all my notes on +basically anything just in my blog, which is all markdown and deployed to GH +with Markata on every push (living dangerously pushing to main) - and that's +all done easily from Vim with nice syntax highlighting, fast response, +integrated git-plugins, etc.. I keep project-specific task lists just in +markdown files and I have Vim/tmux shortcuts to quickly add todos for any +project (todo list is done with markata todoui) and I can get there fast +because my Vim workflow dovetails with Tmux nicely. Also I can pull that list +up right from the terminal, which I'm already in because Vim.... Vim also +pushed me into the cli more - because Vim is so easily extended with cli tools +and I'm already in the terminal... The builtin functionality also made things +make more sense - no more right-click, find "refactor all" or "rename symbol" +(for some stupid reason)... Vim find-replace is so intuitive and if I need it +extended then I learned what sed was because of Vim. Moving quickly in Vim also +enables me to do my job incredibly fast because I hop into several projects a +day in a coaching role - if I was bound by GUIs I'd be waiting forever for +startup, would lose which GUI instance was which project, etc... Being in the +terminal also made Tmux a trivial choice - now I have 90 tmux sessions, all +named appropriately, ready for me to jump back to and all while keeping the +majority of RAM still free for Chrome. Vim as my IDE also forced me to learn +way more about Python (I'm a python developer primarily), how LSP works, how to +configure a development environment, etc... things I took for granted in my GUI +workflows, or never knew, or worse - thought I knew but deeply misunderstood. +Now that I understand them better, I can coach my peers more effectively even +if they are still in a GUI-based ecosystem.

+

Basically, (Neo)Vim actually did change my life and I'm really thankful for it +(maybe that should be the title?)

+ +]]>
Make a series of directories fast!https://pype.dev/make-a-series-of-directories-fast.htmlnicpaynelinuxclitechhttps://pype.dev/make-a-series-of-directories-fast.htmlThu, 10 Nov 2022 15:27:50 GMTarchive-2022 +

mkdir s{1..10} will make directories s1, s2, ... s10 in one command!

+ +]]>
Hebrew Bible Full Classhttps://pype.dev/hebrew-bible-full-class.htmlnicpaynebible-projectfaithhttps://pype.dev/hebrew-bible-full-class.htmlSat, 05 Nov 2022 06:27:40 GMTarchive-2022 +

Class link +Classroom notes (Must be on home network)

+

01 The Shape of the Hebrew Bible

+

Session 1: What on Earth is the Hebrew Bible?

+

This class is not so much a survey of the HB, it is Tim's attempt to distil the +most helpful things for understanding it in a consumable way for laypeople.

+

A chunk of this is the other people giving some of their own background. One +lady said something that might be helpful for ministry - "Maybe that thing that +I saw as 'you don't love me' is 'I don't know how to love you'"

+

!!! note "how to love"

+
Maybe that thing that I saw as 'you don't love me' is 'I don't know how to love you'
+
+

!!! danger "Christian coping strategy for the Olt Testament"

+
1. Hero-example model
+    * Stories get isolated and distilled down into a simple moral model, where the hero is just the hero.
+    * Veggie-Tales is uber-guilty of this nonsense
+    * There's something correct about this - but the oversimplification usually comes out of a massive re-writting of the stories, then anyone raised on those versions of the story is scaldalized when they read it for real
+
+2. Poltical-authority source
+    * Political parties hijacking "The Bible says X about Y" as a means to harvest authority from a book that many people claim is authoritative.
+
+3. Theology answer book model
+    * Treating the Bible like a dictionary of key/value pairs where keys are questions and values are simple answers.
+    * This ignores narrative, and general literacy.
+    * The instinct may be right - the Bible should profoundly shape my view of everything, but it isn't simple
+
+4. Inspirational-heart-warming model
+    * Verse-a-day calendars
+    * Jermiah 29:11
+
+

!!! warning ""

+
Are we imposing a set of questions that are foreign to what the authors are
+trying to communicate? do we need to set our cultural agendas aside to just
+listen?
+
+

A result of asking the wrong questions is the common story of people's faith being dismantled by reading the Bible

+

!!! note "DL Baker - Two Testaments - One Bible"

+
One of the most fundamental questions which has faced theology and the
+Church in every age... is whether or not Christianity also needs an Old
+Testament. Is the Old Testament to be thrown away as obsolete, or pre-
+served as a relic from days of yore, or treasured as a classic and read by
+scholars, or used occasionally as a change from the New Testament, or
+kept in a box in case it should be needed some day? Or is the Old Testa-
+ment an essential part of the Christian Bible, with continuing validity along-
+side the New Testament? —
+
+

Session 2: How Jesus and the Apostle ReadTheir Bibles

+

The Bible most often refers to itself as the Writings

+

!!! note "Road to Emmaus"

+
Jesus confronts a couple guys walking to Emmaus after he is resurrected and
+more or less calls them idiots/fools for not understanding that the
+Writings point to an annointed king who will suffer death for the sake of
+redemption. He's recognized by them once their eyes are opened then he vanishes
+
+

Weird stuff

+

Paul and Timothy

+

Paul assumes when writing to Timothy that he, and probably believers in general, are in a community of people who are regularly learning about Yahweh through the Scriptures as a family

+

!!! scripture "2 Timothy 3:15-16"

+
... and that from childhood you ahve known the sacred writings which are
+able to give you the wisdom that leas to salvation through faith which is
+in Christ Jesus. All Scripture is inspired by God and profitable for
+teaching, for reproof, for correction, for training in righteousness
+
+

!!! success ""

+
For Paul, the `Scriptures` here are our OT, the Hebrew Bible. For Paul, the HB
+is entirely _wisdom literature_ that leads to salvation through Jesus
+
+

The question of "What are the Scriptures?" is covered in the next session

+

To answer the question 'How do we read the HB?' we have to ask the question +'Whose book is the HB?'

+

Session 3: Shape of the Scriptures

+

Old Testament is the Christian term for a set of writings that comprise about +3/4 of the Christian Bible. The authors themselves though refer to those +writings as the Scriptures. One time it is called the Old Covenant by Paul +, but he's talking about Synagogue readings of the Torah portion in synagogues. +THe phrase Hebrew Bible is a modern term that is a bit more neutral.

+
+

So, what is our Bible?

+
+

!!! scripture "Luke 24:25-27"

+
25 And he said to them, “O foolish ones, and slow of
+heart to believe all that the prophets have spoken! 26 Was it not necessary
+that the Christ should suffer these things and enter into his glory?”
+27 And beginning with Moses and all the Prophets, he interpreted to them in
+all the Scriptures the things concerning himself.
+
+
+

Moses and the Prophets

+
+

TaNaK

+

Jweish reference to the books in our OT, in the Hebrew Bible, but the arangement is different...

+

!!! note "TaNaK"

+
1. T = Torah (first 5 books)
+2. N - Nevi'im (Prophets: Joshua - Kings) [Christians often call these the 'historial books']
+3. K - Ketuvim
+
+| **Torah** | **Pentateuch** |
+| --- | --- |
+| Genesis - Exodus - Leviticus - Numbers Deuteronomy | Genesis - Exodus - Leviticus - Numbers - Deuteronomy |
+| **Nevi'im - The Prophets** | **History** |
+| *Former Prophets* <br/> Joshua - Judges - Samueal - Kings | Joshua - Judges - Ruth <br/> 1-2 Samuel - 1-2 Kings <br/> 1-2 Chronicles <br/> Ezra - Nehemiah - Ester |
+| *Later Prophets* <br/> Isaiah - Jeremiah - Ezekiel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi | **Poetry** <br/> Job - Psalms - Proverbs - Ecclesiastes - Song of Solomon |
+| **Kethuvim - The Writings** | **Prophets** |
+| Psalms - Job - Proverbs <br/> Ruth - Song of Songs - Ecclesiastes - Lamentations - Esther [The Megillot] <br/> Daniel - Ezra - Nehemiah - Chronicles | Isiah - Jeremiah - Lamentations <br/> Ezekiel - Daniel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi |
+
+

!!! scripture "Luke 11:49–51 (ESV) "

+
49 Therefore also the Wisdom of God said, ‘I will send them prophets and
+apostles, some of whom they will kill and persecute,’ 50 so that the blood
+of all the prophets, shed from the foundation of the world, may be charged
+against this generation, 51 from the blood of Abel to the blood of
+Zechariah, who perished between the altar and the sanctuary. Yes, I tell
+you, it will be required of this generation.
+
+
+

Blood of Abel to the blood of Zechariah...

+
+

Why would Jesus pick these two events? Abel is murdered on page 4, Zechariah is +murdered in the last part of Chronicles, which in the TaNaK is significant... +Jesus is saying that all the prophets from the beginning of the Scriptures to +the end... All the prophets from A-Z so to speak

+

!!! note "Scriptures"

+
"Books" as we know it, bound papers with writing on it, called a 'codex'
+wasn't a thing until a couple hundred years post-Jesus... so when the
+authors say "The Scriptures" we need to keep in mind that Jews had the
+scriptures in their minds and hearts, not on paper (save for a couple very
+expensive scrolls). So the structure of the scriptures is also apart of the
+Jewish being... This interaction with the Scriptures is _very very very
+different than how we interact with the Bible_
+
+

!!! note "4QMMT"

+
"The scrolls of Moses, the words of the prophets, and of David."
+
+

!!! note "Philo of Alexandria"

+
The laws and the oracles given by inspiration through the prophets and the
+Psalms, and the other scrolls whereby knowledge and piety are increased and
+completed...
+
+- De Vita Contemplatetiva, 25
+
+

Melito of Sardis

+
    +
  • Early 200s
  • +
  • One of the earliest Christians to talk about the books/scrolls of Christian scriptures
  • +
  • Summarizes Christian ordering of the Hebrew Bible with some logic +
      +
    • Foundation narrative of the Pentateuch
    • +
    • History
    • +
    • Poetry
    • +
    • Prophets then point forward to the coming Messiah, Jesus, and the NT writings
    • +
    +
  • +
+

Session 4 - Seams between Texts in the Dead Sea Scrolls

+

Around 100-200 AD there was a split in the Jewish community over things like +how the Temple and sacrifices were to be run, etc. A group got kicked out, so +they grabbed some scrolls and went to start what we'd think of as a Monastic +community. Qumran community is where they went, and the scrolls this group +managed are called the Dead Sea Scrolls.

+

Out of DSS we have some of the oldest biblical scrolls, they have their own +writings and liturgies since they were all priests basically too.

+

The scrolls were hidden in caves before the Romans marched on Qumran. They were +found in the 1940s by a bunch of shepherds. A few showed up online for sale and +that's how we found out about their exitence.... These scrolls give us +pre-Christian Jewish Bible nerds...

+

Qumran community didn't know about Jesus - they thought the Messiah would be a +man called The Teacher of Righteousness

+

Scroll-making

+

The DSS preserved for us, not only ancient biblical texts, but also the method +by which scrolls were created. They were well-preserved papyrus that was +stiched together - literal stitches. We also have obvious additions from Qumran +community as well as notes from priests and corrections from missed +transcribing.

+

Our Bible

+

The DSS scrolls, being the oldest stitched together set of scrolls, teach us +how scrolls and collections of ancient holy texts were put together. We need to +keep this in mind when we think about where our Christian Bible came from

+

The beginning and ending of our books might/are filled with hyperlinks that +call a reader's mind back to other stories. It's the way of linking context and +stories to one another before the writings are in a codex

+
+

Hyperlinks - language/syntax that remind a reader of antoher scroll - help us +understand the structure of the Hebrew Bible

+
+

!!! note "A favorite quote from Tim"

+
So, you can see I'm interested in a historical question of like the
+collection [Hebrew Bible] was produced by a group of people. What did they
+mean by it? And we can actually know a lot about what they meant and locate
+them and read it the way they wanted us to read it, and pick up what
+they're saying. And, lo and behold, you know, I hope to convince you
+that—and this is all pre-Christian—what's happening here and what this all
+points to and means, fits hand in glove with how Jesus and Paul and the
+apostles talk about these texts.
+So that's different from saying nobody
+knew what these texts meant. The events of Jesus happen, and then we go
+reread it, and it has a whole new meaning that no one has ever imagined. It
+seems to me what actually happened in history was a little more interesting
+and complicated than that.  [17:30-18:21]
+
+ +]]>
Case-insensitive search in Vimhttps://pype.dev/case-insensitive-search-in-vim.htmlnicpaynevimvimtechhttps://pype.dev/case-insensitive-search-in-vim.htmlFri, 21 Oct 2022 06:40:21 GMTarchive-2022 +

/mysearch\c will match mysearch, MYSEARCH, mYSeArCh...

+ +]]>
Faithfulhttps://pype.dev/faithful.htmlnicpaynebible-projectfaithhttps://pype.dev/faithful.htmlFri, 21 Oct 2022 06:31:33 GMTarchive-2022 +

Link

+

Notes

+

!!! Exodusds 34:6

+
Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness
+
+

Faithfulness - Emet (can be translated 'Truth') +Related to "Amen" which is untranslated Hebrew expression meaning "that's truth"

+

Stability

+

Moses has to hold his hands up when Israel faces the Amalekites. Joshua (and another) bring Moses a rock to sit on and hold is hands up so they could be Emet.

+

People

+

Describs trustiworthiness

+

Exodus 18:21 - Moses apoints leaders are to be "Emet"

+

God and promises

+

God is a rock - he is faithful, just, and upright

+

Hebrew word for trust is He'Emin which is the verb form of Emet

+

Abraham considers God Emet, he He'Emin's God and God blesses this by creating Isreal.

+

Israel, In Exodus 14:31, He'Emin's God (until they see the gians in Canaan that is)

+

1 Kings 1:6 says David walked in Emet with God

+

2 Samuel 7:16, God blesses David and says his kingdom will have Emet

+

Romans 15:8-9 says Jesus came on behalf of God's faithfulness.

+

Questions

+

!!! note "1"

+
The Hebrew word “emet” is translated with words like “faithful,”
+“reliable,” “sure,” “trustworthy,” and “amen.” Read aloud Psalm 36:5-6 ,
+Psalm 19:7 , and Psalm 41:13 and discuss what the psalmists are
+communicating in these passages when they use the word “emet.”
+
+

!!! scripture "Psalms 36:5-6"

+
5Your lovingkindness, O Lord, extends to the heavens,
+
+Your faithfulness reaches to the skies.
+
+6Your righteousness is like the mountains of God;
+
+Your judgments are like a great deep.
+
+O Lord, You preserve man and beast.
+
+

!!! scripture "Psalms 19:7"

+
7The law of the Lord is perfect, restoring the soul;
+
+The testimony of the Lord is sure, making wise the simple.
+
+

!!! scripture "Psalms 41:13"

+
13Blessed be the Lord, the God of Israel,
+
+From everlasting to everlasting.
+
+Amen and Amen.
+
+

I think the lesson here is pretty simple - God is faithful, full stop. His +faithfulness doesn't look necessarily like how we might want... when I was a +kid I would be upset if my parents didn't respond to me in the way I wanted, +and my kids will certainly share that disappointment. But I am faithful to my +children - sometimes the main issue is a child's outlook on a situation or +worldview. I think that metaphor holds true in relation to humans and Yahweh - +he sees the whole world, we see a part of it so we cannot understand +faithfulness fully, in the same way that my children can't understand my +faithfulness to them fully - even to the point of being upset or thinking that +I'm not being faithful

+

!!! note "2"

+
God promised the Israelites that he would give them a king of peace that
+would rule forever and ever (e.g. 2 Samuel 7:16). However, Israel’s kingdom
+collapsed and they found themselves without a home or a king. Compare the
+beginning of Psalm 89 (vv. 1-10) with the way it closes (vv. 46-52). What
+do you think it practically looks like to trust God when all seems lost?
+
+

!!! scripture "2 Samuel 7:16"

+
16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”
+
+

!!! scripture "PSALM 89"

+
The Lord’s Covenant with David, and Israel’s Afflictions.
+
+A Maskil of Ethan the Ezrahite.
+
+1I will sing of the lovingkindness of the Lord forever;
+
+To all generations I will make known Your faithfulness with my mouth.
+
+2For I have said, “Lovingkindness will be built up forever;
+
+In the heavens You will establish Your faithfulness.”
+
+3“I have made a covenant with My chosen;
+
+I have sworn to David My servant,
+
+4I will establish your seed forever
+
+And build up your throne to all generations.” Selah.
+
+5The heavens will praise Your wonders, O Lord;
+
+Your faithfulness also in the assembly of the holy ones.
+
+6For who in the skies is comparable to the Lord?
+
+Who among the sons of the mighty is like the Lord,
+
+7A God greatly feared in the council of the holy ones,
+
+And awesome above all those who are around Him?
+
+8O Lord God of hosts, who is like You, O mighty Lord?
+
+Your faithfulness also surrounds You.
+
+9You rule the swelling of the sea;
+
+

!!! note "3"

+
Ultimately, God answers the psalmist’s cries in the person of Jesus. Compare 2 Samuel 7:16
+2 Samuel 7:16
+
+16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”
+
+to Hebrews 1:8-9
+Hebrews 1:8-9
+
+8But of the Son He says,
+
+“Your throne, O God, is forever and ever,
+
+And the righteous scepter is the scepter of His kingdom.
+
+9You have loved righteousness and hated lawlessness;
+
+Therefore God, Your God, has anointed You
+
+With the oil of gladness above Your companions.”
+
+. How does King Jesus embody and fulfill the ancient promises of God (e.g. John 1:14
+John 1:14
+
+The Word Made Flesh
+
+14And the Word became flesh, and dwelt among us, and we saw His glory, glory as of the only begotten from the Father, full of grace and truth.
+
+, Hebrews 3:5-6
+Hebrews 3:5-6
+
+5Now Moses was faithful in all His house as a servant, for a testimony of those things which were to be spoken later; 6but Christ was faithful as a Son over His house—whose house we are, if we hold fast our confidence and the boast of our hope firm until the end.
+
+, and Romans 15:8-9
+Romans 15:8-9
+
+8For I say that Christ has become a servant to the circumcision on behalf of the truth of God to confirm the promises given to the fathers, 9and for the Gentiles to glorify God for His mercy; as it is written,
+
+“Therefore I will give praise to You among the Gentiles,
+
+And I will sing to Your name.”
+
+)?
+
+

!!! note "4"

+
Read Hebrews 10:22-25
+Hebrews 10:22-25
+
+22let us draw near with a sincere heart in full assurance of faith, having our hearts sprinkled clean from an evil conscience and our bodies washed with pure water. 23Let us hold fast the confession of our hope without wavering, for He who promised is faithful; 24and let us consider how to stimulate one another to love and good deeds, 25not forsaking our own assembling together, as is the habit of some, but encouraging one another; and all the more as you see the day drawing near.
+
+, Hebrews 11
+Hebrews 11
+
+The Triumphs of Faith
+
+1Now faith is the assurance of things hoped for, the conviction of things not seen. 2For by it the men of old gained approval.
+
+3By faith we understand that the worlds were prepared by the word of God, so that what is seen was not made out of things which are visible. 4By faith Abel offered to God a better sacrifice than Cain, through which he obtained the testimony that he was righteous, God testifying about his gifts, and through faith, though he is dead, he still speaks. 5By faith Enoch was taken up so that he would not see death; and he was not found because God took him up; for he obtained the witness that before his being taken up he was pleasing to God. 6And without faith it is impossible to please Him, for he who comes to God must believe that He is and that He is a rewarder of those who seek Him. 7By faith Noah, being warned by God about things not yet seen, in reverence prepared an ark for the salvation of his household, by which he condemned the world, and became an heir of the righteousness which is according to faith.
+
+8By faith Abraham, when he was called, obeyed by going out to a place which he was to receive for an inheritance; and he went out, not knowing where he was going. 9By faith he lived as an alien in the land of promise, as in a foreign land, dwelling in tents with Isaac and Jacob, fellow heirs of the same promise; 10for he was looking for the city which has foundations, whose architect and builder is God. 11By faith even Sarah herself received ability to conceive, even beyond the proper time of life, since she considered Him faithful who had promised. 12Therefore there was born even of one man, and him as good as dead at that, as many descendants as the stars of heaven in number, and innumerable as the sand which is by the seashore.
+
+13All these died in faith, without receiving the promises, but having seen them and having welcomed them from a distance, and having confessed that they were strangers and exiles on the earth. 14For those who say such things make it clear that they are seeking a country of their own. 15And indeed if they had been thinking of that country from which they went out, they would have had opportunity to return. 16But as it is, they desire a better country, that is, a heavenly one. Therefore God is not ashamed to be called their God; for He has prepared a city for them.
+
+17By faith Abraham, when he was tested, offered up Isaac, and he who had received the promises was offering up his only begotten son; 18it was he to whom it was said, “In Isaac your descendants shall be called.” 19He considered that God is able to raise people even from the dead, from which he also received him back as a type. 20By faith Isaac blessed Jacob and Esau, even regarding things to come. 21By faith Jacob, as he was dying, blessed each of the sons of Joseph, and worshiped, leaning on the top of his staff. 22By faith Joseph, when he was dying, made mention of the exodus of the sons of Israel, and gave orders concerning his bones.
+
+23By faith Moses, when he was born, was hidden for three months by his parents, because they saw he was a beautiful child; and they were not afraid of the king’s edict. 24By faith Moses, when he had grown up, refused to be called the son of Pharaoh’s daughter, 25choosing rather to endure ill-treatment with the people of God than to enjoy the passing pleasures of sin, 26considering the reproach of Christ greater riches than the treasures of Egypt; for he was looking to the reward. 27By faith he left Egypt, not fearing the wrath of the king; for he endured, as seeing Him who is unseen. 28By faith he kept the Passover and the sprinkling of the blood, so that he who destroyed the firstborn would not touch them. 29By faith they passed through the Red Sea as though they were passing through dry land; and the Egyptians, when they attempted it, were drowned.
+
+30By faith the walls of Jericho fell down after they had been encircled for seven days. 31By faith Rahab the harlot did not perish along with those who were disobedient, after she had welcomed the spies in peace.
+
+32And what more shall I say? For time will fail me if I tell of Gideon, Barak, Samson, Jephthah, of David and Samuel and the prophets, 33who by faith conquered kingdoms, performed acts of righteousness, obtained promises, shut the mouths of lions, 34quenched the power of fire, escaped the edge of the sword, from weakness were made strong, became mighty in war, put foreign armies to flight. 35Women received back their dead by resurrection; and others were tortured, not accepting their release, so that they might obtain a better resurrection; 36and others experienced mockings and scourgings, yes, also chains and imprisonment. 37They were stoned, they were sawn in two, they were tempted, they were put to death with the sword; they went about in sheepskins, in goatskins, being destitute, afflicted, ill-treated 38(men of whom the world was not worthy), wandering in deserts and mountains and caves and holes in the ground.
+
+39And all these, having gained approval through their faith, did not receive what was promised, 40because God had provided something better for us, so that apart from us they would not be made perfect.
+
+, and Hebrews 12:1-3
+Hebrews 12:1-3
+
+Jesus, the Example
+
+1Therefore, since we have so great a cloud of witnesses surrounding us, let us also lay aside every encumbrance and the sin which so easily entangles us, and let us run with endurance the race that is set before us, 2fixing our eyes on Jesus, the author and perfecter of faith, who for the joy set before Him endured the cross, despising the shame, and has sat down at the right hand of the throne of God.
+
+3For consider Him who has endured such hostility by sinners against Himself, so that you will not grow weary and lose heart.
+
+. After reading these passages, name one example of what it looks like to put our trust in God.
+
+ +]]>
\ No newline at end of file diff --git a/archive-2023-1.html b/archive-2023-1.html new file mode 100644 index 00000000..947e1075 --- /dev/null +++ b/archive-2023-1.html @@ -0,0 +1,425 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2023' - 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2023' - 1
+
+ + + + + +
+
+ +
+
+

Chaos dragon

+ +
+

+ + +Dragons are metaphorical images in the Bible +Goliath -> armor descriptions +Leviathan +Dragon slayers can be enticed to become dragons themselves +Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon + +calming the ... + read more → +

+ +
+ + + + +
+ +

+ + +ChatGPT Prompt: +Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some prompts for generating art with Stable Diffusion. +Example: + +A ghostly apparition drifting through a haunted mansion's grand ballroom, illuminated by fli ... + read more → +

+ +
+
+ +

+ + + +James +2023 study of the book of James +BP +The Guy +Greek: Iakobos (Jacob in English) +Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection +The book of James is the legacy of this Jacob's wisdom which was h ... + read more → +

+ +
+ +
+ +

+ + +I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least nav ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2023-2.html b/archive-2023-2.html new file mode 100644 index 00000000..936137a3 --- /dev/null +++ b/archive-2023-2.html @@ -0,0 +1,239 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2023' - 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2023' - 2
+
+ + + + + +
+
+ + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2023.html b/archive-2023.html new file mode 100644 index 00000000..bf91a0e8 --- /dev/null +++ b/archive-2023.html @@ -0,0 +1,425 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2023' | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2023'
+
+ + + + + +
+
+ +
+
+

Chaos dragon

+ +
+

+ + +Dragons are metaphorical images in the Bible +Goliath -> armor descriptions +Leviathan +Dragon slayers can be enticed to become dragons themselves +Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon + +calming the ... + read more → +

+ +
+ + + + +
+ +

+ + +ChatGPT Prompt: +Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some prompts for generating art with Stable Diffusion. +Example: + +A ghostly apparition drifting through a haunted mansion's grand ballroom, illuminated by fli ... + read more → +

+ +
+
+ +

+ + + +James +2023 study of the book of James +BP +The Guy +Greek: Iakobos (Jacob in English) +Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection +The book of James is the legacy of this Jacob's wisdom which was h ... + read more → +

+ +
+ +
+ +

+ + +I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least nav ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2023.json b/archive-2023.json new file mode 100644 index 00000000..33a6d527 --- /dev/null +++ b/archive-2023.json @@ -0,0 +1,249 @@ +{ + "version": "https://jsonfeed.org/version/1", + "title": "Pype.dev", + "home_page_url": "https://pype.dev", + "feed_url": "https://pype.dev/archive-2023.json", + "description": "my mental data-lake", + "items": [ + { + "id": "https://pype.dev/dhcp-restart-to-save-ubuntu-22-04-server-networking.html", + "url": "https://pype.dev/dhcp-restart-to-save-ubuntu-22-04-server-networking.html", + "title": "DHCP Restart to Save Ubuntu 22.04 Server Networking", + "content_html": "\n

I moved a computer to a remote location for an off-site backup but when it was powered on it wouldn't show up on any networks. A solution that got me back in was a friend restarting the dhcp client for me:

\n
sudo dhclient -r -v <interface> && sudo dhclient -v <interface>\n
\n\n", + "summary": "", + "date_published": "2023-12-31T20:26:50-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/chaos-dragon.html", + "url": "https://pype.dev/chaos-dragon.html", + "title": "Chaos Dragon", + "content_html": "\n

Dragons are metaphorical images in the Bible

\n

Goliath -> armor descriptions\nLeviathan

\n

Dragon slayers can be enticed to become dragons themselves

\n

Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon

\n\n

Jesus' victory came through the surrender of his life - which brings him deep\ninto the dragon's realm, to deliver the ultimate blow

\n

Reflect

\n
    \n
  1. \n

    In the Bible, why is it challenging for humans to slay the dragon? What risks are involved?\nThe dragon's power is enticing... back to Genesis 3, humans are easy to persuade to do things for personal gain\nIt's challenging also becauset the dragon is powerful, and humans are not\n(without its power or the power of Jesus) so if we stand against it without\nthe Lord, what hope do we have of victory?

    \n
  2. \n
  3. \n

    What are some of the ways that Jesus confronted the “dragon” in his ministry?

    \n\n
  4. \n
  5. \n

    How does Jesus ultimately defeat the “dragon”? How can we follow his example?

    \n\n
  6. \n
\n\n", + "summary": "", + "date_published": "2023-12-20T06:08:08-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/simple-port-forwarding-opnsense.html", + "url": "https://pype.dev/simple-port-forwarding-opnsense.html", + "title": "Simple Port Forwarding OPNSense", + "content_html": "\n

https://forum.opnsense.org/index.php?topic=8783.0

\n\n", + "summary": "", + "date_published": "2023-10-17T10:26:34-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/refresh-nextcloud-groupfolders-after-messing-around-on-the-filesystem.html", + "url": "https://pype.dev/refresh-nextcloud-groupfolders-after-messing-around-on-the-filesystem.html", + "title": "Refresh Nextcloud Groupfolders after messing around on the filesystem", + "content_html": "\n

Exec in as www-data and run ./occ groupfolders:scan folder_id -v (the -v to see what it's doing)

\n\n", + "summary": "", + "date_published": "2023-09-23T12:45:06-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/lsof-to-find-what-s-using-your-filesystem.html", + "url": "https://pype.dev/lsof-to-find-what-s-using-your-filesystem.html", + "title": "lsof to find what's using your filesystem", + "content_html": "\n

lsof | grep /tank/nas shows me what is using my nas at any time!

\n\n", + "summary": "", + "date_published": "2023-04-09T13:32:38-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "zfs", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/convert-word-doc-to-pdf-with-headless-libreoffice.html", + "url": "https://pype.dev/convert-word-doc-to-pdf-with-headless-libreoffice.html", + "title": "Convert Word Doc to PDF with Headless Libreoffice", + "content_html": "\n

I've been using paperless-ngx to manage all my documents, but every once in a while I'll get a .docx file to deal with...

\n

Turns out Libreoffice has a headless mode a pdf converter built-in!

\n
libreoffice --headless --convert-to pdf /path/to/file.docx --outdir /path/to/output/directory\n
\n
\n

Note that --outdir is in fact a directory, not the path to a file

\n
\n\n", + "summary": "", + "date_published": "2023-03-09T06:48:38-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "cli", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/stable-diffusion-notes.html", + "url": "https://pype.dev/stable-diffusion-notes.html", + "title": "Stable Diffusion Notes", + "content_html": "\n

ChatGPT Prompt:

\n

Stable Diffusion is an AI art generation model similar to DALLE-2.\nHere are some prompts for generating art with Stable Diffusion.

\n

Example:

\n\n

The prompt should adhere to and include all of the following rules:

\n\n

I want you to write me a list of detailed prompts exactly about the IDEA follow the rule at least 6 every time.

\n

Ready for my idea?

\n

ChatGPT Prompt for RPG V4:

\n

Stable Diffusion is an AI art generation model similar to DALLE-2.\nHere are some pairs of positive and negative prompts for generating art with Stable Diffusion.

\n

Example:

\n
    \n
  1. \n
\n

Positive: A (full body:1.3) shot at 8k resolution, splash art, fantastic comic book style, photorealistic, intense look, anatomical photorealistic digital painting portrait of a (old male:1.3) human (warrior:1.3) in black and gold intricate (heavy armor:1.3) in a (dark and moody universe:1.3), light particle, very detailed skin,samurai, very detailed eyes, (elden ring style:1.3), (warhammer style:1.1), concept artist, global illumination, depth of field, splash art, art by artgerm and greg rutkowski and viktoria gavrilenko\nNegative: (symmetry:1.2), facial marking, crown, horn, (helmet:1.3), (hoodie:1.1), clock, Female, visible hand, asian, two face, big hair, open mouth, cartoon, high contrast, poorly drawn, Scribbles, Low quality, Low rated, Mediocre, Screenshot, Software, UI, watermark, text, overlay, getty images, cropped, low quality

\n
    \n
  1. \n
\n

Positive: close-up head, facing camera, beautiful satanic female necromancer blood queen, ritualistic (neck tattoo:1.3), (insanely detailed:1.5), ((solo)), (highest quality, Alessandro Casagrande, Greg Rutkowski, Sally Mann, concept art, 4k), (colourful), (high sharpness), ((detailed pupils)), ((painting:1.1)), (digital painting:1.1), detailed face and eyes,Masterpiece, best quality, highly detailed photo:1, 8k, detailed face,photorealistic, (black long Hair:1.1),(young woman),By jeremy mann, by sandra chevrier, by maciej kuciara, smoke and shadow, night, sharp, ((perfect body)), realistic, real shadow, 3d, ((full body)), ((dark and gloomy universe)), (by Michelangelo)\nNegative: crown, (facial marking:1.2), cloth gem, jewel, jewelry, (flower:1.3), (cloak:1.1), (bad art, low detail, pencil drawing, old, mature:1.6), (grainy, low quality, mutated hands and fingers:1.5), (watermark, thin lines:1.3), (deformed, signature:1.2), (big nipples, blurry, ugly, bad anatomy, extra limbs, undersaturated, low resolution), disfigured, deformations, out of frame, amputee, bad proportions, extra limb, missing limbs, distortion, floating limbs, out of frame, poorly drawn face, poorly drawn hands, text, malformed, error, missing fingers, cropped, jpeg artifacts, teeth, unsharp

\n
    \n
  1. \n
\n

Positive: (Painting:1.3) of (Detailed illustration:1.3) A (full body:1.3) shot at 8k resolution, splash art, fantastic comic book style, photorealistic, intense look, anatomical photorealistic digital painting portrait of a (old male:1.3) human (warrior:1.3) in black and gold intricate (heavy armor:1.3) in a (dark and moody universe:1.3), light particle, very detailed skin,samurai, very detailed eyes, (elden ring style:1.3), (warhammer style:1.1), concept artist, global illumination, depth of field, splash art, art by artgerm and greg rutkowski and viktoria gavrilenko\nNegative: (symmetry:1.2), facial marking, crown, (horn:1.1), (helmet:1.3), (hoodie:1.1), clock, Female, visible hand, asian, two face, big hair, open mouth, cartoon, high contrast, poorly drawn, Scribbles, Low quality, Low rated, Mediocre, Screenshot, Software, UI, watermark, text, overlay, getty images, cropped, low qualityLow quality,Bad composition,Faded,(Photo:1.5),(Frame:1.3),watermark,signa ture

\n
    \n
  1. \n
\n

Positive: sci-fi, space rogue thief girl, (smirk:1.1), short hair, black hood, light armor, big grey eyes, beautiful detailed eyes, drawn by Greg Rutkowski, Yoji Shinkawa:0.6\nNegative: open mouth, facial marking, flower, bad-hands-5, lipstick, text, watermark

\n

The prompt should adhere to and include all of the following rules:

\n\n

I want you to write me a list of detailed prompts exactly about the IDEA follow the rule at least 6 every time.

\n

Ready for my idea?

\n

IDEAS

\n

IDEA: A slice of pie that is filled with a futuristic city

\n

Artists I like

\n

Examples

\n\n

Anime styles

\n\n

Scenic

\n\n

Cityscapes

\n\n

Abstract

\n\n

Settings notes

\n

I tend to like cfg at least on the higher end

\n

Good prompts

\n

Angel of death, shadows and mist, skelletol feathered wings, highly detailed, amazing details, intriciate lines, purple haze, styles Yuumei and Krenz Cushart, UHD, HDR, upscale, 8K photo, concept art

\n

Unicorns

\n

positive: unicorn, lora:Unicorns:0.9, portrait, professional photography, 35mm, highly detailed, incredibly realistic, best quality, high quality, highres, purple, lora:mossbeast:0.3

\n

negative: (two tails:1.2),FastNegativeV2,(bad-artist:1.0), (loli:1.2), (worst quality, low quality:1.4), (bad_prompt_version2:0.8), bad-hands-5,lowres, bad anatomy, bad hands, ((text)), (watermark), error, missing fingers, extra digit, fewer digits, cropped, worst quality, low quality, normal quality, ((username)), blurry, (extra limbs), bad-artist-anime, badhandv4, EasyNegative, ng_deepnegative_v1_75t, verybadimagenegative_v1.3, BadDream,(three hands:1.1),(three legs:1.1),(more than two hands:1.4),(more than two legs,:1.2),

\n\n", + "summary": "", + "date_published": "2023-01-28T14:15:11-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "data", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/olivet-mens-group-james-2023.html", + "url": "https://pype.dev/olivet-mens-group-james-2023.html", + "title": "olivet-mens-group-james-2023", + "content_html": "\n\n

James

\n

2023 study of the book of James

\n

BP

\n

The Guy

\n

Greek: Iakobos (Jacob in English)

\n

Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection

\n

The book of James is the legacy of this Jacob's wisdom which was heavily influenced by two things:

\n
    \n
  1. Sermon on the Mount / Matthew 5-7
  2. \n
  3. Proverbs - expecially chapters 1-9
  4. \n
\n

Summary

\n

These are short challenging wisdom speeches full of metaphors and one-liners... Live in a wise way, submitting to Jesus

\n

Chapters 2-5 teach about wholehearted devotion to Jesus - there are 12 teachings total

\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n
sectionsummarysource
2:1-13favoritism vs love(Matthew 5:46-48)
2:14-26genuine faith(Matthew 7:21-27)
teaching about words
3:1-12the tongue(Luke 6:43-45)
4:11-12 fm condeming others(matthew 12:36-37)
5:12telling the truth(Matthew 5:37)
wealth
4:13-17arrogance of wealth(Matthew 6:28-34)
5:1-6danger of wealth(Matthew 6:19-21)
5:7-11peace and endurance(Matthew 24:13)
5:13-18faith-filled prayer(Mathew 21:21-22)
\n
\n

Other 4 are in the poster about James on BP

\n
\n

Chapter 1 the introduction

\n

2-4: life's trials produce endurance and can make us perfect and complete

\n

perect is repeated 7 times in the book - it refers to "wholeness" and integrity.

\n

We are all fractrued and inconsistent people

\n

perfect: Hebrew: Tamim, Greek: Teleios

\n

5-8: God gives wisdom to those who ask in faith

\n

9-11: povety can force us tot rust on God alone; wealth will pass away

\n

12-18: God is generous and gives us new birth through Jesus

\n

19-27: Don't just listen to God's word but do it. It's the Torah of Freedom

\n\n

Jan 21

\n

!!! scripture "James 1:1"

\n
James, a servant of God and of the Lord Jesus Christ, To the twelve tribes in the Dispersion: Greetings.\n
\n

Dispersion: διασπορά - same word used by Peter to describe Jesus-followers as exiles

\n

!!! scripture "James 1:2-11"

\n
2 Count it all joy, my brothers, when you meet trials of various kinds,\n3 for you know that the testing of your faith produces steadfastness. 4 And\nlet steadfastness have its full effect, that you may be perfect and\ncomplete, lacking in nothing.  5 If any of you lacks wisdom, let him ask\nGod, who gives generously to all without reproach, and it will be given\nhim. 6 But let him ask in faith, with no doubting, for the one who doubts\nis like a wave of the sea that is driven and tossed by the wind. 7 For that\nperson must not suppose that he will receive anything from the Lord; 8 he\nis a double-minded man, unstable in all his ways.  9 Let the lowly brother\nboast in his exaltation, 10 and the rich in his humiliation, because like a\nflower of the grass he will pass away. 11 For the sun rises with its\nscorching heat and withers the grass; its flower falls, and its beauty\nperishes. So also will the rich man fade away in the midst of his pursuits.\n
\n

July 15

\n
\n

Missed several meetings due to unfortunate travel circumstances

\n
\n

!!! scripture "James 3:13-18"

\n
13 Who is wise and understanding among you? By his good conduct let him\nshow his works in the meekness of wisdom. 14 But if you have bitter jealousy\nand selfish ambition in your hearts, do not boast and be false to the truth.\n15 This is not the wisdom that comes down from above, but is earthly,\nunspiritual, demonic. 16 For where jealousy and selfish ambition exist, there\nwill be disorder and every vile practice. 17 But the wisdom from above is first\npure, then peaceable, gentle, open to reason, full of mercy and good fruits,\nimpartial and sincere. 18 And a harvest of righteousness is sown in peace by\nthose who make peace.\n\nThe Holy Bible: English Standard Version (Jas 3:13–18). (2016). Crossway\nBibles.\n
\n

December 16

\n

!!! scripture "James 5:13-20"

\n
13 Is anyone among you suffering misfortune? He should pray. Is anyone\ncheerful? He should sing praise. 14 Is anyone among you sick? He should\nsummon the elders of the church and they should pray over him, anointing\nhim with olive oil in the name of the Lord. 15 And the prayer of faith will\nsave the one who is sick, and the Lord will raise him up, and if he has\ncommitted sins ⌊he will be forgiven⌋. 16 Therefore confess your sins to one\nanother, and pray for one another, so that you may be healed. The effective\nprayer of a righteous person accomplishes much. 17 Elijah was a human being\nwith the same nature as us, and ⌊he prayed fervently⌋ for it not to rain,\nand it did not rain on the land for three years and six months. 18 And he\nprayed again, and the sky gave rain and the earth produced its fruit.\n19 My brothers, if anyone among you should wander away from the truth and\nsomeone turns him back, 20 he should know that the one who turns a sinner\nback from the error of his way will save that person’s soul from death, and\nwill cover over a great number of sins.\n
\n

When to pray

\n
    \n
  1. All circumstances of life
  2. \n
  3. Sickness
  4. \n
  5. Confession
  6. \n
  7. Working out the will of God
  8. \n
  9. Retrieving wandering souls
  10. \n
\n

James ends his letter with prayer because it's an exhortation of the Disapora\nand a life of faith must revolve around prayer

\n

For myself I think I pray in all circumstances, sickness, confession all ok. I\ndo not pray for long periods of time, and don't feel very disiplined, but\nwhenever anything happens, by the Lord's grace I am quick to turn my\nattention to Jesus, and hopefully turn the attention of my wife/kids to Jesus\nas well. Example: a person collapsed at the water park we went to this last\nweekend, Athalia and I were close-ish to that happening, so I told her we\nneeded to stop what we were doing and pray that Jesus would intervene.

\n

I confess sin to Jesus but I'm not sure what that should look like. I've\ntaken a Brother Lawrence approach to try and quickly confess and move on,\naccepting grace, but I struggle with intentional sinning in this area... What\nis prayer if I knew what I was doing was wrong?

\n

I am not more inclined to pray for suffering, but I think that's because I've\nvery consciously been trying to pray in good circumstances more often because\nwhen we only pray in suffering that turns prayer into a Santa's wish list\nsituation I think... yes we need the Lord in suffering, but we display our need\nfor him NOT only in suffering, and if that is true then it begs the question,\nto me anyways, of whether or not the need is truly there

\n

JC Ryle's quote

\n

I disagree with the dude's quote about the requirement of prayer, but only\nbecause the message is given in a direction that makes prayer look like\nsomething I have to do to get/keep/maintain my salvation... Yahweh changes his\nchildren's hearts and orients them towards him through prayer - if someone\ndoesn't then I think that just means Yahweh has not worked or has not chosen\nthem, but them calling themselves a Christian is irrelevant, and no amount of\nforcing themselves to pray will change Yahweh's will.

\n

!!! scripture "Isaiah 1:6"

\n
From the sole of the foot and up to the head\nthere is no health in it;\nbruise and sore and bleeding wound have not been cleansed,\nand they have not been bound up\nand not softened with the oil.\n
\n

!!! scripture "Psalm 23:5"

\n
5 You prepare before me a table\nin the presence of my oppressors.\nYou anoint my head with oil;\nmy cup is overflowing.\n
\n

!!! scripture "1 Kings 17:1-16"

\n
17 Elijah the Tishbite from Tishbe of Gilead said to Ahab, “⌊As Yahweh\nlives⌋, the God of Israel before whom I stand, there shall surely not be\ndew nor rain these years ⌊except by my command⌋.” 2 Then the word of Yahweh\ncame to him, saying, 3 “Go from this place and turn to the east; you must\nhide yourself in the Wadi Kerith ⌊which faces the Jordan⌋. 4 It shall be\nthat you shall drink from the wadi, and I have commanded the crows to\nsustain you there.” 5 So he went and did according to the word of Yahweh.\nHe went and stayed in the Wadi Kerith ⌊which faces the Jordan⌋. 6 The crows\nwere bringing bread and meat in the morning for him and bread and meat in\nthe evening, and he drank from the wadi. 7 It happened ⌊after a while⌋ that\nthe wadi dried up, because there was no rain in the land.\n\n8 Then the\nword of Yahweh came to him, saying, 9 “Get up and go to Zarephath which\nbelongs to Sidon and stay there. Look, I have commanded a woman there, a\nwidow, to sustain you.” 10 So he arose and went to Zarephath and came to\nthe gate of the city. There was a widow woman gathering wood, so he called\nto her, and he said, “Please bring a little water for me in a vessel so\nthat I can drink.” 11 She went to fetch it, and he called to her and said,\n“Please bring me a morsel of bread in your hand.” 12 She said, “⌊As Yahweh\nyour God lives⌋, surely I do not have a cake, ⌊but only a handful of flour⌋\nin the jar and a little olive oil in the jug. Here I am gathering a few\npieces of wood, and I will go and prepare it for me and my son, that we\nmight eat it and die.” 13 Elijah said to her, “Don’t be afraid. Go and do\naccording to your word; only make for me a small bread cake from it first,\nand bring it out to me. Make it for yourself and for your son afterward.\n14 For thus says Yahweh, the God of Israel: ‘The jar of flour will not be\nemptied and the jug of olive oil will not run out until the day Yahweh\ngives rain on the surface of the earth.’ ” 15 So she went and did according\nto the word of Elijah; then both she and he ate with her household for many\ndays. 16 The jar of flour was not emptied and the jug of olive oil did not\nrun out, according to the word of Yahweh which he spoke by the hand of\nElijah.\n
\n\n", + "summary": "", + "date_published": "2023-01-21T06:06:31-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "olivet", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/ffmpeg-10-bit-videos-to-8-bit.html", + "url": "https://pype.dev/ffmpeg-10-bit-videos-to-8-bit.html", + "title": "FFMPEG 10-bit videos to 8-bit", + "content_html": "\n

ffmpeg -i input.mp4 -map 0 -c:v libx264 -vf format=yuv420p -c:a copy output.mp4

\n\n", + "summary": "", + "date_published": "2023-01-16T13:15:53-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "cli", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/i3-like-keyboard-mapping-in-pop-os.html", + "url": "https://pype.dev/i3-like-keyboard-mapping-in-pop-os.html", + "title": "i3-Like keyboard mapping in Pop_OS", + "content_html": "\n

I was introduced to tiling window managers through i3, which I use heavily on\none of my machines. I have switched to Pop_OS! at home though, which has a\ntiling window mode but the keybindings are not what I'm used to for i3. I\nwanted to at least navigate workspaces how I'm used to doing (cause I set\nworkspace 3 for communication apps, 1 for my terminal, etc...)

\n

Here's how I set keybindings for:

\n\n
#!/bin/bash\ngsettings set org.gnome.mutter dynamic-workspaces false \ngsettings set org.gnome.desktop.wm.preferences num-workspaces 8 \ngsettings set org.gnome.shell.keybindings switch-to-application-1 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-2 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-3 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-4 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-5 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-6 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-7 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-8 [] \ngsettings set org.gnome.shell.keybindings switch-to-application-9 [] \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-1 "['<Super>1']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-2 "['<Super>2']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-3 "['<Super>3']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-4 "['<Super>4']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-5 "['<Super>5']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-6 "['<Super>6']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-7 "['<Super>7']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-8 "['<Super>8']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-9 "['<Super>9']" \ngsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-10 "['<Super>0']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-1 "['<Super><Shift>1']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-2 "['<Super><Shift>2']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-3 "['<Super><Shift>3']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-4 "['<Super><Shift>4']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-5 "['<Super><Shift>5']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-6 "['<Super><Shift>6']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-7 "['<Super><Shift>7']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-8 "['<Super><Shift>8']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-9 "['<Super><Shift>9']" \ngsettings set org.gnome.desktop.wm.keybindings move-to-workspace-10 "['<Super><Shift>0']"\n
\n\n", + "summary": "", + "date_published": "2023-01-12T05:51:25-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/use-non-standard-named-ssh-keys-with-github.html", + "url": "https://pype.dev/use-non-standard-named-ssh-keys-with-github.html", + "title": "Use non-standard named ssh keys with github", + "content_html": "\n

I was getting (publickey denied) when trying to push to GH using ssh. When I\ntested the connection I saw that a bunch of keys in ``~/.ssh/ were being\nattempted

\n
✗ ssh git@github.com -vv\n\n...\n\ndebug1: Will attempt key: /home/nic/.ssh/id_rsa \ndebug1: Will attempt key: /home/nic/.ssh/id_ecdsa \ndebug1: Will attempt key: /home/nic/.ssh/id_ecdsa_sk \ndebug1: Will attempt key: /home/nic/.ssh/id_ed25519 \ndebug1: Will attempt key: /home/nic/.ssh/id_ed25519_sk \ndebug1: Will attempt key: /home/nic/.ssh/id_xmss \ndebug1: Will attempt key: /home/nic/.ssh/id_dsa \n\n...\n\ndebug1: No more authentication methods to try.\ngit@github.com: Permission denied (publickey).\n\n
\n

None of those were the key I setup with GH. So I added an entry\ninto ~/.ssh/config:

\n
Host\ngithub.com\nUser git\nPort 22\nHostname github.com\nIdentityFile ~/.ssh/my_custom_github_key\nTCPKeepAlive yes\nIdentitiesOnly yes \n\n
\n\n", + "summary": "", + "date_published": "2023-01-03T08:34:50-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "cli", + "tech" + ], + "language": "en" + } + ] +} \ No newline at end of file diff --git a/archive-2023.rss b/archive-2023.rss new file mode 100644 index 00000000..0c26e264 --- /dev/null +++ b/archive-2023.rss @@ -0,0 +1,494 @@ +Pype.devhttps://pype.devmy mental data-lakeSun, 31 Dec 2023 20:26:50 GMTFri, 06 Dec 2024 21:33:02 GMTmarmiteDHCP Restart to Save Ubuntu 22.04 Server Networkinghttps://pype.dev/dhcp-restart-to-save-ubuntu-22-04-server-networking.htmlnicpaynehomelablinuxtechhttps://pype.dev/dhcp-restart-to-save-ubuntu-22-04-server-networking.htmlSun, 31 Dec 2023 20:26:50 GMTarchive-2023 +

I moved a computer to a remote location for an off-site backup but when it was powered on it wouldn't show up on any networks. A solution that got me back in was a friend restarting the dhcp client for me:

+
sudo dhclient -r -v <interface> && sudo dhclient -v <interface>
+
+ +]]>
Chaos Dragonhttps://pype.dev/chaos-dragon.htmlnicpaynebible-projectfaithhttps://pype.dev/chaos-dragon.htmlWed, 20 Dec 2023 06:08:08 GMTarchive-2023 +

Dragons are metaphorical images in the Bible

+

Goliath -> armor descriptions +Leviathan

+

Dragon slayers can be enticed to become dragons themselves

+

Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon

+
    +
  • calming the sea
  • +
  • conquering sickness in others
  • +
  • tempter in the wilderness
  • +
+

Jesus' victory came through the surrender of his life - which brings him deep +into the dragon's realm, to deliver the ultimate blow

+

Reflect

+
    +
  1. +

    In the Bible, why is it challenging for humans to slay the dragon? What risks are involved? +The dragon's power is enticing... back to Genesis 3, humans are easy to persuade to do things for personal gain +It's challenging also becauset the dragon is powerful, and humans are not +(without its power or the power of Jesus) so if we stand against it without +the Lord, what hope do we have of victory?

    +
  2. +
  3. +

    What are some of the ways that Jesus confronted the “dragon” in his ministry?

    +
      +
    • calming the sea
    • +
    • conquering sickness in others
    • +
    • tempter in the wilderness
    • +
    +
  4. +
  5. +

    How does Jesus ultimately defeat the “dragon”? How can we follow his example?

    +
      +
    • Surrender
    • +
    • I think we do the same, but it doesn't always look like death, sometimes it's +subverting the temporary authorities we are under to comply in the least +possible ways while always ultimately striving for the coming of the Kingdom
    • +
    +
  6. +
+ +]]>
Simple Port Forwarding OPNSensehttps://pype.dev/simple-port-forwarding-opnsense.htmlnicpaynehomelabhomelabtechhttps://pype.dev/simple-port-forwarding-opnsense.htmlTue, 17 Oct 2023 10:26:34 GMTarchive-2023 +

https://forum.opnsense.org/index.php?topic=8783.0

+ +]]>
Refresh Nextcloud Groupfolders after messing around on the filesystemhttps://pype.dev/refresh-nextcloud-groupfolders-after-messing-around-on-the-filesystem.htmlnicpaynehomelablinuxtechhttps://pype.dev/refresh-nextcloud-groupfolders-after-messing-around-on-the-filesystem.htmlSat, 23 Sep 2023 12:45:06 GMTarchive-2023 +

Exec in as www-data and run ./occ groupfolders:scan folder_id -v (the -v to see what it's doing)

+ +]]>
lsof to find what's using your filesystemhttps://pype.dev/lsof-to-find-what-s-using-your-filesystem.htmlnicpaynezfshomelabtechhttps://pype.dev/lsof-to-find-what-s-using-your-filesystem.htmlSun, 09 Apr 2023 13:32:38 GMTarchive-2023 +

lsof | grep /tank/nas shows me what is using my nas at any time!

+ +]]>
Convert Word Doc to PDF with Headless Libreofficehttps://pype.dev/convert-word-doc-to-pdf-with-headless-libreoffice.htmlnicpaynelinuxclitechhttps://pype.dev/convert-word-doc-to-pdf-with-headless-libreoffice.htmlThu, 09 Mar 2023 06:48:38 GMTarchive-2023 +

I've been using paperless-ngx to manage all my documents, but every once in a while I'll get a .docx file to deal with...

+

Turns out Libreoffice has a headless mode a pdf converter built-in!

+
libreoffice --headless --convert-to pdf /path/to/file.docx --outdir /path/to/output/directory
+
+
+

Note that --outdir is in fact a directory, not the path to a file

+
+ +]]>
Stable Diffusion Noteshttps://pype.dev/stable-diffusion-notes.htmlnicpaynehomelabdatatechhttps://pype.dev/stable-diffusion-notes.htmlSat, 28 Jan 2023 14:15:11 GMTarchive-2023 +

ChatGPT Prompt:

+

Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some prompts for generating art with Stable Diffusion.

+

Example:

+
    +
  • A ghostly apparition drifting through a haunted mansion's grand ballroom, illuminated by flickering candlelight. Eerie, ethereal, moody lighting.
  • +
  • portait of a homer simpson archer shooting arrow at forest monster, front game card, drark, marvel comics, dark, smooth
  • +
  • pirate, deep focus, fantasy, matte, sharp focus
  • +
  • red dead redemption 2, cinematic view, epic sky, detailed, low angle, high detail, warm lighting, volumetric, godrays, vivid, beautiful
  • +
  • a fantasy style portrait painting of rachel lane / alison brie hybrid in the style of francois boucher oil painting, rpg portrait
  • +
  • athena, greek goddess, claudia black, bronze greek armor, owl crown, d & d, fantasy, portrait, headshot, sharp focus
  • +
  • closeup portrait shot of a large strong female biomechanic woman in a scenic scifi environment, elegant, smooth, sharp focus, warframe
  • +
  • ultra realistic illustration of steve urkle as the hulk, elegant, smooth, sharp focus
  • +
  • portrait of beautiful happy young ana de armas, ethereal, realistic anime, clean lines, sharp lines, crisp lines, vibrant color scheme
  • +
  • A highly detailed and hyper realistic portrait of a gorgeous young ana de armas, lisa frank, butterflies, floral, sharp focus
  • +
  • lots of delicious tropical fruits with drops of moisture on table, floating colorful water, mysterious expression, in a modern and abstract setting, with bold and colorful abstract art, blurred background, bright lighting
  • +
  • 1girl, The most beautiful form of chaos, Fauvist design, Flowing colors, Vivid colors, dynamic angle, fantasy world
  • +
  • solo, sitting, close-up, girl in the hourglass, Sand is spilling out of the broken hourglass, flowing sand, huge hourglass art, hologram, particles, nebula, magic circle
  • +
  • geometric abstract background, 1girl, depth of field, zentangle, mandala, tangle, entangle, beautiful and aesthetic, dynamic angle, glowing skin, floating colorful sparkles the most beautiful form of chaos, elegant, a brutalist designed, vivid colours, romanticism
  • +
+

The prompt should adhere to and include all of the following rules:

+
    +
  • Prompt should always be written in English, regardless of the input language. Please provide the prompts in English.
  • +
  • Each prompt should consist of a description of the scene followed by modifiers divided by commas.
  • +
  • When generating descriptions, focus on portraying the visual elements rather than delving into abstract psychological and emotional aspects. Provide clear and concise details that vividly depict the scene and its composition, capturing the tangible elements that make up the setting.
  • +
  • The modifiers should alter the mood, style, lighting, and other aspects of the scene.
  • +
  • Multiple modifiers can be used to provide more specific details.
  • +
+

I want you to write me a list of detailed prompts exactly about the IDEA follow the rule at least 6 every time.

+

Ready for my idea?

+

ChatGPT Prompt for RPG V4:

+

Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some pairs of positive and negative prompts for generating art with Stable Diffusion.

+

Example:

+
    +
  1. +
+

Positive: A (full body:1.3) shot at 8k resolution, splash art, fantastic comic book style, photorealistic, intense look, anatomical photorealistic digital painting portrait of a (old male:1.3) human (warrior:1.3) in black and gold intricate (heavy armor:1.3) in a (dark and moody universe:1.3), light particle, very detailed skin,samurai, very detailed eyes, (elden ring style:1.3), (warhammer style:1.1), concept artist, global illumination, depth of field, splash art, art by artgerm and greg rutkowski and viktoria gavrilenko +Negative: (symmetry:1.2), facial marking, crown, horn, (helmet:1.3), (hoodie:1.1), clock, Female, visible hand, asian, two face, big hair, open mouth, cartoon, high contrast, poorly drawn, Scribbles, Low quality, Low rated, Mediocre, Screenshot, Software, UI, watermark, text, overlay, getty images, cropped, low quality

+
    +
  1. +
+

Positive: close-up head, facing camera, beautiful satanic female necromancer blood queen, ritualistic (neck tattoo:1.3), (insanely detailed:1.5), ((solo)), (highest quality, Alessandro Casagrande, Greg Rutkowski, Sally Mann, concept art, 4k), (colourful), (high sharpness), ((detailed pupils)), ((painting:1.1)), (digital painting:1.1), detailed face and eyes,Masterpiece, best quality, highly detailed photo:1, 8k, detailed face,photorealistic, (black long Hair:1.1),(young woman),By jeremy mann, by sandra chevrier, by maciej kuciara, smoke and shadow, night, sharp, ((perfect body)), realistic, real shadow, 3d, ((full body)), ((dark and gloomy universe)), (by Michelangelo) +Negative: crown, (facial marking:1.2), cloth gem, jewel, jewelry, (flower:1.3), (cloak:1.1), (bad art, low detail, pencil drawing, old, mature:1.6), (grainy, low quality, mutated hands and fingers:1.5), (watermark, thin lines:1.3), (deformed, signature:1.2), (big nipples, blurry, ugly, bad anatomy, extra limbs, undersaturated, low resolution), disfigured, deformations, out of frame, amputee, bad proportions, extra limb, missing limbs, distortion, floating limbs, out of frame, poorly drawn face, poorly drawn hands, text, malformed, error, missing fingers, cropped, jpeg artifacts, teeth, unsharp

+
    +
  1. +
+

Positive: (Painting:1.3) of (Detailed illustration:1.3) A (full body:1.3) shot at 8k resolution, splash art, fantastic comic book style, photorealistic, intense look, anatomical photorealistic digital painting portrait of a (old male:1.3) human (warrior:1.3) in black and gold intricate (heavy armor:1.3) in a (dark and moody universe:1.3), light particle, very detailed skin,samurai, very detailed eyes, (elden ring style:1.3), (warhammer style:1.1), concept artist, global illumination, depth of field, splash art, art by artgerm and greg rutkowski and viktoria gavrilenko +Negative: (symmetry:1.2), facial marking, crown, (horn:1.1), (helmet:1.3), (hoodie:1.1), clock, Female, visible hand, asian, two face, big hair, open mouth, cartoon, high contrast, poorly drawn, Scribbles, Low quality, Low rated, Mediocre, Screenshot, Software, UI, watermark, text, overlay, getty images, cropped, low qualityLow quality,Bad composition,Faded,(Photo:1.5),(Frame:1.3),watermark,signa ture

+
    +
  1. +
+

Positive: sci-fi, space rogue thief girl, (smirk:1.1), short hair, black hood, light armor, big grey eyes, beautiful detailed eyes, drawn by Greg Rutkowski, Yoji Shinkawa:0.6 +Negative: open mouth, facial marking, flower, bad-hands-5, lipstick, text, watermark

+

The prompt should adhere to and include all of the following rules:

+
    +
  • Each prompt should consist of a description of the scene followed by modifiers divided by commas.
  • +
  • When generating descriptions, focus on portraying the visual elements rather than delving into abstract psychological and emotional aspects. Provide clear and concise details that vividly depict the scene and its composition, capturing the tangible elements that make up the setting.
  • +
  • The modifiers should alter the mood, style, lighting, and other aspects of the scene.
  • +
  • Multiple modifiers can be used to provide more specific details.
  • +
+

I want you to write me a list of detailed prompts exactly about the IDEA follow the rule at least 6 every time.

+

Ready for my idea?

+

IDEAS

+

IDEA: A slice of pie that is filled with a futuristic city

+

Artists I like

+

Examples

+
    +
  • J. M. W. Turner
  • +
  • Jean-Baptiste Monge
  • +
  • John Lasseter
  • +
  • John Martin
  • +
  • Raymond Swanland
  • +
+

Anime styles

+
    +
  • Krenz Cushart
  • +
  • Kyoto Animation
  • +
  • Yoshiyuki Sadamoto
  • +
  • Yuumei
  • +
+

Scenic

+
    +
  • Ted Nasmith
  • +
  • Terry Redlin
  • +
  • Thomas Kinkade
  • +
  • Thomas Moran
  • +
  • Thomas W Schaller
  • +
+

Cityscapes

+
    +
  • Marc Simonetti
  • +
  • Wadim Kashin
  • +
+

Abstract

+
    +
  • Scott Naismith
  • +
+

Settings notes

+

I tend to like cfg at least on the higher end

+

Good prompts

+

Angel of death, shadows and mist, skelletol feathered wings, highly detailed, amazing details, intriciate lines, purple haze, styles Yuumei and Krenz Cushart, UHD, HDR, upscale, 8K photo, concept art

+

Unicorns

+

positive: unicorn, lora:Unicorns:0.9, portrait, professional photography, 35mm, highly detailed, incredibly realistic, best quality, high quality, highres, purple, lora:mossbeast:0.3

+

negative: (two tails:1.2),FastNegativeV2,(bad-artist:1.0), (loli:1.2), (worst quality, low quality:1.4), (bad_prompt_version2:0.8), bad-hands-5,lowres, bad anatomy, bad hands, ((text)), (watermark), error, missing fingers, extra digit, fewer digits, cropped, worst quality, low quality, normal quality, ((username)), blurry, (extra limbs), bad-artist-anime, badhandv4, EasyNegative, ng_deepnegative_v1_75t, verybadimagenegative_v1.3, BadDream,(three hands:1.1),(three legs:1.1),(more than two hands:1.4),(more than two legs,:1.2),

+ +]]>
olivet-mens-group-james-2023https://pype.dev/olivet-mens-group-james-2023.htmlnicpayneolivetfaithhttps://pype.dev/olivet-mens-group-james-2023.htmlSat, 21 Jan 2023 06:06:31 GMTarchive-2023 + +

James

+

2023 study of the book of James

+

BP

+

The Guy

+

Greek: Iakobos (Jacob in English)

+

Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection

+

The book of James is the legacy of this Jacob's wisdom which was heavily influenced by two things:

+
    +
  1. Sermon on the Mount / Matthew 5-7
  2. +
  3. Proverbs - expecially chapters 1-9
  4. +
+

Summary

+

These are short challenging wisdom speeches full of metaphors and one-liners... Live in a wise way, submitting to Jesus

+

Chapters 2-5 teach about wholehearted devotion to Jesus - there are 12 teachings total

+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
sectionsummarysource
2:1-13favoritism vs love(Matthew 5:46-48)
2:14-26genuine faith(Matthew 7:21-27)
teaching about words
3:1-12the tongue(Luke 6:43-45)
4:11-12 fm condeming others(matthew 12:36-37)
5:12telling the truth(Matthew 5:37)
wealth
4:13-17arrogance of wealth(Matthew 6:28-34)
5:1-6danger of wealth(Matthew 6:19-21)
5:7-11peace and endurance(Matthew 24:13)
5:13-18faith-filled prayer(Mathew 21:21-22)
+
+

Other 4 are in the poster about James on BP

+
+

Chapter 1 the introduction

+

2-4: life's trials produce endurance and can make us perfect and complete

+

perect is repeated 7 times in the book - it refers to "wholeness" and integrity.

+

We are all fractrued and inconsistent people

+

perfect: Hebrew: Tamim, Greek: Teleios

+

5-8: God gives wisdom to those who ask in faith

+

9-11: povety can force us tot rust on God alone; wealth will pass away

+

12-18: God is generous and gives us new birth through Jesus

+

19-27: Don't just listen to God's word but do it. It's the Torah of Freedom

+
    +
  • speak with love
  • +
  • serve the poor
  • +
  • be wholly devoted to God
  • +
+

Jan 21

+

!!! scripture "James 1:1"

+
James, a servant of God and of the Lord Jesus Christ, To the twelve tribes in the Dispersion: Greetings.
+
+

Dispersion: διασπορά - same word used by Peter to describe Jesus-followers as exiles

+

!!! scripture "James 1:2-11"

+
2 Count it all joy, my brothers, when you meet trials of various kinds,
+3 for you know that the testing of your faith produces steadfastness. 4 And
+let steadfastness have its full effect, that you may be perfect and
+complete, lacking in nothing.  5 If any of you lacks wisdom, let him ask
+God, who gives generously to all without reproach, and it will be given
+him. 6 But let him ask in faith, with no doubting, for the one who doubts
+is like a wave of the sea that is driven and tossed by the wind. 7 For that
+person must not suppose that he will receive anything from the Lord; 8 he
+is a double-minded man, unstable in all his ways.  9 Let the lowly brother
+boast in his exaltation, 10 and the rich in his humiliation, because like a
+flower of the grass he will pass away. 11 For the sun rises with its
+scorching heat and withers the grass; its flower falls, and its beauty
+perishes. So also will the rich man fade away in the midst of his pursuits.
+
+

July 15

+
+

Missed several meetings due to unfortunate travel circumstances

+
+

!!! scripture "James 3:13-18"

+
13 Who is wise and understanding among you? By his good conduct let him
+show his works in the meekness of wisdom. 14 But if you have bitter jealousy
+and selfish ambition in your hearts, do not boast and be false to the truth.
+15 This is not the wisdom that comes down from above, but is earthly,
+unspiritual, demonic. 16 For where jealousy and selfish ambition exist, there
+will be disorder and every vile practice. 17 But the wisdom from above is first
+pure, then peaceable, gentle, open to reason, full of mercy and good fruits,
+impartial and sincere. 18 And a harvest of righteousness is sown in peace by
+those who make peace.
+
+The Holy Bible: English Standard Version (Jas 3:13–18). (2016). Crossway
+Bibles.
+
+

December 16

+

!!! scripture "James 5:13-20"

+
13 Is anyone among you suffering misfortune? He should pray. Is anyone
+cheerful? He should sing praise. 14 Is anyone among you sick? He should
+summon the elders of the church and they should pray over him, anointing
+him with olive oil in the name of the Lord. 15 And the prayer of faith will
+save the one who is sick, and the Lord will raise him up, and if he has
+committed sins ⌊he will be forgiven⌋. 16 Therefore confess your sins to one
+another, and pray for one another, so that you may be healed. The effective
+prayer of a righteous person accomplishes much. 17 Elijah was a human being
+with the same nature as us, and ⌊he prayed fervently⌋ for it not to rain,
+and it did not rain on the land for three years and six months. 18 And he
+prayed again, and the sky gave rain and the earth produced its fruit.
+19 My brothers, if anyone among you should wander away from the truth and
+someone turns him back, 20 he should know that the one who turns a sinner
+back from the error of his way will save that person’s soul from death, and
+will cover over a great number of sins.
+
+

When to pray

+
    +
  1. All circumstances of life
  2. +
  3. Sickness
  4. +
  5. Confession
  6. +
  7. Working out the will of God
  8. +
  9. Retrieving wandering souls
  10. +
+

James ends his letter with prayer because it's an exhortation of the Disapora +and a life of faith must revolve around prayer

+

For myself I think I pray in all circumstances, sickness, confession all ok. I +do not pray for long periods of time, and don't feel very disiplined, but +whenever anything happens, by the Lord's grace I am quick to turn my +attention to Jesus, and hopefully turn the attention of my wife/kids to Jesus +as well. Example: a person collapsed at the water park we went to this last +weekend, Athalia and I were close-ish to that happening, so I told her we +needed to stop what we were doing and pray that Jesus would intervene.

+

I confess sin to Jesus but I'm not sure what that should look like. I've +taken a Brother Lawrence approach to try and quickly confess and move on, +accepting grace, but I struggle with intentional sinning in this area... What +is prayer if I knew what I was doing was wrong?

+

I am not more inclined to pray for suffering, but I think that's because I've +very consciously been trying to pray in good circumstances more often because +when we only pray in suffering that turns prayer into a Santa's wish list +situation I think... yes we need the Lord in suffering, but we display our need +for him NOT only in suffering, and if that is true then it begs the question, +to me anyways, of whether or not the need is truly there

+

JC Ryle's quote

+

I disagree with the dude's quote about the requirement of prayer, but only +because the message is given in a direction that makes prayer look like +something I have to do to get/keep/maintain my salvation... Yahweh changes his +children's hearts and orients them towards him through prayer - if someone +doesn't then I think that just means Yahweh has not worked or has not chosen +them, but them calling themselves a Christian is irrelevant, and no amount of +forcing themselves to pray will change Yahweh's will.

+

!!! scripture "Isaiah 1:6"

+
From the sole of the foot and up to the head
+there is no health in it;
+bruise and sore and bleeding wound have not been cleansed,
+and they have not been bound up
+and not softened with the oil.
+
+

!!! scripture "Psalm 23:5"

+
5 You prepare before me a table
+in the presence of my oppressors.
+You anoint my head with oil;
+my cup is overflowing.
+
+

!!! scripture "1 Kings 17:1-16"

+
17 Elijah the Tishbite from Tishbe of Gilead said to Ahab, “⌊As Yahweh
+lives⌋, the God of Israel before whom I stand, there shall surely not be
+dew nor rain these years ⌊except by my command⌋.” 2 Then the word of Yahweh
+came to him, saying, 3 “Go from this place and turn to the east; you must
+hide yourself in the Wadi Kerith ⌊which faces the Jordan⌋. 4 It shall be
+that you shall drink from the wadi, and I have commanded the crows to
+sustain you there.” 5 So he went and did according to the word of Yahweh.
+He went and stayed in the Wadi Kerith ⌊which faces the Jordan⌋. 6 The crows
+were bringing bread and meat in the morning for him and bread and meat in
+the evening, and he drank from the wadi. 7 It happened ⌊after a while⌋ that
+the wadi dried up, because there was no rain in the land.
+
+8 Then the
+word of Yahweh came to him, saying, 9 “Get up and go to Zarephath which
+belongs to Sidon and stay there. Look, I have commanded a woman there, a
+widow, to sustain you.” 10 So he arose and went to Zarephath and came to
+the gate of the city. There was a widow woman gathering wood, so he called
+to her, and he said, “Please bring a little water for me in a vessel so
+that I can drink.” 11 She went to fetch it, and he called to her and said,
+“Please bring me a morsel of bread in your hand.” 12 She said, “⌊As Yahweh
+your God lives⌋, surely I do not have a cake, ⌊but only a handful of flour⌋
+in the jar and a little olive oil in the jug. Here I am gathering a few
+pieces of wood, and I will go and prepare it for me and my son, that we
+might eat it and die.” 13 Elijah said to her, “Don’t be afraid. Go and do
+according to your word; only make for me a small bread cake from it first,
+and bring it out to me. Make it for yourself and for your son afterward.
+14 For thus says Yahweh, the God of Israel: ‘The jar of flour will not be
+emptied and the jug of olive oil will not run out until the day Yahweh
+gives rain on the surface of the earth.’ ” 15 So she went and did according
+to the word of Elijah; then both she and he ate with her household for many
+days. 16 The jar of flour was not emptied and the jug of olive oil did not
+run out, according to the word of Yahweh which he spoke by the hand of
+Elijah.
+
+ +]]>
FFMPEG 10-bit videos to 8-bithttps://pype.dev/ffmpeg-10-bit-videos-to-8-bit.htmlnicpayneclihomelabtechhttps://pype.dev/ffmpeg-10-bit-videos-to-8-bit.htmlMon, 16 Jan 2023 13:15:53 GMTarchive-2023 +

ffmpeg -i input.mp4 -map 0 -c:v libx264 -vf format=yuv420p -c:a copy output.mp4

+ +]]>
i3-Like keyboard mapping in Pop_OShttps://pype.dev/i3-like-keyboard-mapping-in-pop-os.htmlnicpaynelinuxlinuxtechhttps://pype.dev/i3-like-keyboard-mapping-in-pop-os.htmlThu, 12 Jan 2023 05:51:25 GMTarchive-2023 +

I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least navigate workspaces how I'm used to doing (cause I set +workspace 3 for communication apps, 1 for my terminal, etc...)

+

Here's how I set keybindings for:

+
    +
  • <Super> + <number> sends me to that numbered workspace
  • +
  • <Shift> + <Super> + <number> moves the window I'm focused on to workspace number
  • +
+
#!/bin/bash
+gsettings set org.gnome.mutter dynamic-workspaces false 
+gsettings set org.gnome.desktop.wm.preferences num-workspaces 8 
+gsettings set org.gnome.shell.keybindings switch-to-application-1 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-2 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-3 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-4 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-5 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-6 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-7 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-8 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-9 [] 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-1 "['<Super>1']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-2 "['<Super>2']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-3 "['<Super>3']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-4 "['<Super>4']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-5 "['<Super>5']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-6 "['<Super>6']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-7 "['<Super>7']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-8 "['<Super>8']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-9 "['<Super>9']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-10 "['<Super>0']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-1 "['<Super><Shift>1']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-2 "['<Super><Shift>2']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-3 "['<Super><Shift>3']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-4 "['<Super><Shift>4']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-5 "['<Super><Shift>5']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-6 "['<Super><Shift>6']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-7 "['<Super><Shift>7']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-8 "['<Super><Shift>8']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-9 "['<Super><Shift>9']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-10 "['<Super><Shift>0']"
+
+ +]]>
Use non-standard named ssh keys with githubhttps://pype.dev/use-non-standard-named-ssh-keys-with-github.htmlnicpaynelinuxclitechhttps://pype.dev/use-non-standard-named-ssh-keys-with-github.htmlTue, 03 Jan 2023 08:34:50 GMTarchive-2023 +

I was getting (publickey denied) when trying to push to GH using ssh. When I +tested the connection I saw that a bunch of keys in ``~/.ssh/ were being +attempted

+
✗ ssh git@github.com -vv
+
+...
+
+debug1: Will attempt key: /home/nic/.ssh/id_rsa 
+debug1: Will attempt key: /home/nic/.ssh/id_ecdsa 
+debug1: Will attempt key: /home/nic/.ssh/id_ecdsa_sk 
+debug1: Will attempt key: /home/nic/.ssh/id_ed25519 
+debug1: Will attempt key: /home/nic/.ssh/id_ed25519_sk 
+debug1: Will attempt key: /home/nic/.ssh/id_xmss 
+debug1: Will attempt key: /home/nic/.ssh/id_dsa 
+
+...
+
+debug1: No more authentication methods to try.
+git@github.com: Permission denied (publickey).
+
+
+

None of those were the key I setup with GH. So I added an entry +into ~/.ssh/config:

+
Host
+github.com
+User git
+Port 22
+Hostname github.com
+IdentityFile ~/.ssh/my_custom_github_key
+TCPKeepAlive yes
+IdentitiesOnly yes 
+
+
+ +]]>
\ No newline at end of file diff --git a/archive-2024-1.html b/archive-2024-1.html new file mode 100644 index 00000000..049c1b11 --- /dev/null +++ b/archive-2024-1.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2024' - 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2024' - 1
+
+ + + + + +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2024-2.html b/archive-2024-2.html new file mode 100644 index 00000000..fcc5a0d2 --- /dev/null +++ b/archive-2024-2.html @@ -0,0 +1,430 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2024' - 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2024' - 2
+
+ + + + + +
+
+
+ +

+ + +I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted... + +PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least ... + read more → +

+ +
+ + + + + + + + +
+ +

+ + +To customize k9s use the skins from catppuccin or the ones k9s supplies +OUT="${XDG_CONFIG_HOME:-$HOME/.config}/k9s/skins" +mkdir -p "$OUT" +curl -L https://github.com/catppuccin/k9s/archive/main.tar.gz | tar xz -C "$OUT" ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2024-3.html b/archive-2024-3.html new file mode 100644 index 00000000..2792ef1f --- /dev/null +++ b/archive-2024-3.html @@ -0,0 +1,299 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2024' - 3 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2024' - 3
+
+ + + + + +
+
+ +
+ +

+ + +I started deploying a website to Cloudflare on a branch called pages. Similar to one of the GH Pages deployment patterns. But when my CI was pushing the branch I couldn't see it locally... +git fetch -a wasn't pulling any new branches, and git branch ... + read more → +

+ +
+ +
+ +

+ + +Video +Sermon on the Mount +3 chapters filled with phrases that are very well-known in our culture +Phrases + +Love your neighbor as yourself +Do to others what you would have them do to you +You are the salt of the earth +You can’t serve both God and money ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2024.html b/archive-2024.html new file mode 100644 index 00000000..e80385e4 --- /dev/null +++ b/archive-2024.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Posts from '2024' | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Posts from '2024'
+
+ + + + + +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/archive-2024.json b/archive-2024.json new file mode 100644 index 00000000..f43df902 --- /dev/null +++ b/archive-2024.json @@ -0,0 +1,325 @@ +{ + "version": "https://jsonfeed.org/version/1", + "title": "Pype.dev", + "home_page_url": "https://pype.dev", + "feed_url": "https://pype.dev/archive-2024.json", + "description": "my mental data-lake", + "items": [ + { + "id": "https://pype.dev/advent-2024-peace.html", + "url": "https://pype.dev/advent-2024-peace.html", + "title": "Advent 2024 - Peace", + "content_html": "\n

Scripture

\n

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

\n

Edification

\n

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

\n

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

\n

You all know we messed that up, Shalom was broken and humanity was exiled.

\n

But we have a Great Healer.

\n

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

\n

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

\n

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

\n

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

\n

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

\n

Finally I pray we may all be given, and accept, the conviction of Paul -

\n

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

\n

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

\n\n", + "summary": "", + "date_published": "2024-12-06T15:26:15-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "url": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "title": "hostnamectl to easily change hostname", + "content_html": "\n

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

\n
\n❯ hostnamectl --help\nhostnamectl [OPTIONS...] COMMAND ...\n\nQuery or change system hostname.\n\nCommands:\n  status                 Show current hostname settings\n  hostname [NAME]        Get/set system hostname\n  icon-name [NAME]       Get/set icon name for host\n  chassis [NAME]         Get/set chassis type for host\n  deployment [NAME]      Get/set deployment environment for host\n  location [NAME]        Get/set location for host\n\nOptions:\n  -h --help              Show this help\n     --version           Show package version\n     --no-ask-password   Do not prompt for password\n  -H --host=[USER@]HOST  Operate on remote host\n  -M --machine=CONTAINER Operate on local container\n     --transient         Only set transient hostname\n     --static            Only set static hostname\n     --pretty            Only set pretty hostname\n     --json=pretty|short|off\n                         Generate JSON output\n\nSee the hostnamectl(1) man page for details.\n
\n

I learned there's transient and static hostnames, so that's cool...

\n

The thing I needed was hostnamectl --static hostname babyblue-aurora

\n

pretty sweet tool

\n\n", + "summary": "", + "date_published": "2024-12-06T07:25:59-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/how-to-survive-the-flood.html", + "url": "https://pype.dev/how-to-survive-the-flood.html", + "title": "How To Survive The Flood", + "content_html": "\n

There a lot of flood stories throughout the history of the world, and the Bible\nis no different in this regard. God warns Noah of a de-creation event, whereby\nhe'll start over with humanity via Noah and his family. Noah survives the flood\nby abiding in Yahweh and staying close to the One who loves him.

\n
\n

Note this reflection doesn't address AT ALL if the flood narrative is a\n"real" historical event, whether it's a global or local event, or anything\nlike that - regardless of those points the Biblical authors used this type of\nimagery of chaos waters to communicate themes of judgement and wrath.

\n
\n

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images\nof the chaos waters (the winds and the rains). His instruction is that the wise\nman who built his house on the rock will survive, but the foolish man builds\nhis house on the sand and the winds and the rains destroyed it.

\n

Somewhat obviously this is metaphorical for basing your life on wisdom or\nfolly. The wisdom is Jesus' teaching which is all based on Yahweh's love for\nhumanity and his desire to partner with humanity for the good of the whole\nearth.

\n

The simple take-away is for us to survive the winds and the rain, and to say it\nmore fully - to survive de-creation and destruction, we must live our lives in\na way that revolves around Jesus, the perfect human. He calls us to a greater\nhumanity, an unbroken humanity, which is unachievable apart from him (just look\naround if you doubt this truth).

\n

It's important to notice though that abiding in the Lord, basing your life on\nthe rock, doesn't spare you from the wind and the rain. Trials come, life gets\nhard, shit hits the fan. The last few weeks for me haven't been my favorite and\nI've certainly experienced turmoil in my life but frankly Jesus makes those\nthings bearable... in a way I can't put enough words to I'll just be reminded of\nPaul in Romans 8...

\n
worthy to be compared with the glory that is to be revealed to us.” Our present\ntrials are not on an equal scale with the glory of heaven ```\n\nBy God's grace he's molded my heart to be nearly incapable of separating the\nLove God has for me from any trial I face - it's not a magic answer or silver\nbullet to fixing those problems, and it doesn't make them go away, but I know\nthe sufferings here aren't even worth comparing to the glory of the Lord. Amen.\n\n<!-- Content Injected to every content markdown footer -->\n\n[github]: https://github.com/rochacbruno/marmite\n
\n", + "summary": "", + "date_published": "2024-12-04T05:52:44-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/welcome.html", + "url": "https://pype.dev/welcome.html", + "title": "Welcome to Marmite", + "content_html": "\n

This is your first post!

\n

Edit this content

\n

edit on content/{date}-welcome.md

\n

Add more content

\n

create new markdown files in the content folder

\n

use marmite --new to create new content

\n

Customize your site

\n

edit marmite.yaml to change site settings

\n

edit the files starting with _ in the content folder to change the layout

\n

or edit the templates to create a custom layout

\n

Deploy your site

\n

read more on marmite documentation

\n\n", + "summary": "", + "date_published": "2024-12-04T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [], + "language": "en" + }, + { + "id": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "url": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "title": "Stylus for custom webpage themes", + "content_html": "\n

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

\n

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

\n

TODO: image

\n\n", + "summary": "", + "date_published": "2024-11-27T06:07:39-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/the-two-houses.html", + "url": "https://pype.dev/the-two-houses.html", + "title": "The Two Houses", + "content_html": "\n

Context

\n
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.\n\nThe Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.\n
\n

Reflection

\n

From the visual commentary Tim calls out a few things:

\n
    \n
  1. \n

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    \n
  2. \n
  3. \n

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    \n
  4. \n
\n\n", + "summary": "", + "date_published": "2024-11-27T05:40:24-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "url": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "title": "DNS Broke After Reboot - Ubuntu 22.04", + "content_html": "\n

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

\n

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

\n

sudo mkdir /etc/systemd/resolved.conf.d/\nsudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

\n

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

\n
[Resolve]\nDNS=8.8.8.8 1.1.1.1\n
\n

But I decided to use tailscale

\n
[Resolve]\nDNS=100.100.100.100\n
\n

Then restart systemd-resolved

\n

sudo systemctl restart systemd-resolved

\n\n", + "summary": "", + "date_published": "2024-11-22T08:08:40-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/restart-kde-plasma.html", + "url": "https://pype.dev/restart-kde-plasma.html", + "title": "Restart KDE Plasma", + "content_html": "\n

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

\n
\nsudo killall plasmashell\n\nkstart plasmashell\n\n
\n\n", + "summary": "", + "date_published": "2024-11-08T15:53:52-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/opnsense-bootstrap-recovery.html", + "url": "https://pype.dev/opnsense-bootstrap-recovery.html", + "title": "OPNSense Bootstrap Recovery", + "content_html": "\n

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

\n\n", + "summary": "", + "date_published": "2024-11-07T08:40:19-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "infrastructure", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/bp-the-golden-rule.html", + "url": "https://pype.dev/bp-the-golden-rule.html", + "title": "BP - The Golden Rule", + "content_html": "\n

Matthew 7:12

\n
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets\n
\n

What do I desire that people "do to [me]"?

\n
    \n
  1. Help if I need it - I want to live in a world where humans are helpful
  2. \n
  3. Listen to me and understand what I say
  4. \n
  5. Leave me alone sometimes
  6. \n
\n

What is the Torah and Prophets?

\n

I know there's a lot more to where the texts come from and the varying\ntraditions in Judaism. But I think at a very high level, Jesus is saying that\nwe all know, deep down, how to live in harmony but that it requires sacrifice.\nHe calls us to live sacrificially towards each other, to live in Heaven\ntoday, so we can experience the coming reality if our own resurrection

\n\n", + "summary": "", + "date_published": "2024-11-06T05:54:32-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/recovering-opnsense.html", + "url": "https://pype.dev/recovering-opnsense.html", + "title": "Recovering OPNSense", + "content_html": "\n

I woke up to faulty internet and after some troubleshooting it turns out the\nroot zfs dataset that OPNSense boots from got corrupted...

\n
\n

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or\nnextcloud... But if you won't then at least back up your OPNSense config\nsomewhere everytime you update it.

\n
\n

It's too much to recount every issue, so here's a bullet list what worked.

\n
    \n
  1. On a fresh drive install OPNSense
  2. \n
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would\nhappen if you plugged it in along with the new drive and then booted up.\nBecause both drives will have a zfs pool zroot and the boot dataset is\nautomounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it\ndidn't automount
  4. \n
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO:\nzpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. \n
\n
\n

-d is the zfs flag to import the pool by disk id, -N it to not mount any of\nthe datasets (we need to change mountpoints) and the zroot zrootrecovery\nimports the zroot pool with a new name

\n
\n
    \n
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere\nlike /mnt/zrootrecovery
  2. \n
  3. Depending on the mount point you set you'll find a config directory around\n/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another\nmachine via scp or whatever
  4. \n
  5. Go to OPNSense webui and recover from that config!
  6. \n
\n

All in all this process took me around 8 hours but I did run into about ever\nissue under the sun (several bad disks in the mix, a laptop that wouldn't live\nboot into a BSD system, etc.)

\n\n", + "summary": "", + "date_published": "2024-11-06T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "blog", + "homelab" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "title": "Reflection - Wisdom in Relationships 2", + "content_html": "\n

Passage

\n
Why do you see the speck in the eye of your brother, but you don't perceive the\nbeam in your own eye?\n\nOr how can you say to your brother, "Allow me to take out the speck from your\neye," and look, the beam is in your eye!\n\nHypocrite! First take out the beam from your eye, and then you can see clearly\nthe speck in the eye of your brother.\n
\n
Ask and it will be given to you. Seek and you will find. Knock and it will be\nhopend to you. For the one who asks will receive, and the one who seeks will\nfind. And to the one who knocks it will be opened. For what person is among\nyou, who when their son asks for break, will give him a rock? Or when he asks\nfor a fish will give him a snake? So then fi you all are bad, but you know how\nto give good gifts to your children, how much more will your Father in the\nskies give good things to those who ask.\n
\n

Reflection

\n

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon\non the Mount. We aren't just to ask for anything that we think is good...\nwisdom is the good we are to ask for.

\n

Tim: Prayer is important because wisdom will flow out of a deep interpersonal\nrelationship with God.

\n

Where has God given me wisdom?

\n
    \n
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. \n
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. \n
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. \n
\n\n", + "summary": "", + "date_published": "2024-10-14T06:07:33-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships.html", + "title": "Reflection - Wisdom in Relationships", + "content_html": "\n

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

\n

The passage is Matthew 7:1-2

\n
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.\n\nAnd with the measure that you measure, it will be measured to you.\n
\n

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

\n

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

\n

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

\n\n", + "summary": "", + "date_published": "2024-10-12T05:40:11-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-remote-add.html", + "url": "https://pype.dev/docker-remote-add.html", + "title": "docker-remote-add", + "content_html": "\n

Add from url??

\n

ADD http://example.com/cars.csv /tmp/cars.csv

\n

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

\n

ADD myapp.tar.gz /opt/myapp/

\n\n", + "summary": "", + "date_published": "2024-09-17T06:19:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-copy-and-chown.html", + "url": "https://pype.dev/docker-copy-and-chown.html", + "title": "Docker copy and chown", + "content_html": "\n

COPY --chown=myuser:mygroup source-file target-file

\n\n", + "summary": "", + "date_published": "2024-09-17T06:18:09-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "homelab", + "tech" + ], + "language": "en" + } + ] +} \ No newline at end of file diff --git a/archive-2024.rss b/archive-2024.rss new file mode 100644 index 00000000..ca10f32c --- /dev/null +++ b/archive-2024.rss @@ -0,0 +1,263 @@ +Pype.devhttps://pype.devmy mental data-lakeFri, 06 Dec 2024 15:26:15 GMTFri, 06 Dec 2024 21:33:02 GMTmarmiteAdvent 2024 - Peacehttps://pype.dev/advent-2024-peace.htmlnicpaynefaithhttps://pype.dev/advent-2024-peace.htmlFri, 06 Dec 2024 15:26:15 GMTarchive-2024 +

Scripture

+

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

+

Edification

+

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

+

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

+

You all know we messed that up, Shalom was broken and humanity was exiled.

+

But we have a Great Healer.

+

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

+

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

+

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

+

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

+

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

+

Finally I pray we may all be given, and accept, the conviction of Paul -

+

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

+

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

+ +]]>
hostnamectl to easily change hostnamehttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlnicpaynelinuxterminaltechhttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlFri, 06 Dec 2024 07:25:59 GMTarchive-2024 +

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

+

+❯ hostnamectl --help
+hostnamectl [OPTIONS...] COMMAND ...
+
+Query or change system hostname.
+
+Commands:
+  status                 Show current hostname settings
+  hostname [NAME]        Get/set system hostname
+  icon-name [NAME]       Get/set icon name for host
+  chassis [NAME]         Get/set chassis type for host
+  deployment [NAME]      Get/set deployment environment for host
+  location [NAME]        Get/set location for host
+
+Options:
+  -h --help              Show this help
+     --version           Show package version
+     --no-ask-password   Do not prompt for password
+  -H --host=[USER@]HOST  Operate on remote host
+  -M --machine=CONTAINER Operate on local container
+     --transient         Only set transient hostname
+     --static            Only set static hostname
+     --pretty            Only set pretty hostname
+     --json=pretty|short|off
+                         Generate JSON output
+
+See the hostnamectl(1) man page for details.
+
+

I learned there's transient and static hostnames, so that's cool...

+

The thing I needed was hostnamectl --static hostname babyblue-aurora

+

pretty sweet tool

+ +]]>
How To Survive The Floodhttps://pype.dev/how-to-survive-the-flood.htmlnicpaynebible-projectfaithhttps://pype.dev/how-to-survive-the-flood.htmlWed, 04 Dec 2024 05:52:44 GMTarchive-2024 +

There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding in Yahweh and staying close to the One who loves him.

+
+

Note this reflection doesn't address AT ALL if the flood narrative is a +"real" historical event, whether it's a global or local event, or anything +like that - regardless of those points the Biblical authors used this type of +imagery of chaos waters to communicate themes of judgement and wrath.

+
+

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images +of the chaos waters (the winds and the rains). His instruction is that the wise +man who built his house on the rock will survive, but the foolish man builds +his house on the sand and the winds and the rains destroyed it.

+

Somewhat obviously this is metaphorical for basing your life on wisdom or +folly. The wisdom is Jesus' teaching which is all based on Yahweh's love for +humanity and his desire to partner with humanity for the good of the whole +earth.

+

The simple take-away is for us to survive the winds and the rain, and to say it +more fully - to survive de-creation and destruction, we must live our lives in +a way that revolves around Jesus, the perfect human. He calls us to a greater +humanity, an unbroken humanity, which is unachievable apart from him (just look +around if you doubt this truth).

+

It's important to notice though that abiding in the Lord, basing your life on +the rock, doesn't spare you from the wind and the rain. Trials come, life gets +hard, shit hits the fan. The last few weeks for me haven't been my favorite and +I've certainly experienced turmoil in my life but frankly Jesus makes those +things bearable... in a way I can't put enough words to I'll just be reminded of +Paul in Romans 8...

+
worthy to be compared with the glory that is to be revealed to us.” Our present
+trials are not on an equal scale with the glory of heaven ```
+
+By God's grace he's molded my heart to be nearly incapable of separating the
+Love God has for me from any trial I face - it's not a magic answer or silver
+bullet to fixing those problems, and it doesn't make them go away, but I know
+the sufferings here aren't even worth comparing to the glory of the Lord. Amen.
+
+<!-- Content Injected to every content markdown footer -->
+
+[github]: https://github.com/rochacbruno/marmite
+
+]]>
Welcome to Marmitehttps://pype.dev/welcome.htmlnicpaynehttps://pype.dev/welcome.htmlWed, 04 Dec 2024 00:00:00 GMTarchive-2024 +

This is your first post!

+

Edit this content

+

edit on content/{date}-welcome.md

+

Add more content

+

create new markdown files in the content folder

+

use marmite --new to create new content

+

Customize your site

+

edit marmite.yaml to change site settings

+

edit the files starting with _ in the content folder to change the layout

+

or edit the templates to create a custom layout

+

Deploy your site

+

read more on marmite documentation

+ +]]>
Stylus for custom webpage themeshttps://pype.dev/stylus-for-custom-webpage-themes.htmlnicpaynetechhttps://pype.dev/stylus-for-custom-webpage-themes.htmlWed, 27 Nov 2024 06:07:39 GMTarchive-2024 +

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

+

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

+

TODO: image

+ +]]>
The Two Houseshttps://pype.dev/the-two-houses.htmlnicpaynebible-projectfaithhttps://pype.dev/the-two-houses.htmlWed, 27 Nov 2024 05:40:24 GMTarchive-2024 +

Context

+
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.
+
+The Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.
+
+

Reflection

+

From the visual commentary Tim calls out a few things:

+
    +
  1. +

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    +
  2. +
  3. +

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    +
  4. +
+ +]]>
DNS Broke After Reboot - Ubuntu 22.04https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlnicpaynehomelablinuxtechhttps://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlFri, 22 Nov 2024 08:08:40 GMTarchive-2024 +

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

+

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

+

sudo mkdir /etc/systemd/resolved.conf.d/ +sudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

+

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

+
[Resolve]
+DNS=8.8.8.8 1.1.1.1
+
+

But I decided to use tailscale

+
[Resolve]
+DNS=100.100.100.100
+
+

Then restart systemd-resolved

+

sudo systemctl restart systemd-resolved

+ +]]>
Restart KDE Plasmahttps://pype.dev/restart-kde-plasma.htmlnicpaynelinuxterminaltechhttps://pype.dev/restart-kde-plasma.htmlFri, 08 Nov 2024 15:53:52 GMTarchive-2024 +

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

+

+sudo killall plasmashell
+
+kstart plasmashell
+
+
+ +]]>
OPNSense Bootstrap Recoveryhttps://pype.dev/opnsense-bootstrap-recovery.htmlnicpayneinfrastructurehomelabtechhttps://pype.dev/opnsense-bootstrap-recovery.htmlThu, 07 Nov 2024 08:40:19 GMTarchive-2024 +

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

+ +]]>
BP - The Golden Rulehttps://pype.dev/bp-the-golden-rule.htmlnicpaynebible-projectfaithhttps://pype.dev/bp-the-golden-rule.htmlWed, 06 Nov 2024 05:54:32 GMTarchive-2024 +

Matthew 7:12

+
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets
+
+

What do I desire that people "do to [me]"?

+
    +
  1. Help if I need it - I want to live in a world where humans are helpful
  2. +
  3. Listen to me and understand what I say
  4. +
  5. Leave me alone sometimes
  6. +
+

What is the Torah and Prophets?

+

I know there's a lot more to where the texts come from and the varying +traditions in Judaism. But I think at a very high level, Jesus is saying that +we all know, deep down, how to live in harmony but that it requires sacrifice. +He calls us to live sacrificially towards each other, to live in Heaven +today, so we can experience the coming reality if our own resurrection

+ +]]>
Recovering OPNSensehttps://pype.dev/recovering-opnsense.htmlnicpaynebloghomelabhttps://pype.dev/recovering-opnsense.htmlWed, 06 Nov 2024 00:00:00 GMTarchive-2024 +

I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted...

+
+

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least back up your OPNSense config +somewhere everytime you update it.

+
+

It's too much to recount every issue, so here's a bullet list what worked.

+
    +
  1. On a fresh drive install OPNSense
  2. +
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would +happen if you plugged it in along with the new drive and then booted up. +Because both drives will have a zfs pool zroot and the boot dataset is +automounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it +didn't automount
  4. +
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO: +zpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. +
+
+

-d is the zfs flag to import the pool by disk id, -N it to not mount any of +the datasets (we need to change mountpoints) and the zroot zrootrecovery +imports the zroot pool with a new name

+
+
    +
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere +like /mnt/zrootrecovery
  2. +
  3. Depending on the mount point you set you'll find a config directory around +/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another +machine via scp or whatever
  4. +
  5. Go to OPNSense webui and recover from that config!
  6. +
+

All in all this process took me around 8 hours but I did run into about ever +issue under the sun (several bad disks in the mix, a laptop that wouldn't live +boot into a BSD system, etc.)

+ +]]>
Reflection - Wisdom in Relationships 2https://pype.dev/reflection-wisdom-in-relationships-2.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships-2.htmlMon, 14 Oct 2024 06:07:33 GMTarchive-2024 +

Passage

+
Why do you see the speck in the eye of your brother, but you don't perceive the
+beam in your own eye?
+
+Or how can you say to your brother, "Allow me to take out the speck from your
+eye," and look, the beam is in your eye!
+
+Hypocrite! First take out the beam from your eye, and then you can see clearly
+the speck in the eye of your brother.
+
+
Ask and it will be given to you. Seek and you will find. Knock and it will be
+hopend to you. For the one who asks will receive, and the one who seeks will
+find. And to the one who knocks it will be opened. For what person is among
+you, who when their son asks for break, will give him a rock? Or when he asks
+for a fish will give him a snake? So then fi you all are bad, but you know how
+to give good gifts to your children, how much more will your Father in the
+skies give good things to those who ask.
+
+

Reflection

+

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon +on the Mount. We aren't just to ask for anything that we think is good... +wisdom is the good we are to ask for.

+

Tim: Prayer is important because wisdom will flow out of a deep interpersonal +relationship with God.

+

Where has God given me wisdom?

+
    +
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. +
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. +
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. +
+ +]]>
Reflection - Wisdom in Relationshipshttps://pype.dev/reflection-wisdom-in-relationships.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships.htmlSat, 12 Oct 2024 05:40:11 GMTarchive-2024 +

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

+

The passage is Matthew 7:1-2

+
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.
+
+And with the measure that you measure, it will be measured to you.
+
+

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

+

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

+

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

+ +]]>
docker-remote-addhttps://pype.dev/docker-remote-add.htmlnicpaynehomelablinuxtechhttps://pype.dev/docker-remote-add.htmlTue, 17 Sep 2024 06:19:00 GMTarchive-2024 +

Add from url??

+

ADD http://example.com/cars.csv /tmp/cars.csv

+

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

+

ADD myapp.tar.gz /opt/myapp/

+ +]]>
Docker copy and chownhttps://pype.dev/docker-copy-and-chown.htmlnicpaynelinuxhomelabtechhttps://pype.dev/docker-copy-and-chown.htmlTue, 17 Sep 2024 06:18:09 GMTarchive-2024 +

COPY --chown=myuser:mygroup source-file target-file

+ +]]>
\ No newline at end of file diff --git a/archive.html b/archive.html new file mode 100644 index 00000000..004b70ed --- /dev/null +++ b/archive.html @@ -0,0 +1,266 @@ + + + + + + + + + + + + + + + + + + + + Archive | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ +
+
Archive
+
+
+
+ 2024 24 + +
+ 2023 11 + +
+ 2022 164 + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/arr-client-config.html b/arr-client-config.html new file mode 100644 index 00000000..5caab269 --- /dev/null +++ b/arr-client-config.html @@ -0,0 +1,343 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + arr client config | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

arr client config

+ + + + + +
+ + + +
+

TIL that when setting up download clients for +radarr/sonarr/lidarr/readarr/bazarr/prowlarr that you can utilize internal DNS +and instead of hardcoding an IP address of your download client server, can use +just the CNAME record (ie. instead of 172.10.14.13 I can use +transmission.mydomain.com... notice the lact of http(s)://... adding that won't +allow the connection to work/

+

Furthermore, you can use internal DNS to lookup the domain, not the subdomain, +and expose the port, like mydomain.com:7878 for sonarr. This was simpler to +maintain because I don't change which ports an application exposes or utilizes +hardly ever, plus I don't need to maintain CNAME records for every service!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/author-nicpayne-1.html b/author-nicpayne-1.html new file mode 100644 index 00000000..371dd830 --- /dev/null +++ b/author-nicpayne-1.html @@ -0,0 +1,456 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-10.html b/author-nicpayne-10.html new file mode 100644 index 00000000..06dba4ac --- /dev/null +++ b/author-nicpayne-10.html @@ -0,0 +1,447 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 10 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +TIL that when setting up download clients for +radarr/sonarr/lidarr/readarr/bazarr/prowlarr that you can utilize internal DNS +and instead of hardcoding an IP address of your download client server, can use +just the CNAME record (ie. instead of 172.10 ... + read more → +

+ +
+
+ +

+ + +I ran out of space on the SSD in my server when doing some file transfers but only 100GB was used of a 256 GB SSD? +LVM +When installing Ubuntu live server the default option for how to partition the +disk (in my experience) has been to setup an LVM gr ... + read more → +

+ +
+
+ +

+ + +When working with tdarr remote nodes, they need to have access not only to the +same libraries but also the same transcode cache as the server otherwise the +transcodes will fail... +Network Setup +To explain I'll give a brief overview of my home setup + ... + read more → +

+ +
+ + + + + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-11.html b/author-nicpayne-11.html new file mode 100644 index 00000000..3f24aee3 --- /dev/null +++ b/author-nicpayne-11.html @@ -0,0 +1,450 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 11 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+ + +
+ +

+ + +As I was cleaning up my NAS recently I noticed that I ran out of storage even +though my disk usage looked pretty low... turns out I was keeping a mega-ton of +ZFS snapshots and due to my own ignorance at the time didn't realize the +storage cost of th ... + read more → +

+ +
+ +
+ +

+ + +I started my homelab journey being super naive about ZFS and how to manage the +filesystem... that bit me in the butt when transfering a ton of files out of +folders and into datasets because ZFS is copy on write so I was essentially +duplicating my st ... + read more → +

+ +
+ +
+ +

+ + +I've had Plug 'hrsh7th/cmp-path' in my plugins for ever but didn't notice +until recently that I wasn't getting any filepath completion in vim! +Fuller setup instructions below the TLDR +TL;DR +Turns out I need to not be a dope and configure nvim-cmp to ... + read more → +

+ +
+
+ +

+ + +I just started using FastAPI for a home project and needed to pass back a +dynamic number of values from a form rendered with jinja... +Dynamic Values +The jinja templating for rendering HTML based on something like a python iterable is nice and easy + + ... + read more → +

+ +
+ +
+ +

+ + +If you use vim-plug for managing your vim plugins, do yourself a favor and snapshot your plugins before upgrading! +:PlugSnapshot creates a vim.snapshot file that you can use to restore your plugin versions with vim -S snapshot.vim +The snapshot file ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-12.html b/author-nicpayne-12.html new file mode 100644 index 00000000..5adad540 --- /dev/null +++ b/author-nicpayne-12.html @@ -0,0 +1,470 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 12 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+ +
+ +

+ + +TODO + +import os + +import boto3 +import pytest +from moto import mock_s3 + +MY_BUCKET = "bucket" +# BAD PREFIX +MY_PREFIX = "bucket/project/data/layer/dataset/" + + +@pytest.fixture(scope="function") +def aws_credentials(): + &qu ... + read more → +

+ +
+
+ +

+ + +I wrote up a little on exporting DataFrames to markdown and html here +But I've been playing with a web app for with lists and while I'm toying around I learned you can actually give your tables some style with some simple css classes! +To HTML +Remind ... + read more → +

+ +
+
+ +

+ + +Pandas +pandas.DataFrames are pretty sweet data structures in Python. +I do a lot of work with tabular data and one thing I have incorporated into some of that work is automatic data summary reports by throwing the first few, or several relevant, rows ... + read more → +

+ +
+
+ +

+ + +Amazon has crossed the line with me just one too many times now so we are looking to drop them like every other Big Tech provider.... +However, one key feature of Amazon that has been so useful for us is Lists... We can just maintain a list for each ... + read more → +

+ +
+
+
+

Git-bisect

+ +
+

+ + +I try to commit a lot, and I also try to write useful tests appropriate for the scope of work I'm focusing on, but sometimes I drop the ball... +Whether by laziness, ignorance, or accepted tech debt I don't always code perfectly and recently I was do ... + read more → +

+ +
+
+ +

+ + +TL;DR +pandas.Series.str.contains accepts regular expressions and this is turned on by default! +Use case +We often need to filter pandas DataFrames based on several string values in a Series. + +Notice that sweet pyflyby import 😁! + +sandbox  main via 3 ... + read more → +

+ +
+ +
+
+

Htop

+ +
+

+ + +htop is a common command line tool for seeing interactive output of your system resource utilization, running processes, etc. +I've always been super confused about htop showing seemingly the same process several times though... +The Fix... +Just hit H ... + read more → +

+ +
+
+ +

+ + +Unpacking iterables in python with * is a pretty handy trick for writing code that is just a tiny bit more pythonic than not. +arr: Tuple[Union[int, str]] = (1, 2, 3, 'a', 'b', 'c') + + +print(arr) +>>> (1, 2, 3, 'a', 'b', 'c') + +# the * unpacks ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-13.html b/author-nicpayne-13.html new file mode 100644 index 00000000..b283c788 --- /dev/null +++ b/author-nicpayne-13.html @@ -0,0 +1,445 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 13 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+
+

Pipx

+ +
+

+ + +pipx is a tool I've been using to solve a few problems of mine... + +pinning formatting tools like black, flake8, isort, etc. to the same version for all my projects +keeping virtual environments clean of things like cookiecutter +python utilities I wan ... + read more → +

+ +
+
+
+

Fx-json

+ +
+

+ + +fx is an interactaive JSON viewer for the terminal. +It's a simple tool built with Charmcli's Bubble Tea. +Installation +The installation with go was broken for me - both via the link and direct from the repo. +Now I'm not a gopher so I don't really kno ... + read more → +

+ +
+
+ +

+ + +I use Jellyfin at home for serving up most of our media - movies and shows etc. +My dream is to have a GPU capable of transcoding any and all of our media for smooth playback on any device... +Now, I thought I'd have that by now with my Nvidia Quadro ... + read more → +

+ +
+
+
+

Typeddict

+ +
+

+ + +Type hinting has helped me write code almost as much, if not more, than unit testing. +One thing I love is that with complete type hinting you get a lot more out of your LSP. +Typing dictionaries can be tricky and I recently learned about TypedDict to ... + read more → +

+ +
+
+
+

Terraform-01

+ +
+

+ + +I've started using Terraform to manage Snowflake infrastructure at work. +I'm still a noobie but I've got a workflow that I think makes sense... +Here's the directory setup for a simple project with some databases, schemas, and tables to manage. +terra ... + read more → +

+ +
+
+ +

+ + +My moonlander is great, and I just recently added CAPS LOCK back to my keymapping but I've moved it... +At present it is where the ESC kep usually is however I'm trying to match my general moonlander usage with a keymap that fits on a planck. +Because ... + read more → +

+ +
+
+ +

+ + +My current homelab setup is not great but it works... +Proxmox on PowerEdge R610 +I boot off an SD card and have 1 SSD and 5 HDDs configured as a JBOD array using a Dell H700 SAS controller. +I cannot boot from a disk using this controller and I can't ... + read more → +

+ +
+
+
+

And-vs-&

+ +
+

+ + +I often struggle to remember the correct way to do and type comparisons when working in pandas. +I remember learning long long ago that and and & are different, the former being lazy boolean evaluation whereas the latter is a bitwise operation. +I ... + read more → +

+ +
+
+
+

File-length

+ +
+

+ + +I have a specific need for counting the number of lines in a file quickly. +At work we use S3 for data storage during our Kedro pipeline development, and in the development process we may end up orphaning several datasets. +In order to keep our worksp ... + read more → +

+ +
+
+ +

+ + +I have a post on starship where I have some notes on how I use starship to make my zsh experience great with a sweet terminal prompt. +Now... I spend quite a bit of time in ipython every day and I got kind of sick of the vanilla experience and wanted ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-14.html b/author-nicpayne-14.html new file mode 100644 index 00000000..6c129171 --- /dev/null +++ b/author-nicpayne-14.html @@ -0,0 +1,456 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 14 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +Did you know you can spell check in Vim?! + + + + Vim Spell check + + + Without... + Here is a missspelled word. + <h3>With!</h3> + <p>Here is a <u>missspelled</u> word.</p> + + + +What is this magi ... + read more → +

+ +
+
+
+

Polybar-01

+ +
+

+ + +polybar is an awesome and super customizable status bar for your desktop environment. +I use it with i3-gaps on Ubuntu for work and it makes my day just that much better to have a clean and elegant bar with the things in it that I care about. +The Git ... + read more → +

+ +
+
+
+

Deques

+ +
+

+ + +I am working on a project to create a small system monitoring dashboard using the python psutil library. +The repo is here (if you want actual system monitoring please use netdata). +I'm using streamlit and plotly for the webserver, design, and plotti ... + read more → +

+ +
+
+ +

+ + +Streamlit +I use streamlit for any EDA I ever have to do at work. +It's super easy to spin up a small dashboard to filter and view dataframes in, live, without the fallbacks of Jupyter notebooks (kernels dying, memory bloat, a billion "Untitled N ... + read more → +

+ +
+
+
+

Starship

+ +
+

+ + +If you spend time in the terminal then you'll want it to look somewhat pleasing to the eye. +I used to ssh into servers with no customization, use vi to edit a file or two, then get back to my regularly scheduled programming in VS C**e... +One of the ... + read more → +

+ +
+
+ +

+ + +Self-hosting 1 or several media servers is another common homelab use-case. +Getting content for your media servers is up to you, but I'll show a few ways here to get content somewhat easily! +YouTube Disclaimer at Bottom +you-get +you-get is a nice cli ... + read more → +

+ +
+
+
+

Skimpy

+ +
+

+ + +EDA +I work with data a lot, but the nature of my job isn't to dive super deep into a small amount of datasets, +I'm often jumping between several projects every day and need to just get a super quick glance at some tables to get a high level view. +Wh ... + read more → +

+ +
+
+ +

+ + +NAS +One of the most common use cases for self-hosting anything is a file share system. +I have been a fan of TrueNAS for a while. +I currently use TrueNAS Core at home, and plan to consider transitioning to TrueNAS Scale soon. +Blog post forthcoming on ... + read more → +

+ +
+
+
+

Pyclean

+ +
+

+ + +I like to keep my workspace clean and one thing that I don't personally love looking at is the __pycache__ directory that pops up after running some code. +The *.pyc files that show up there are python bytecode and they are cached to make subsequent ... + read more → +

+ +
+
+
+

Psutil-01

+ +
+

+ + +Mike Driscoll has been posting some awesome posts about psutil lately. +I'm interested in making my own system monitoring dashboard now using this library. +I don't expect it to compete with Netdata or Glances but it'll just be for fun to see how Pyth ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-15.html b/author-nicpayne-15.html new file mode 100644 index 00000000..afb49902 --- /dev/null +++ b/author-nicpayne-15.html @@ -0,0 +1,444 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 15 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+
+

Mu

+ +
+

+ + +If you work with a template for several projects then you might sometimes need to do the same action across all repos. +A good example of this is updating a package in requirements.txt in every project, or refactoring a common module. +If you have sev ... + read more → +

+ +
+
+
+

Wireguard

+ +
+

+ + +VPN +Virtual Private Networks are a big deal, and this shouldn't be considered anything even close to a guide on using them. +Here are just my notes and some setup for how I use wireguard at home. +Wireguard +Wireguard is an awesome peer-to-peer VPN tun ... + read more → +

+ +
+
+ +

+ + +Git +Hopefully if you write code you are using git, if not go learn the basics of commit, pull, push, and pull request/merge request like... right now. +Assuming you are at least familiar with git then you probably work the same way I have since I've ... + read more → +

+ +
+
+ +

+ + +ABCMeta +I don't do a lot of OOP currently, but I have been on a few heavy OOP projects and this ABCMeta and abstractmethod from abc would've been super nice to know about! +If you are creating a library with classes that you expect your users to exte ... + read more → +

+ +
+
+ +

+ + +Being lazy +I almost exclusively use Python for my job and have been eye-balls deep in it for almost 5 years but I really lack in-depth knowledge of builtins. +I recently learned of an awesome builtin called calendar that has way more than I know abo ... + read more → +

+ +
+
+ +

+ + +I am personally trying to use logger instead of print in all of my code, +however I learned from [@Python-Hub] that you can align printouts using print with f-strings!. +This little python script shows how options in the f-string can format the printo ... + read more → +

+ +
+
+ +

+ + +I have often wanted to dive into memory usage for pandas DataFrames when it comes to cloud deployment. +If I have a python process running on a server at home I can use glances or a number of other tools to diagnose a memory issue... +However at work ... + read more → +

+ +
+
+ +

+ + +I run pi-hole at home for ad blocking and some internal DNS/DHCP handling. +pi hole posts on the way +One thing I've never put too much thought in is asking "how well am I doing at blocking?" +There's lots of ways to measure that depending on ... + read more → +

+ +
+
+ +

+ + +I host a lot of services in my homelab, but they're mostly dockerized applications so I have never had to care much about how content gets served up. +Today I had several little concepts click into place regarding webservers, and it was a similar exp ... + read more → +

+ +
+
+
+

Tree

+ +
+

+ + +I wanted a quick way to generate an index.html for a directory of html files that grows by 1 or 2 files a week. +I don't know any html (the files are exports from my tiddlywiki)... +tree is just the answer. +Say I have a file structure like this: +./htm ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-16.html b/author-nicpayne-16.html new file mode 100644 index 00000000..e7c79ff7 --- /dev/null +++ b/author-nicpayne-16.html @@ -0,0 +1,479 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 16 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+
+

Traefik-01

+ +
+

+ + +Traefik +If you don't know about traefik and you need a reverse-proxy then you might want to check it out. +I used to use nginx for my reverse proxy but the config was over my head, and once it was working I was afraid to touch it. +Traefik brings a lo ... + read more → +

+ +
+
+ +

+ + +On my team we often have to change data types of columns in a pandas.DataFrame for a variety of reasons. +The main one is it tends to be an artifact of EDA whereby a file is read in via pandas but the data types are somewhat wonky (ie. dates show up ... + read more → +

+ +
+
+
+

Tiddly-wiki

+ +
+

+ + +Tiddly Wiki is a great note taking utility for organizing non-linear notes. +I used it to replace my OneNote workflow and my only complaint is I don't have an easy way to access and edit my tiddlers (posts) if I'm not at home. +The tiddlywiki is just ... + read more → +

+ +
+
+ +

+ + +I ran into an issue where I had some copy-pasta markdown tables in a docstring but the generator I used to make the table gave me tabs instead of spaces in odd places which caused black to throw a fit. +Instead of manually changing all tabs to spaes, ... + read more → +

+ +
+
+
+

Stow-target

+ +
+

+ + +Check out stow for a brief introduction to stow +What if I want to stow a package somewhere else? +Boom, that's where -t comes in... +Maybe I don't like having my dotfiles repo at $HOME and instead I want it in ~/git or ~/personal just to stay organize ... + read more → +

+ +
+
+ +

+ + +After carefully staging only lines related to a specific change and comitting I suddenly realized I missed one... darn, what do I do? +Old me would have soft reset my branch to the previous commit and redone all my careful staging... what a PIA... +Ne ... + read more → +

+ +
+
+
+

Stow

+ +
+

+ + +Stow is a great tool for managing dotfiles. My usage looks like cloning my dotfiles to my home directory, setting some environment variables via a script, then stowing relevant packages and boom my config is good to go... +cd ~ +git clone <my dotfi ... + read more → +

+ +
+
+ +

+ + +Sometimes I need to manually set a static IP of a Linux machine. I generally run the latest version of Ubuntu server in my VMs at home. +In Ubuntu 20 I'm able to change up /etc/netplan/<something>.yml +network: + version: 2 + ethernets: + enp0 ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-17.html b/author-nicpayne-17.html new file mode 100644 index 00000000..7152c398 --- /dev/null +++ b/author-nicpayne-17.html @@ -0,0 +1,620 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 17 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-18.html b/author-nicpayne-18.html new file mode 100644 index 00000000..f3a4b96e --- /dev/null +++ b/author-nicpayne-18.html @@ -0,0 +1,620 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 18 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-19.html b/author-nicpayne-19.html new file mode 100644 index 00000000..8c843ed6 --- /dev/null +++ b/author-nicpayne-19.html @@ -0,0 +1,620 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 19 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-2.html b/author-nicpayne-2.html new file mode 100644 index 00000000..bb932ee4 --- /dev/null +++ b/author-nicpayne-2.html @@ -0,0 +1,455 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted... + +PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least ... + read more → +

+ +
+ + + + + + + + +
+ +

+ + +To customize k9s use the skins from catppuccin or the ones k9s supplies +OUT="${XDG_CONFIG_HOME:-$HOME/.config}/k9s/skins" +mkdir -p "$OUT" +curl -L https://github.com/catppuccin/k9s/archive/main.tar.gz | tar xz -C "$OUT" ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-20.html b/author-nicpayne-20.html new file mode 100644 index 00000000..11a63102 --- /dev/null +++ b/author-nicpayne-20.html @@ -0,0 +1,580 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 20 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-3.html b/author-nicpayne-3.html new file mode 100644 index 00000000..38acf6b8 --- /dev/null +++ b/author-nicpayne-3.html @@ -0,0 +1,449 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 3 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+ +
+ +

+ + +I started deploying a website to Cloudflare on a branch called pages. Similar to one of the GH Pages deployment patterns. But when my CI was pushing the branch I couldn't see it locally... +git fetch -a wasn't pulling any new branches, and git branch ... + read more → +

+ +
+ +
+ +

+ + +Video +Sermon on the Mount +3 chapters filled with phrases that are very well-known in our culture +Phrases + +Love your neighbor as yourself +Do to others what you would have them do to you +You are the salt of the earth +You can’t serve both God and money ... + read more → +

+ +
+ +
+
+

Chaos dragon

+ +
+

+ + +Dragons are metaphorical images in the Bible +Goliath -> armor descriptions +Leviathan +Dragon slayers can be enticed to become dragons themselves +Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon + +calming the ... + read more → +

+ +
+ + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-4.html b/author-nicpayne-4.html new file mode 100644 index 00000000..3916cbba --- /dev/null +++ b/author-nicpayne-4.html @@ -0,0 +1,463 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 4 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +ChatGPT Prompt: +Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some prompts for generating art with Stable Diffusion. +Example: + +A ghostly apparition drifting through a haunted mansion's grand ballroom, illuminated by fli ... + read more → +

+ +
+
+ +

+ + + +James +2023 study of the book of James +BP +The Guy +Greek: Iakobos (Jacob in English) +Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection +The book of James is the legacy of this Jacob's wisdom which was h ... + read more → +

+ +
+ +
+ +

+ + +I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least nav ... + read more → +

+ +
+ +
+
+

Modal labs

+ +
+

+ + +Playing around with Modal Labs +One of the first things I tried was a regular cron job... +@stub.function( + schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret") +) +def say_hi(): + now = time.ctime() + sec ... + read more → +

+ +
+ + +
+ +

+ + +I have a bash script called syncoid-job which boils down to a barebones - +#!/bin/bash + +syncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas + +I want to run this script hourly but a ... + read more → +

+ +
+ + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-5.html b/author-nicpayne-5.html new file mode 100644 index 00000000..8c8eaf8a --- /dev/null +++ b/author-nicpayne-5.html @@ -0,0 +1,465 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 5 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as +an example... I'll want to play with something but if I don't start Neovim as +root then I get in trouble making edits I can't save! So +suda.vim gives me +:SudaWrite which ... + read more → +

+ +
+ +
+ +

+ + +AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entry ... + read more → +

+ +
+ +
+ +

+ + +I wanted to break down some long lines in a Markdown table cell to make it look +nicer on my blog but \n didn't do anything for me... turns out is the +magic sauce + + + +Column 1 +Column 2 + + + + +Key +Doggo ipsum many pats. Borkdrive borking doggo doing me a ... + read more → +

+ +
+ + +
+ +

+ + +Class link +Classroom notes (Must be on home network) +01 The Shape of the Hebrew Bible +Session 1: What on Earth is the Hebrew Bible? +This class is not so much a survey of the HB, it is Tim's attempt to distil the +most helpful things for understanding ... + read more → +

+ +
+ +
+
+

Faithful

+ +
+

+ + +Link +Notes +!!! Exodusds 34:6 +Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness + +Faithfulness - Emet (can be translated 'Truth') +Related to "Amen" which is untranslated Hebrew expression meaning "t ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-6.html b/author-nicpayne-6.html new file mode 100644 index 00000000..cc5027ef --- /dev/null +++ b/author-nicpayne-6.html @@ -0,0 +1,456 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 6 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +zfs list has a flag -r, but if you use zfs driver for docker then you'll get +flooded with every docker volume in the world. zfs list -r -d N will limit the +dept of the print out, so zfs list -r -d 2 gives me tank, tank/encrypted, +tank/encrypted/dock ... + read more → +

+ +
+ +
+
+

Sabbath

+ +
+

+ + +Link to study +Creation +Brougt to completion on the seventh day in Genesis 1. It is the only day that +does not end with 'there evening and there was morning, the Nth day' +Humans were meant to rest with God in his creation forever, but in their +reblli ... + read more → +

+ +
+ + +
+ +

+ + +!!! note "Babyblue v2" +Ryzen 5700x + 32 GB 3200 CL16 RAM + +<a href="https://www.passmark.com/baselines/V10/display.php?id=503041456656"><img src="https://www.passmark.com/baselines/V10/media/503041456656.png" al ... + read more → +

+ +
+ +
+
+

Chara-joy

+ +
+

+ + +link +Chara / Joy +There are several words for similar feelings - example like joy has several synonyms. +Sources +Genesis tells us creation and life bring joy +Psalm 104 - A good bottle of wine is God's gift to bring joy to people's hearts +P#lm 65 - Bea ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-7.html b/author-nicpayne-7.html new file mode 100644 index 00000000..84174a41 --- /dev/null +++ b/author-nicpayne-7.html @@ -0,0 +1,465 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 7 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +link to study +Video +Priests +God creates Eden in which he places humans to be his royal image - priests. God +sets humans up to receive his blessing but humans choose their own way. The +promise is for a priest and a sacrifice to come in Jesus. +God cho ... + read more → +

+ +
+ +
+
+

Tree of life

+ +
+

+ + +Video +Eden +Biblical story begins in a garden, which is presented as a type of Temple. The +top (center) is the Tree of Life, which represents God's life and creative +power. Humans were supposed to eat from the Tree of Life but there's +another tree, t ... + read more → +

+ +
+
+ +

+ + +study link +Peace +!!! note "" +generally means absnese of war + +In Hebrew the word is Shalom (Greek: Eirene). Basic biblical meeting of +Shalom is "complete" or "whole". ie. a stone with no cracks, or stone wall with +nogaps ... + read more → +

+ +
+
+ +

+ + +I use Tmux and Vim for most of my workflow, but I end up with a lot of dangling +tmux sessions that dont' really need to persist... but killing them one at a +time is a pain so I wrote a little script-kitty nonsense to pipe multiple +choices from fzf i ... + read more → +

+ +
+
+ +

+ + +link to presentation +Hellenism +During the "silent years" Hellenism was on the rise, even among several Jewish circles. +Essenes +Another Jewish group (like Pharisees, Herodians, etc.) with a lot of debate +surrounding them. They were largely ... + read more → +

+ +
+ +
+ +

+ + +Herodians show up twice in the Gospels, Josephus talks about them a bit as +well. There is a lot of hsitorical debate that surrounds the Herodians. + +Like Republicans and Democracts meant one thing in American history, but +those positions and words me ... + read more → +

+ +
+
+ +

+ + +Link to presentation +Sadducees +>Often we in the modern time totally conflate Sadducees and Pharisees but they +>are as Republicans and Democrats today... very much not the same +Origin +Back in the Davidic kingdom they are the group that sought t ... + read more → +

+ +
+
+ +

+ + +Hellenism + +For the first time in history, Greeks redefined worldfiew to be cenetered +around the individual. Prior to Hellenism, worldviews centered around +pleasing the gods + +Alexander the Great had his own gospel (εὐαγγέλιον - euangelion: predates b ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-8.html b/author-nicpayne-8.html new file mode 100644 index 00000000..733cdcab --- /dev/null +++ b/author-nicpayne-8.html @@ -0,0 +1,476 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 8 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+ +
+ +

+ + +Link to presentation +Judaism +Modern Judaism is very different from Jesus' Judaism which was distinct from +David's Judaism, etc... We, as modern westerners, need to be aware of the +religious evolution and history of Judaism to properly understand the ... + read more → +

+ +
+
+ +

+ + +Intro +Session 1: Torah +Session 2: Prophets and Writings +Review +Torah +Big idea: partnership + +Basis of partnership / meet the characters (Genesis) +God chooses a partner / the partner chooses God (Exodus) +God defines the partnership (Leviticus) +God sha ... + read more → +

+ +
+
+ +

+ + +Intro +I use ZFS at home in my homelab for basically all of my storage... Docker uses +ZFS backend, all my VMs have their .qcow2 images in their own zfs datasets, +and all my shares are ZFS datasets. I love ZFS but my home hardware presently +is the opp ... + read more → +

+ +
+ +
+
+

Screwtape

+ +
+

+ + +Chapters +Below are just quick notes or quotes from each chapter as a reminder of what to +go back to chat about. This isn't intended to be in-depth by any stretch. +Chapter 1 +"Your man has been accustomed, ever since he was a boy, to have a dozen ... + read more → +

+ +
+ +
+ +

+ + +Steps +sudo fdisk -l +then look for the device and partition +get the Type column +mount +Example + +dumbledore in /media NO PYTHON VENV SET +❯ sudo fdisk -l + +... + +Device Boot Start End Sectors Size Id Type +/dev/sdk1 * 2048 60371951 ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne-9.html b/author-nicpayne-9.html new file mode 100644 index 00000000..85972b6e --- /dev/null +++ b/author-nicpayne-9.html @@ -0,0 +1,458 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne - 9 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+ + + + +
+ +

+ + +man can be a pain to read... and there's lots of alternatives out there and one I've just started playing with is cheat +man man will give you this plus a billion more lines of docs, which is useful when you need it... +MAN(1) ... + read more → +

+ +
+
+ +

+ + +I got into a pickle where I encrypted the ssh keys I use for my SSH connections on LAN, but then I couldn't run my ansible playbook on my server! ssh-keygen -p and leave the new passphrase blank saved my day (although password protected key files ar ... + read more → +

+ +
+ + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne.html b/author-nicpayne.html new file mode 100644 index 00000000..2aa484e6 --- /dev/null +++ b/author-nicpayne.html @@ -0,0 +1,456 @@ + + + + + + + + + + + + + + + + + + + + + Nicholas Payne | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + +
+
+
+
+
+ Nicholas Payne +
+
+

Nicholas Payne

+
+

Just some guy

+
+
+
+ + + +
+
+
+ +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/author-nicpayne.json b/author-nicpayne.json new file mode 100644 index 00000000..e10d3654 --- /dev/null +++ b/author-nicpayne.json @@ -0,0 +1,325 @@ +{ + "version": "https://jsonfeed.org/version/1", + "title": "Pype.dev", + "home_page_url": "https://pype.dev", + "feed_url": "https://pype.dev/author-nicpayne.json", + "description": "my mental data-lake", + "items": [ + { + "id": "https://pype.dev/advent-2024-peace.html", + "url": "https://pype.dev/advent-2024-peace.html", + "title": "Advent 2024 - Peace", + "content_html": "\n

Scripture

\n

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

\n

Edification

\n

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

\n

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

\n

You all know we messed that up, Shalom was broken and humanity was exiled.

\n

But we have a Great Healer.

\n

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

\n

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

\n

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

\n

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

\n

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

\n

Finally I pray we may all be given, and accept, the conviction of Paul -

\n

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

\n

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

\n\n", + "summary": "", + "date_published": "2024-12-06T15:26:15-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "url": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "title": "hostnamectl to easily change hostname", + "content_html": "\n

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

\n
\n❯ hostnamectl --help\nhostnamectl [OPTIONS...] COMMAND ...\n\nQuery or change system hostname.\n\nCommands:\n  status                 Show current hostname settings\n  hostname [NAME]        Get/set system hostname\n  icon-name [NAME]       Get/set icon name for host\n  chassis [NAME]         Get/set chassis type for host\n  deployment [NAME]      Get/set deployment environment for host\n  location [NAME]        Get/set location for host\n\nOptions:\n  -h --help              Show this help\n     --version           Show package version\n     --no-ask-password   Do not prompt for password\n  -H --host=[USER@]HOST  Operate on remote host\n  -M --machine=CONTAINER Operate on local container\n     --transient         Only set transient hostname\n     --static            Only set static hostname\n     --pretty            Only set pretty hostname\n     --json=pretty|short|off\n                         Generate JSON output\n\nSee the hostnamectl(1) man page for details.\n
\n

I learned there's transient and static hostnames, so that's cool...

\n

The thing I needed was hostnamectl --static hostname babyblue-aurora

\n

pretty sweet tool

\n\n", + "summary": "", + "date_published": "2024-12-06T07:25:59-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/how-to-survive-the-flood.html", + "url": "https://pype.dev/how-to-survive-the-flood.html", + "title": "How To Survive The Flood", + "content_html": "\n

There a lot of flood stories throughout the history of the world, and the Bible\nis no different in this regard. God warns Noah of a de-creation event, whereby\nhe'll start over with humanity via Noah and his family. Noah survives the flood\nby abiding in Yahweh and staying close to the One who loves him.

\n
\n

Note this reflection doesn't address AT ALL if the flood narrative is a\n"real" historical event, whether it's a global or local event, or anything\nlike that - regardless of those points the Biblical authors used this type of\nimagery of chaos waters to communicate themes of judgement and wrath.

\n
\n

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images\nof the chaos waters (the winds and the rains). His instruction is that the wise\nman who built his house on the rock will survive, but the foolish man builds\nhis house on the sand and the winds and the rains destroyed it.

\n

Somewhat obviously this is metaphorical for basing your life on wisdom or\nfolly. The wisdom is Jesus' teaching which is all based on Yahweh's love for\nhumanity and his desire to partner with humanity for the good of the whole\nearth.

\n

The simple take-away is for us to survive the winds and the rain, and to say it\nmore fully - to survive de-creation and destruction, we must live our lives in\na way that revolves around Jesus, the perfect human. He calls us to a greater\nhumanity, an unbroken humanity, which is unachievable apart from him (just look\naround if you doubt this truth).

\n

It's important to notice though that abiding in the Lord, basing your life on\nthe rock, doesn't spare you from the wind and the rain. Trials come, life gets\nhard, shit hits the fan. The last few weeks for me haven't been my favorite and\nI've certainly experienced turmoil in my life but frankly Jesus makes those\nthings bearable... in a way I can't put enough words to I'll just be reminded of\nPaul in Romans 8...

\n
worthy to be compared with the glory that is to be revealed to us.” Our present\ntrials are not on an equal scale with the glory of heaven ```\n\nBy God's grace he's molded my heart to be nearly incapable of separating the\nLove God has for me from any trial I face - it's not a magic answer or silver\nbullet to fixing those problems, and it doesn't make them go away, but I know\nthe sufferings here aren't even worth comparing to the glory of the Lord. Amen.\n\n<!-- Content Injected to every content markdown footer -->\n\n[github]: https://github.com/rochacbruno/marmite\n
\n", + "summary": "", + "date_published": "2024-12-04T05:52:44-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/welcome.html", + "url": "https://pype.dev/welcome.html", + "title": "Welcome to Marmite", + "content_html": "\n

This is your first post!

\n

Edit this content

\n

edit on content/{date}-welcome.md

\n

Add more content

\n

create new markdown files in the content folder

\n

use marmite --new to create new content

\n

Customize your site

\n

edit marmite.yaml to change site settings

\n

edit the files starting with _ in the content folder to change the layout

\n

or edit the templates to create a custom layout

\n

Deploy your site

\n

read more on marmite documentation

\n\n", + "summary": "", + "date_published": "2024-12-04T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [], + "language": "en" + }, + { + "id": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "url": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "title": "Stylus for custom webpage themes", + "content_html": "\n

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

\n

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

\n

TODO: image

\n\n", + "summary": "", + "date_published": "2024-11-27T06:07:39-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/the-two-houses.html", + "url": "https://pype.dev/the-two-houses.html", + "title": "The Two Houses", + "content_html": "\n

Context

\n
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.\n\nThe Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.\n
\n

Reflection

\n

From the visual commentary Tim calls out a few things:

\n
    \n
  1. \n

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    \n
  2. \n
  3. \n

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    \n
  4. \n
\n\n", + "summary": "", + "date_published": "2024-11-27T05:40:24-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "url": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "title": "DNS Broke After Reboot - Ubuntu 22.04", + "content_html": "\n

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

\n

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

\n

sudo mkdir /etc/systemd/resolved.conf.d/\nsudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

\n

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

\n
[Resolve]\nDNS=8.8.8.8 1.1.1.1\n
\n

But I decided to use tailscale

\n
[Resolve]\nDNS=100.100.100.100\n
\n

Then restart systemd-resolved

\n

sudo systemctl restart systemd-resolved

\n\n", + "summary": "", + "date_published": "2024-11-22T08:08:40-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/restart-kde-plasma.html", + "url": "https://pype.dev/restart-kde-plasma.html", + "title": "Restart KDE Plasma", + "content_html": "\n

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

\n
\nsudo killall plasmashell\n\nkstart plasmashell\n\n
\n\n", + "summary": "", + "date_published": "2024-11-08T15:53:52-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/opnsense-bootstrap-recovery.html", + "url": "https://pype.dev/opnsense-bootstrap-recovery.html", + "title": "OPNSense Bootstrap Recovery", + "content_html": "\n

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

\n\n", + "summary": "", + "date_published": "2024-11-07T08:40:19-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "infrastructure", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/bp-the-golden-rule.html", + "url": "https://pype.dev/bp-the-golden-rule.html", + "title": "BP - The Golden Rule", + "content_html": "\n

Matthew 7:12

\n
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets\n
\n

What do I desire that people "do to [me]"?

\n
    \n
  1. Help if I need it - I want to live in a world where humans are helpful
  2. \n
  3. Listen to me and understand what I say
  4. \n
  5. Leave me alone sometimes
  6. \n
\n

What is the Torah and Prophets?

\n

I know there's a lot more to where the texts come from and the varying\ntraditions in Judaism. But I think at a very high level, Jesus is saying that\nwe all know, deep down, how to live in harmony but that it requires sacrifice.\nHe calls us to live sacrificially towards each other, to live in Heaven\ntoday, so we can experience the coming reality if our own resurrection

\n\n", + "summary": "", + "date_published": "2024-11-06T05:54:32-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/recovering-opnsense.html", + "url": "https://pype.dev/recovering-opnsense.html", + "title": "Recovering OPNSense", + "content_html": "\n

I woke up to faulty internet and after some troubleshooting it turns out the\nroot zfs dataset that OPNSense boots from got corrupted...

\n
\n

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or\nnextcloud... But if you won't then at least back up your OPNSense config\nsomewhere everytime you update it.

\n
\n

It's too much to recount every issue, so here's a bullet list what worked.

\n
    \n
  1. On a fresh drive install OPNSense
  2. \n
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would\nhappen if you plugged it in along with the new drive and then booted up.\nBecause both drives will have a zfs pool zroot and the boot dataset is\nautomounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it\ndidn't automount
  4. \n
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO:\nzpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. \n
\n
\n

-d is the zfs flag to import the pool by disk id, -N it to not mount any of\nthe datasets (we need to change mountpoints) and the zroot zrootrecovery\nimports the zroot pool with a new name

\n
\n
    \n
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere\nlike /mnt/zrootrecovery
  2. \n
  3. Depending on the mount point you set you'll find a config directory around\n/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another\nmachine via scp or whatever
  4. \n
  5. Go to OPNSense webui and recover from that config!
  6. \n
\n

All in all this process took me around 8 hours but I did run into about ever\nissue under the sun (several bad disks in the mix, a laptop that wouldn't live\nboot into a BSD system, etc.)

\n\n", + "summary": "", + "date_published": "2024-11-06T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "blog", + "homelab" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "title": "Reflection - Wisdom in Relationships 2", + "content_html": "\n

Passage

\n
Why do you see the speck in the eye of your brother, but you don't perceive the\nbeam in your own eye?\n\nOr how can you say to your brother, "Allow me to take out the speck from your\neye," and look, the beam is in your eye!\n\nHypocrite! First take out the beam from your eye, and then you can see clearly\nthe speck in the eye of your brother.\n
\n
Ask and it will be given to you. Seek and you will find. Knock and it will be\nhopend to you. For the one who asks will receive, and the one who seeks will\nfind. And to the one who knocks it will be opened. For what person is among\nyou, who when their son asks for break, will give him a rock? Or when he asks\nfor a fish will give him a snake? So then fi you all are bad, but you know how\nto give good gifts to your children, how much more will your Father in the\nskies give good things to those who ask.\n
\n

Reflection

\n

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon\non the Mount. We aren't just to ask for anything that we think is good...\nwisdom is the good we are to ask for.

\n

Tim: Prayer is important because wisdom will flow out of a deep interpersonal\nrelationship with God.

\n

Where has God given me wisdom?

\n
    \n
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. \n
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. \n
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. \n
\n\n", + "summary": "", + "date_published": "2024-10-14T06:07:33-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships.html", + "title": "Reflection - Wisdom in Relationships", + "content_html": "\n

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

\n

The passage is Matthew 7:1-2

\n
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.\n\nAnd with the measure that you measure, it will be measured to you.\n
\n

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

\n

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

\n

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

\n\n", + "summary": "", + "date_published": "2024-10-12T05:40:11-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-remote-add.html", + "url": "https://pype.dev/docker-remote-add.html", + "title": "docker-remote-add", + "content_html": "\n

Add from url??

\n

ADD http://example.com/cars.csv /tmp/cars.csv

\n

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

\n

ADD myapp.tar.gz /opt/myapp/

\n\n", + "summary": "", + "date_published": "2024-09-17T06:19:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-copy-and-chown.html", + "url": "https://pype.dev/docker-copy-and-chown.html", + "title": "Docker copy and chown", + "content_html": "\n

COPY --chown=myuser:mygroup source-file target-file

\n\n", + "summary": "", + "date_published": "2024-09-17T06:18:09-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "homelab", + "tech" + ], + "language": "en" + } + ] +} \ No newline at end of file diff --git a/author-nicpayne.rss b/author-nicpayne.rss new file mode 100644 index 00000000..465192a5 --- /dev/null +++ b/author-nicpayne.rss @@ -0,0 +1,263 @@ +Pype.devhttps://pype.devmy mental data-lakeFri, 06 Dec 2024 15:26:15 GMTFri, 06 Dec 2024 21:33:05 GMTmarmiteAdvent 2024 - Peacehttps://pype.dev/advent-2024-peace.htmlnicpaynefaithhttps://pype.dev/advent-2024-peace.htmlFri, 06 Dec 2024 15:26:15 GMTauthor-nicpayne +

Scripture

+

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

+

Edification

+

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

+

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

+

You all know we messed that up, Shalom was broken and humanity was exiled.

+

But we have a Great Healer.

+

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

+

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

+

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

+

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

+

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

+

Finally I pray we may all be given, and accept, the conviction of Paul -

+

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

+

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

+ +]]>
hostnamectl to easily change hostnamehttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlnicpaynelinuxterminaltechhttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlFri, 06 Dec 2024 07:25:59 GMTauthor-nicpayne +

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

+

+❯ hostnamectl --help
+hostnamectl [OPTIONS...] COMMAND ...
+
+Query or change system hostname.
+
+Commands:
+  status                 Show current hostname settings
+  hostname [NAME]        Get/set system hostname
+  icon-name [NAME]       Get/set icon name for host
+  chassis [NAME]         Get/set chassis type for host
+  deployment [NAME]      Get/set deployment environment for host
+  location [NAME]        Get/set location for host
+
+Options:
+  -h --help              Show this help
+     --version           Show package version
+     --no-ask-password   Do not prompt for password
+  -H --host=[USER@]HOST  Operate on remote host
+  -M --machine=CONTAINER Operate on local container
+     --transient         Only set transient hostname
+     --static            Only set static hostname
+     --pretty            Only set pretty hostname
+     --json=pretty|short|off
+                         Generate JSON output
+
+See the hostnamectl(1) man page for details.
+
+

I learned there's transient and static hostnames, so that's cool...

+

The thing I needed was hostnamectl --static hostname babyblue-aurora

+

pretty sweet tool

+ +]]>
How To Survive The Floodhttps://pype.dev/how-to-survive-the-flood.htmlnicpaynebible-projectfaithhttps://pype.dev/how-to-survive-the-flood.htmlWed, 04 Dec 2024 05:52:44 GMTauthor-nicpayne +

There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding in Yahweh and staying close to the One who loves him.

+
+

Note this reflection doesn't address AT ALL if the flood narrative is a +"real" historical event, whether it's a global or local event, or anything +like that - regardless of those points the Biblical authors used this type of +imagery of chaos waters to communicate themes of judgement and wrath.

+
+

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images +of the chaos waters (the winds and the rains). His instruction is that the wise +man who built his house on the rock will survive, but the foolish man builds +his house on the sand and the winds and the rains destroyed it.

+

Somewhat obviously this is metaphorical for basing your life on wisdom or +folly. The wisdom is Jesus' teaching which is all based on Yahweh's love for +humanity and his desire to partner with humanity for the good of the whole +earth.

+

The simple take-away is for us to survive the winds and the rain, and to say it +more fully - to survive de-creation and destruction, we must live our lives in +a way that revolves around Jesus, the perfect human. He calls us to a greater +humanity, an unbroken humanity, which is unachievable apart from him (just look +around if you doubt this truth).

+

It's important to notice though that abiding in the Lord, basing your life on +the rock, doesn't spare you from the wind and the rain. Trials come, life gets +hard, shit hits the fan. The last few weeks for me haven't been my favorite and +I've certainly experienced turmoil in my life but frankly Jesus makes those +things bearable... in a way I can't put enough words to I'll just be reminded of +Paul in Romans 8...

+
worthy to be compared with the glory that is to be revealed to us.” Our present
+trials are not on an equal scale with the glory of heaven ```
+
+By God's grace he's molded my heart to be nearly incapable of separating the
+Love God has for me from any trial I face - it's not a magic answer or silver
+bullet to fixing those problems, and it doesn't make them go away, but I know
+the sufferings here aren't even worth comparing to the glory of the Lord. Amen.
+
+<!-- Content Injected to every content markdown footer -->
+
+[github]: https://github.com/rochacbruno/marmite
+
+]]>
Welcome to Marmitehttps://pype.dev/welcome.htmlnicpaynehttps://pype.dev/welcome.htmlWed, 04 Dec 2024 00:00:00 GMTauthor-nicpayne +

This is your first post!

+

Edit this content

+

edit on content/{date}-welcome.md

+

Add more content

+

create new markdown files in the content folder

+

use marmite --new to create new content

+

Customize your site

+

edit marmite.yaml to change site settings

+

edit the files starting with _ in the content folder to change the layout

+

or edit the templates to create a custom layout

+

Deploy your site

+

read more on marmite documentation

+ +]]>
Stylus for custom webpage themeshttps://pype.dev/stylus-for-custom-webpage-themes.htmlnicpaynetechhttps://pype.dev/stylus-for-custom-webpage-themes.htmlWed, 27 Nov 2024 06:07:39 GMTauthor-nicpayne +

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

+

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

+

TODO: image

+ +]]>
The Two Houseshttps://pype.dev/the-two-houses.htmlnicpaynebible-projectfaithhttps://pype.dev/the-two-houses.htmlWed, 27 Nov 2024 05:40:24 GMTauthor-nicpayne +

Context

+
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.
+
+The Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.
+
+

Reflection

+

From the visual commentary Tim calls out a few things:

+
    +
  1. +

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    +
  2. +
  3. +

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    +
  4. +
+ +]]>
DNS Broke After Reboot - Ubuntu 22.04https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlnicpaynehomelablinuxtechhttps://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlFri, 22 Nov 2024 08:08:40 GMTauthor-nicpayne +

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

+

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

+

sudo mkdir /etc/systemd/resolved.conf.d/ +sudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

+

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

+
[Resolve]
+DNS=8.8.8.8 1.1.1.1
+
+

But I decided to use tailscale

+
[Resolve]
+DNS=100.100.100.100
+
+

Then restart systemd-resolved

+

sudo systemctl restart systemd-resolved

+ +]]>
Restart KDE Plasmahttps://pype.dev/restart-kde-plasma.htmlnicpaynelinuxterminaltechhttps://pype.dev/restart-kde-plasma.htmlFri, 08 Nov 2024 15:53:52 GMTauthor-nicpayne +

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

+

+sudo killall plasmashell
+
+kstart plasmashell
+
+
+ +]]>
OPNSense Bootstrap Recoveryhttps://pype.dev/opnsense-bootstrap-recovery.htmlnicpayneinfrastructurehomelabtechhttps://pype.dev/opnsense-bootstrap-recovery.htmlThu, 07 Nov 2024 08:40:19 GMTauthor-nicpayne +

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

+ +]]>
BP - The Golden Rulehttps://pype.dev/bp-the-golden-rule.htmlnicpaynebible-projectfaithhttps://pype.dev/bp-the-golden-rule.htmlWed, 06 Nov 2024 05:54:32 GMTauthor-nicpayne +

Matthew 7:12

+
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets
+
+

What do I desire that people "do to [me]"?

+
    +
  1. Help if I need it - I want to live in a world where humans are helpful
  2. +
  3. Listen to me and understand what I say
  4. +
  5. Leave me alone sometimes
  6. +
+

What is the Torah and Prophets?

+

I know there's a lot more to where the texts come from and the varying +traditions in Judaism. But I think at a very high level, Jesus is saying that +we all know, deep down, how to live in harmony but that it requires sacrifice. +He calls us to live sacrificially towards each other, to live in Heaven +today, so we can experience the coming reality if our own resurrection

+ +]]>
Recovering OPNSensehttps://pype.dev/recovering-opnsense.htmlnicpaynebloghomelabhttps://pype.dev/recovering-opnsense.htmlWed, 06 Nov 2024 00:00:00 GMTauthor-nicpayne +

I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted...

+
+

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least back up your OPNSense config +somewhere everytime you update it.

+
+

It's too much to recount every issue, so here's a bullet list what worked.

+
    +
  1. On a fresh drive install OPNSense
  2. +
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would +happen if you plugged it in along with the new drive and then booted up. +Because both drives will have a zfs pool zroot and the boot dataset is +automounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it +didn't automount
  4. +
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO: +zpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. +
+
+

-d is the zfs flag to import the pool by disk id, -N it to not mount any of +the datasets (we need to change mountpoints) and the zroot zrootrecovery +imports the zroot pool with a new name

+
+
    +
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere +like /mnt/zrootrecovery
  2. +
  3. Depending on the mount point you set you'll find a config directory around +/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another +machine via scp or whatever
  4. +
  5. Go to OPNSense webui and recover from that config!
  6. +
+

All in all this process took me around 8 hours but I did run into about ever +issue under the sun (several bad disks in the mix, a laptop that wouldn't live +boot into a BSD system, etc.)

+ +]]>
Reflection - Wisdom in Relationships 2https://pype.dev/reflection-wisdom-in-relationships-2.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships-2.htmlMon, 14 Oct 2024 06:07:33 GMTauthor-nicpayne +

Passage

+
Why do you see the speck in the eye of your brother, but you don't perceive the
+beam in your own eye?
+
+Or how can you say to your brother, "Allow me to take out the speck from your
+eye," and look, the beam is in your eye!
+
+Hypocrite! First take out the beam from your eye, and then you can see clearly
+the speck in the eye of your brother.
+
+
Ask and it will be given to you. Seek and you will find. Knock and it will be
+hopend to you. For the one who asks will receive, and the one who seeks will
+find. And to the one who knocks it will be opened. For what person is among
+you, who when their son asks for break, will give him a rock? Or when he asks
+for a fish will give him a snake? So then fi you all are bad, but you know how
+to give good gifts to your children, how much more will your Father in the
+skies give good things to those who ask.
+
+

Reflection

+

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon +on the Mount. We aren't just to ask for anything that we think is good... +wisdom is the good we are to ask for.

+

Tim: Prayer is important because wisdom will flow out of a deep interpersonal +relationship with God.

+

Where has God given me wisdom?

+
    +
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. +
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. +
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. +
+ +]]>
Reflection - Wisdom in Relationshipshttps://pype.dev/reflection-wisdom-in-relationships.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships.htmlSat, 12 Oct 2024 05:40:11 GMTauthor-nicpayne +

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

+

The passage is Matthew 7:1-2

+
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.
+
+And with the measure that you measure, it will be measured to you.
+
+

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

+

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

+

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

+ +]]>
docker-remote-addhttps://pype.dev/docker-remote-add.htmlnicpaynehomelablinuxtechhttps://pype.dev/docker-remote-add.htmlTue, 17 Sep 2024 06:19:00 GMTauthor-nicpayne +

Add from url??

+

ADD http://example.com/cars.csv /tmp/cars.csv

+

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

+

ADD myapp.tar.gz /opt/myapp/

+ +]]>
Docker copy and chownhttps://pype.dev/docker-copy-and-chown.htmlnicpaynelinuxhomelabtechhttps://pype.dev/docker-copy-and-chown.htmlTue, 17 Sep 2024 06:18:09 GMTauthor-nicpayne +

COPY --chown=myuser:mygroup source-file target-file

+ +]]>
\ No newline at end of file diff --git a/authors.html b/authors.html new file mode 100644 index 00000000..bd32df8b --- /dev/null +++ b/authors.html @@ -0,0 +1,211 @@ + + + + + + + + + + + + + + + + + + + + Authors | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ +
+
Authors
+
+ + +
+ + + +
+ + + + + + + + + diff --git a/benchmark-your-disks-with-fio.html b/benchmark-your-disks-with-fio.html new file mode 100644 index 00000000..32d32157 --- /dev/null +++ b/benchmark-your-disks-with-fio.html @@ -0,0 +1,406 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Benchmark your disks with fio | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Benchmark your disks with fio

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Intro

+

I use ZFS at home in my homelab for basically all of my storage... Docker uses +ZFS backend, all my VMs have their .qcow2 images in their own zfs datasets, +and all my shares are ZFS datasets. I love ZFS but my home hardware presently +is the opposite of expensive or new... Thankfully I've had a lot of my orginal +homelab simply given to me but the cost of this is that I didn't put my +machines together, I didn't choose the disks, and I definitely didn't do the +research I would've otherwise done had I bankrolled my server personally...

+

The Problem

+

I run glances on basically all my machines and for the longest time I have +been seeing big time iowait issues. Now, since everything was free I've +largely been able to ignore that however I'm now after some better performance +which I think means new hardware!

+

Here is a random screenshot of my glances homepage at time of writing - The +only major load on my server is some ffmpeg transcoding (about 60% CPU +utilization)...

+

Alt Text

+

As you can see... there's a lot of issues and I don't even know what they mean.

+

fio

+

I heard about fio through a friend and +decided to try it out quick. It installs with apt on ubuntu quick and easy...

+

Jim Saltar has a good blog post on it here

+

Basically it's a handy tool for benchmarking your disks and the blog dives into +what types of metrics matter - it's not just throughput, but also latency, +iops, etc.

+

Tests

+

I ran a few basic commands inside a new zfs dataset on my server tank/fio

+
fio --name=random-write --ioengine=posixaio --rw=randwrite --bs=4k --size=4g --numjobs=1 --runtime=60 --time_based --end_fsync=1 > single-4KiB-random-write.txt
+fio --name=random-write --ioengine=posixaio --rw=randwrite --bs=64k --size=256m --numjobs=16 --iodepth=16 --runtime=60 --time_based --end_fsync=1 > 16-parallel-64KiB-random-write.txt
+fio --name=random-write --ioengine=posixaio --rw=randwrite --bs=1m --size=16g --numjobs=1 --iodepth=1 --runtime=60 --time_based --end_fsync=1 > single-1MiB-random-write.txt
+
+

Results

+

The single 4 KiB random write:

+

WRITE: bw=7836KiB/s (8024kB/s), 7836KiB/s-7836KiB/s (8024kB/s-8024kB/s), io=523MiB (548MB), run=68317-68317msec

+

The 16 parallel 64KiB random writes:

+

WRITE: bw=93.9MiB/s (98.4MB/s), 5599KiB/s-6303KiB/s (5734kB/s-6454kB/s), io=7642MiB (8013MB), run=81310-81418msec

+

The single 1MiB random write:

+

WRITE: bw=81.2MiB/s (85.1MB/s), 81.2MiB/s-81.2MiB/s (85.1MB/s-85.1MB/s), io=8177MiB (8574MB), run=100699-100699msec

+

Summary

+

So I don't fully understand these numbers yet... 80-100 MiB/s isn't super fast +and that's across a parallelized workload... The single threaded workloads have +awful performance so this tells me something is wrong... I have a few ideas...

+
    +
  1. ZFS dataset config options such as ashift or the blocksize might be way misconfigured
  2. +
  3. The disks/pool which came from a TrueNAS/FreeBSD machine may have some artifacts that I need to clean up
  4. +
  5. The SAS controller I am using, which I flashed with IT firmware to get it into JBOD mode might be messed up
  6. +
  7. The data cables themselves could be a problem...
  8. +
+

Points 3 and 4 are less likely given that the write speed does increase in the parallelized job but I'm a newbie so it's time to dive in!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/bp-the-golden-rule.html b/bp-the-golden-rule.html new file mode 100644 index 00000000..5d81abc8 --- /dev/null +++ b/bp-the-golden-rule.html @@ -0,0 +1,362 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + BP - The Golden Rule | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

BP - The Golden Rule

+ + + + + +
+ + + + + +
+

Matthew 7:12

+
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets
+
+

What do I desire that people "do to [me]"?

+
    +
  1. Help if I need it - I want to live in a world where humans are helpful
  2. +
  3. Listen to me and understand what I say
  4. +
  5. Leave me alone sometimes
  6. +
+

What is the Torah and Prophets?

+

I know there's a lot more to where the texts come from and the varying +traditions in Judaism. But I think at a very high level, Jesus is saying that +we all know, deep down, how to live in harmony but that it requires sacrifice. +He calls us to live sacrificially towards each other, to live in Heaven +today, so we can experience the coming reality if our own resurrection

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/call-basicconfig-to-get-python-log-messages-in-ipython.html b/call-basicconfig-to-get-python-log-messages-in-ipython.html new file mode 100644 index 00000000..a0f2f2ed --- /dev/null +++ b/call-basicconfig-to-get-python-log-messages-in-ipython.html @@ -0,0 +1,373 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Call basicConfig to get Python log messages in iPython | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Call basicConfig to get Python log messages in iPython

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Logging instead of printing

+

I am trying to adopt logger.debug instead of print but ran into a confusing +thing in ipython during Advent of Code... I riddled by script with +logger.debug (yes after setting logging.setLevel('DEBUG')) but in ipython +none of my log messages showed up!

+
import logging
+
+logger = logging.getLogger(__name__)
+logger.setLevel("DEBUG")
+
+
+

Turns out what I was missing was a call to basicConfig

+
import logging
+
+# forget this and your messages are in the ether! or at least not seen in ipython...
+logging.basicConfig()
+
+logger = logging.getLogger(__name__)
+logger.setLevel("DEBUG")
+
+

Bonus

+

Want your new messages to show up while iterating on something without killing +the ipython kernel?

+
from importlib import reload
+reload(logging) # to make sure you get new log messages you add while developing!
+
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/caps-lock-polybar.html b/caps-lock-polybar.html new file mode 100644 index 00000000..e90b70a5 --- /dev/null +++ b/caps-lock-polybar.html @@ -0,0 +1,341 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Caps-Lock-Polybar | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Caps-Lock-Polybar

+ + + + + +
+ + + +
+

My moonlander is great, and I just recently added CAPS LOCK back to my keymapping but I've moved it... +At present it is where the ESC kep usually is however I'm trying to match my general moonlander usage with a keymap that fits on a planck.

+

Because of this though I keep turning CAPS LOCK on without meaning too by thinking I'm hitting ESC, so while I learn the keymapping I need a way to know if I screwed up...

+

Enter
+dotfiles  work  ×4  ×12  ×4 via  v3.8.11(dotfiles) on  (us-east-1) proxy +❯ xset q | grep Caps +00: Caps Lock: on 01: Num Lock: off 02: Scroll Lock: off

+

dotfiles  work  ×4  ×12  ×4 via  v3.8.11(dotfiles) on  (us-east-1) proxy +❯ xset q | grep Caps +00: Caps Lock: off 01: Num Lock: off 02: Scroll Lock: off

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/case-insensitive-search-in-vim.html b/case-insensitive-search-in-vim.html new file mode 100644 index 00000000..3b7327a7 --- /dev/null +++ b/case-insensitive-search-in-vim.html @@ -0,0 +1,335 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Case-insensitive search in Vim | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Case-insensitive search in Vim

+ + + + + +
+ + + +
+

/mysearch\c will match mysearch, MYSEARCH, mYSeArCh...

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/chaos-dragon.html b/chaos-dragon.html new file mode 100644 index 00000000..16a55a6b --- /dev/null +++ b/chaos-dragon.html @@ -0,0 +1,375 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Chaos Dragon | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Chaos Dragon

+ + + + + +
+ + + +
+

Dragons are metaphorical images in the Bible

+

Goliath -> armor descriptions +Leviathan

+

Dragon slayers can be enticed to become dragons themselves

+

Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon

+
    +
  • calming the sea
  • +
  • conquering sickness in others
  • +
  • tempter in the wilderness
  • +
+

Jesus' victory came through the surrender of his life - which brings him deep +into the dragon's realm, to deliver the ultimate blow

+

Reflect

+
    +
  1. +

    In the Bible, why is it challenging for humans to slay the dragon? What risks are involved? +The dragon's power is enticing... back to Genesis 3, humans are easy to persuade to do things for personal gain +It's challenging also becauset the dragon is powerful, and humans are not +(without its power or the power of Jesus) so if we stand against it without +the Lord, what hope do we have of victory?

    +
  2. +
  3. +

    What are some of the ways that Jesus confronted the “dragon” in his ministry?

    +
      +
    • calming the sea
    • +
    • conquering sickness in others
    • +
    • tempter in the wilderness
    • +
    +
  4. +
  5. +

    How does Jesus ultimately defeat the “dragon”? How can we follow his example?

    +
      +
    • Surrender
    • +
    • I think we do the same, but it doesn't always look like death, sometimes it's +subverting the temporary authorities we are under to comply in the least +possible ways while always ultimately striving for the coming of the Kingdom
    • +
    +
  6. +
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/chara-joy.html b/chara-joy.html new file mode 100644 index 00000000..ba0fa4b0 --- /dev/null +++ b/chara-joy.html @@ -0,0 +1,514 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Chara-Joy | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Chara-Joy

+ + + + + +
+ + + + + +
+

link

+

Chara / Joy

+

There are several words for similar feelings - example like joy has several synonyms.

+

Sources

+

Genesis tells us creation and life bring joy +Psalm 104 - A good bottle of wine is God's gift to bring joy to people's hearts +P#lm 65 - Beautiful things bring joy +Jeremiah 33:11 - Weddings

+

Corruption

+

Bible shows us that humanity and brokenness mark our world by death and loss

+

Joy in spite of corruption

+

God's people have reasons in God's faithfulness to be joyful. +Joy in the LORD is not determinmed by current struggles, but by future hope and deliverance

+

Jesus

+

His birth gives good news and brings great joy

+

Matthew 5 - Jesus says to rejoice and be glad when we are persecuted for his Name

+

Apostles

+

Paul says he chooses joy when he is in jail

+

!!! note ""

+
Joy is a _choice_
+
+

2 Corinthians 6:10 -> Paul is filled with sorrow and yet rejoicing

+

!!! success ""

+
Christian joy is rooted in future hope and expectation of a Messiah, of
+Jesus, to come again. It is a profound choice, not the result of current
+circumstances
+
+

Questions

+

!!! note "1"

+
The Israelites choose a path apart from God. As a result, they get exiled
+from their land and dominated by foreign nations. But the prophet Isaiah
+knew that sorrow would not have the final word with these people. He looked
+forward to the day when Yahweh would end pain and corruption to lead them
+into endless, joyful living. Read Isaiah 49:13 and Isaiah 51:11 . What does
+Isaiah tell us about God’s character in these passages? What does Isaiah
+say will happen to God’s people?
+
+

!!! scripture "Isaiah 49:13"

+
13Shout for joy, O heavens! And rejoice, O earth!
+
+Break forth into joyful shouting, O mountains!
+
+For the Lord has comforted His people
+
+And will have compassion on His afflicted.
+
+

!!! scripture "Isaiah 51:11"

+
11So the ransomed of the Lord will return
+
+And come with joyful shouting to Zion,
+
+And everlasting joy will be on their heads.
+
+They will obtain gladness and joy,
+
+And sorrow and sighing will flee away.
+
+

Isiah tells us that God is good and faithful. He mentions God's past +faithfulness - For the Lord _has_ comforted His people as well as future +faithfulness - So the randomed of the Lord _will_ return...

+

Isiah leans in on Yahweh's defining nature from Exodus 34:6. God's hesed, his +steadfase love, is what is our hope. Otherwise our God is no different than +any powerful but fickle diety.

+

Isiah also doesn't, in these short passages, promise or claim a promise of any +kind of temporal happiness - the joy is historical-facing in reflecting on +God's deliverance and future-facing inr reflecting also on God's deliverance. +God's people were still supposed to find this joy in the midst of their bondage.

+

!!! note "2"

+
The prophet Isaiah looked forward to the coming of Israel’s redeemer. His
+prophecies were fulfilled with the arrival of Jesus. Read Luke 2:9-11 . Why
+were the shepherds afraid? What reasons did the angels give for them to
+rejoice instead?
+
+

!!! scripture "Luke 2:9-11"

+
9And an angel of the Lord suddenly stood before them, and the glory of the
+Lord shone around them; and they were terribly frightened. 10But the angel
+said to them, “Do not be afraid; for behold, I bring you good news of great
+joy which will be for all the people; 11for today in the city of David
+there has been born for you a Savior, who is Christ the Lord.
+
+

Presumably the shepherds were afraid because of the glory of the Lord. All +throughout the OT we have examples of God's people fearing this glory, +specifically on Sinai. Yahweh even tells Moses that he can only be shown +Yahweh's back due to his glory, and then Moses has to veil his face so that the +glory of the Lord persisted on him would not terrify the Israelites.

+

The angels outright said that a Savior has been born, the Messiah has come. +There is no greater cause for joy than the king of creation returning

+

!!! note "3"

+
Joy can persist in the harshest of circumstances because it depends on God
+and his promises. Read Matthew 5:11-12 , Acts 13:50-52 , and Hebrews 12:1-3
+. According to these passages, what specific truths about God can sustain
+joy even through painful or dire situations?
+
+

!!! success ""

+
Joy can persist in the harshest of circumstances because it depends on God
+and his promises.
+
+

!!! scripture "Matthew 5:11-12"

+
11“Blessed are you when people insult you and persecute you, and falsely
+say all kinds of evil against you because of Me. 12Rejoice and be glad, for
+your reward in heaven is great; for in the same way they persecuted the
+prophets who were before you.
+
+

!!! scripture "Acts 13:50-52"

+
50But the Jews incited the devout women of prominence and the leading men
+of the city, and instigated a persecution against Paul and Barnabas, and
+drove them out of their district. 51But they shook off the dust of their
+feet in protest against them and went to Iconium. 52And the disciples were
+continually filled with joy and with the Holy Spirit.
+
+

!!! scripture "Hebrews 12:1-3"

+
Jesus, the Example
+
+1Therefore, since we have so great a cloud of witnesses surrounding us, let
+us also lay aside every encumbrance and the sin which so easily entangles
+us, and let us run with endurance the race that is set before us, 2fixing
+our eyes on Jesus, the author and perfecter of faith, who for the joy set
+before Him endured the cross, despising the shame, and has sat down at the
+right hand of the throne of God. 3For consider Him who has endured such
+hostility by sinners against Himself, so that you will not grow weary and
+lose heart.
+
+
    +
  1. +

    Harsh treatment of us, particularly for faith, reflects Jesus' life. We stand +with God-incarnate in living for a different kingdom which has negative +consequences for us in the modern age, but obviously not in God's age that's +already here and yet coming.

    +
  2. +
  3. +

    Holy Spirit gives us joy

    +
  4. +
  5. +

    We have long list of people in history who lived faithful lives, struggled +with God, experienced pain, and yet were faithful the Lord by God's own +grace. Similarly we are chosen and favored - the receipients of God's +hesed love.

    +
  6. +
  7. +
+

!!! note "4"

+
When we see how Jesus’ loving way of life has overcome death itself, joy
+starts to become strangely reasonable. But this doesn’t mean it is wise to
+ignore or suppress sorrow. Read 2 Corinthians 6:3-10 . How did Paul
+integrate both joy and sorrow?
+
+

!!! scripture "2 Corinthians 6:3-10"

+
3giving no cause for offense in anything, so that the ministry will not be
+discredited, 4but in everything commending ourselves as servants of God, in
+much endurance, in afflictions, in hardships, in distresses, 5in beatings,
+in imprisonments, in tumults, in labors, in sleeplessness, in hunger, 6in
+purity, in knowledge, in patience, in kindness, in the Holy Spirit, in
+genuine love, 7in the word of truth, in the power of God; by the weapons of
+righteousness for the right hand and the left, 8by glory and dishonor, by
+evil report and good report; regarded as deceivers and yet true; 9as
+unknown yet well-known, as dying yet behold, we live; as punished yet not
+put to death, 10as sorrowful yet always rejoicing, as poor yet making many
+rich, as having nothing yet possessing all things.
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/cheat-on-your-man.html b/cheat-on-your-man.html new file mode 100644 index 00000000..da06f3bf --- /dev/null +++ b/cheat-on-your-man.html @@ -0,0 +1,414 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + cheat on your man | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

cheat on your man

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

man can be a pain to read... and there's lots of alternatives out there and one I've just started playing with is cheat

+

man man will give you this plus a billion more lines of docs, which is useful when you need it...

+
MAN(1)                                                                                                                       Manual pager utils                                                                                                                      MAN(1)
+
+NAME
+       man - an interface to the on-line reference manuals
+
+SYNOPSIS
+       man  [-C  file]  [-d] [-D] [--warnings[=warnings]] [-R encoding] [-L locale] [-m system[,...]] [-M path] [-S list] [-e extension] [-i|-I] [--regex|--wildcard] [--names-only] [-a] [-u] [--no-subpages] [-P pager] [-r prompt] [-7] [-E encoding] [--no-hyphenation]
+       [--no-justification] [-p string] [-t] [-T[device]] [-H[browser]] [-X[dpi]] [-Z] [[section] page[.section] ...] ...
+       man -k [apropos options] regexp ...
+       man -K [-w|-W] [-S list] [-i|-I] [--regex] [section] term ...
+       man -f [whatis options] page ...
+       man -l [-C file] [-d] [-D] [--warnings[=warnings]] [-R encoding] [-L locale] [-P pager] [-r prompt] [-7] [-E encoding] [-p string] [-t] [-T[device]] [-H[browser]] [-X[dpi]] [-Z] file ...
+       man -w|-W [-C file] [-d] [-D] page ...
+       man -c [-C file] [-d] [-D] page ...
+       man [-?V]
+
+DESCRIPTION
+       man is the system's manual pager.  Each page argument given to man is normally the name of a program, utility or function.  The manual page associated with each of these arguments is then found and displayed.  A section, if provided, will direct  man  to  look
+       only  in  that  section of the manual.  The default action is to search in all of the available sections following a pre-defined order ("1 n l 8 3 2 3posix 3pm 3perl 3am 5 4 9 6 7" by default, unless overridden by the SECTION directive in /etc/manpath.config),
+       and to show only the first page found, even if page exists in several sections.
+
+       The table below shows the section numbers of the manual followed by the types of pages they contain.
+
+       1   Executable programs or shell commands
+       2   System calls (functions provided by the kernel)
+       3   Library calls (functions within program libraries)
+       4   Special files (usually found in /dev)
+       5   File formats and conventions eg /etc/passwd
+       6   Games
+       7   Miscellaneous (including macro packages and conventions), e.g. man(7), groff(7)
+       8   System administration commands (usually only for root)
+       9   Kernel routines [Non standard]
+
+       A manual page consists of several sections.
+
+       Conventional section names include NAME, SYNOPSIS, CONFIGURATION, DESCRIPTION, OPTIONS, EXIT STATUS, RETURN VALUE, ERRORS, ENVIRONMENT, FILES, VERSIONS, CONFORMING TO, NOTES, BUGS, EXAMPLE, AUTHORS, and SEE ALSO.
+
+       The following conventions apply to the SYNOPSIS section and can be used as a guide in other sections.
+
+       bold text          type exactly as shown.
+       italic text        replace with appropriate argument.
+       [-abc]             any or all arguments within [ ] are optional.
+       -a|-b              options delimited by | cannot be used together.
+       argument ...       argument is repeatable.
+       [expression] ...   entire expression within [ ] is repeatable.
+
+       Exact rendering may vary depending on the output device.  For instance, man will usually not be able to render italics when running in a terminal, and will typically use underlined or coloured text instead.
+
+       The command or function illustration is a pattern that should match all possible invocations.  In some cases it is advisable to illustrate several exclusive invocations as is shown in the SYNOPSIS section of this manual page.
+
+EXAMPLES
+       man ls
+           Display the manual page for the item (program) ls.
+
+       man man.7
+           Display the manual page for macro package man from section 7.
+
+

But what if you don't?

+

cheat man

+
# To convert a man page to pdf:
+man -t bash | ps2pdf - bash.pdf
+
+# To view the ascii chart:
+man 7 ascii
+
+

You get tiny examples to remind you of what you probably are trying to do!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/check-your-bios-version-on-ubuntu.html b/check-your-bios-version-on-ubuntu.html new file mode 100644 index 00000000..f7e210b3 --- /dev/null +++ b/check-your-bios-version-on-ubuntu.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Check Your BIOS Version On Ubuntu | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Check Your BIOS Version On Ubuntu

+ + + + + +
+ + + +
+

sudo dmidecode -s bios-version

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/check-your-smart-status-with-smartctl.html b/check-your-smart-status-with-smartctl.html new file mode 100644 index 00000000..3cc22445 --- /dev/null +++ b/check-your-smart-status-with-smartctl.html @@ -0,0 +1,386 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Check your SMART status with smartctl | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Check your SMART status with smartctl

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

https://www.simplified.guide/linux/disk-health-check

+

Install

+

For ubuntu/debian based distros (which is what I primarly use presently)

+

sudo apt update -y && sudo apt install smartmontools -y

+

List hard drives

+

lsblk | grep disk is one way or sudo lshw -c disk is another

+

smartctl

+

Use a device's logical name such as dev/sda, not a partition of the disk

+

sudo smartctl -t short /dev/sda

+
dotfiles   home   ×3  ×2  ×2 via   v3.10.6(dotfiles)  took 11s
+❯ sudo smartctl -t short /dev/sda
+smartctl 7.1 2019-12-30 r5022 [x86_64-linux-5.15.0-48-generic] (local build)
+Copyright (C) 2002-19, Bruce Allen, Christian Franke, www.smartmontools.org
+
+=== START OF OFFLINE IMMEDIATE AND SELF-TEST SECTION ===
+Sending command: "Execute SMART Short self-test routine immediately in off-line mode".
+Drive command "Execute SMART Short self-test routine immediately in off-line mode" successful.
+Testing has begun.
+Please wait 2 minutes for test to complete.
+Test will complete after Fri Sep 23 05:59:39 2022 CDT
+Use smartctl -X to abort test.
+
+

check status

+

sudo smartctl -H /dev/sda

+

+dotfiles   home   ×3  ×2  ×2 via   v3.10.6(dotfiles)
+❯ sudo smartctl -H /dev/sda
+smartctl 7.1 2019-12-30 r5022 [x86_64-linux-5.15.0-48-generic] (local build)
+Copyright (C) 2002-19, Bruce Allen, Christian Franke, www.smartmontools.org
+
+=== START OF READ SMART DATA SECTION ===
+SMART overall-health self-assessment test result: PASSED
+
+
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/configure-bridge-network-on-ubuntu-22-04-with-netplan.html b/configure-bridge-network-on-ubuntu-22-04-with-netplan.html new file mode 100644 index 00000000..7bfa9890 --- /dev/null +++ b/configure-bridge-network-on-ubuntu-22-04-with-netplan.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Configure bridge network on Ubuntu 22.04 with Netplan | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Configure bridge network on Ubuntu 22.04 with Netplan

+ + + + + +
+ + + +
+

See 02-....yaml in ansible-nas

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/convert-word-doc-to-pdf-with-headless-libreoffice.html b/convert-word-doc-to-pdf-with-headless-libreoffice.html new file mode 100644 index 00000000..023c7f8d --- /dev/null +++ b/convert-word-doc-to-pdf-with-headless-libreoffice.html @@ -0,0 +1,340 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Convert Word Doc to PDF with Headless Libreoffice | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Convert Word Doc to PDF with Headless Libreoffice

+ + + + + +
+ + + +
+

I've been using paperless-ngx to manage all my documents, but every once in a while I'll get a .docx file to deal with...

+

Turns out Libreoffice has a headless mode a pdf converter built-in!

+
libreoffice --headless --convert-to pdf /path/to/file.docx --outdir /path/to/output/directory
+
+
+

Note that --outdir is in fact a directory, not the path to a file

+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/cron-for-nextcloud-in-docker.html b/cron-for-nextcloud-in-docker.html new file mode 100644 index 00000000..354f9c68 --- /dev/null +++ b/cron-for-nextcloud-in-docker.html @@ -0,0 +1,369 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Cron for Nextcloud in Docker | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Cron for Nextcloud in Docker

+ + + + + +
+ + + +
+

AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entrypoint to /cron.sh that does what you need!

+
+

Note that this is a task in an Ansible playbook - but the docker-compose is straight forward

+
+

So the only thing you need to make sure of is that all the configuration +options - data volumes, user permissions, etc. are identical between the +containers running the cron job and the one actually hosting NextCloud. This +ensures that the container running cron has proper access to the database and +filesystem - or at least the same access as NextCloud proper.

+
- name: Nextcloud Cron Docker Container
+  docker_container:
+    name: nextcloud-cron
+    image: "{{ nextcloud_image }}"
+    pull: true
+    links:
+      - nextcloud-mysql:mysql
+    entrypoint: /cron.sh
+    volumes:
+      - "{{ nextcloud_data_directory }}/nextcloud:/var/www/html:rw"
+    env:
+      MYSQL_HOST: "mysql"
+      MYSQL_DATABASE: "nextcloud"
+      MYSQL_USER: "{{ nextcloud_sql_user }}"
+      MYSQL_PASSWORD: "{{ nextcloud_sql_password }}"
+      NEXTCLOUD_TRUSTED_DOMAINS: "{{ nextcloud_hostname }}.{{ ansible_nas_domain }}"
+      PUID: "{{ nextcloud_user_id }}"
+      PGID: "{{ nextcloud_group_id }}"
+      TZ: "{{ ansible_nas_timezone }}"
+    restart_policy: unless-stopped
+    memory: "{{ nextcloud_memory }}"
+
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/customize-k9s.html b/customize-k9s.html new file mode 100644 index 00000000..00d9d850 --- /dev/null +++ b/customize-k9s.html @@ -0,0 +1,356 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Customize K9s | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Customize K9s

+ + + + + +
+ + + +
+

To customize k9s use the skins from catppuccin or the ones k9s supplies

+
OUT="${XDG_CONFIG_HOME:-$HOME/.config}/k9s/skins"
+mkdir -p "$OUT"
+curl -L https://github.com/catppuccin/k9s/archive/main.tar.gz | tar xz -C "$OUT" --strip-components=2 k9s-main/dist
+
+

Then edit your k9s config

+
# ~/.config/k9s/config.yml
+k9s:
+  ui:
+    skin: catppuccin-mocha
+    # ...or another flavor:
+    # skin: catppuccin-macchiato
+    # skin: catppuccin-frappe
+    # skin: catppuccin-latte
+
+    # ...or the transparent variants:
+    # skin: catppuccin-mocha-transparent
+    # skin: catppuccin-macchiato-transparent
+    # skin: catppuccin-frappe-transparent
+    # skin: catppuccin-latte-transparent
+
+

Other k9s skins are available here

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dataframe-memory-usage.html b/dataframe-memory-usage.html new file mode 100644 index 00000000..0ee0a80b --- /dev/null +++ b/dataframe-memory-usage.html @@ -0,0 +1,357 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Dataframe-Memory-Usage | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Dataframe-Memory-Usage

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I have often wanted to dive into memory usage for pandas DataFrames when it comes to cloud deployment. +If I have a python process running on a server at home I can use glances or a number of other tools to diagnose a memory issue... +However at work I normally deploy dockerized processes on AWS Batch and it's much more challenging to get info on the dockerized process without more AWS integration that my team isn't quite ready for. +So TIL that I can get some of the info I want from pandas directly!

+

DataFrame.info()

+

I didn't realize that df.info() was able to give me more info than just dtypes and some summary stats... +There is a kwarg memory_usage that can configure what you need to get back, so df.memory_usage="deep" will give you how much RAM any given DataFrame is using! +Amazing tool for finding issues with joins or renegade source data files.

+
df = pd.read_csv("cars.csv")
+
+df.info(memory_usage="deep")
+
+

Alt text
DF memory

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dataframe-to-markdown.html b/dataframe-to-markdown.html new file mode 100644 index 00000000..3ae98571 --- /dev/null +++ b/dataframe-to-markdown.html @@ -0,0 +1,388 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Dataframe-To-Markdown | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Dataframe-To-Markdown

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Pandas

+

pandas.DataFrames are pretty sweet data structures in Python.

+

I do a lot of work with tabular data and one thing I have incorporated into some of that work is automatic data summary reports by throwing the first few, or several relevant, rows of a dataframe at a point in a pipeline into a markdown file.

+

Pandas has a method on DataFrames that makes this 100% trivial!

+

The Method

+

Say we have a dataframe, df... then it's literally just: df.to_markdown()

+
❯ df.head()
+
+          Unnamed: 0   mpg  cyl   disp   hp  drat     wt   qsec  vs  am  gear  carb
+0          Mazda RX4  21.0    6  160.0  110  3.90  2.620  16.46   0   1     4     4
+1      Mazda RX4 Wag  21.0    6  160.0  110  3.90  2.875  17.02   0   1     4     4
+2         Datsun 710  22.8    4  108.0   93  3.85  2.320  18.61   1   1     4     1
+3     Hornet 4 Drive  21.4    6  258.0  110  3.08  3.215  19.44   1   0     3     1
+4  Hornet Sportabout  18.7    8  360.0  175  3.15  3.440  17.02   0   0     3     2
+
+
+

In ipython I can call the method and get a markdown table back as a string

+

+mental-data-lake   new-posts via 3.8.11(mental-data-lake) ipython
+❯ df.head().to_markdown()
+'|    | Unnamed: 0        |   mpg |   cyl |   disp |   hp |   drat |    wt |   qsec |   vs |   am |   gear |   carb |\n|---:|:------------------|------:|------:|-------:|-----:|-------:|------:|-------:|-----:|-----:|-------:|-------:|\n|  0 | Mazda RX4         |  21   |     6 |    160 |  110 |   3.9  | 2.62  |  16.46 |    0 |    1 |      4 |      4 |\n|  1 | Mazda RX4 Wag     |  21   |     6 |    160 |  110 |   3.9  | 2.875 |  17.02 |    0 |    1 |      4 |      4 |\n|  2 | Datsun 710        |  22.8 |     4 |    108 |   93 |   3.85 | 2.32  |  18.61 |    1 |    1 |      4 |      1 |\n|  3 | Hornet 4 Drive    |  21.4 |     6 |    258 |  110 |   3.08 | 3.215 |  19.44 |    1 |    0 |      3 |      1 |\n|  4 | Hornet Sportabout |  18.7 |     8 |    360 |  175 |   3.15 | 3.44  |  17.02 |    0 |    0 |      3 |      2 |'
+
+
+

You can drop that string into a markdown file and using any reader that supports the rendering you'll have a nicely formated table of example data in whatever report you're making!

+

Bonus method

+

Just like markdown, you can export a dataframe to html with df.to_html() and use that if it's more appropriate for your use case:

+

+'<table border="1" class="dataframe">\n  <thead>\n    <tr style="text-align: right;">\n      <th></th>\n      <th>Unnamed: 0</th>\n      <th>mpg</th>\n      <th>cyl</th>\n      <th>disp</th>\n      <th>hp</th>\n      <th>drat</th>\n      <th>wt</th>\n      <th>qsec</th>\n      <th>vs</th>\n      <th>am</th>\n      <th>gear</th>\n      <th>carb</th>\n    </tr>\n  </thead>\n  <tbody>\n    <tr>\n      <th>0</th>\n      <td>Mazda RX4</td>\n      <td>21.0</td>\n      <td>6</td>\n      <td>160.0</td>\n      <td>110</td>\n      <td>3.90</td>\n      <td>2.620</td>\n      <td>16.46</td>\n      <td>0</td>\n      <td>1</td>\n      <td>4</td>\n      <td>4</td>\n    </tr>\n    <tr>\n      <th>1</th>\n      <td>Mazda RX4 Wag</td>\n      <td>21.0</td>\n      <td>6</td>\n      <td>160.0</td>\n      <td>110</td>\n      <td>3.90</td>\n      <td>2.875</td>\n      <td>17.02</td>\n      <td>0</td>\n      <td>1</td>\n      <td>4</td>\n      <td>4</td>\n    </tr>\n    <tr>\n      <th>2</th>\n      <td>Datsun 710</td>\n      <td>22.8</td>\n      <td>4</td>\n      <td>108.0</td>\n      <td>93</td>\n      <td>3.85</td>\n      <td>2.320</td>\n      <td>18.61</td>\n      <td>1</td>\n      <td>1</td>\n      <td>4</td>\n      <td>1</td>\n    </tr>\n    <tr>\n      <th>3</th>\n      <td>Hornet 4 Drive</td>\n      <td>21.4</td>\n      <td>6</td>\n      <td>258.0</td>\n      <td>110</td>\n      <td>3.08</td>\n      <td>3.215</td>\n      <td>19.44</td>\n      <td>1</td>\n      <td>0</td>\n      <td>3</td>\n      <td>1</td>\n    </tr>\n    <tr>\n      <th>4</th>\n      <td>Hornet Sportabout</td>\n      <td>18.7</td>\n      <td>8</td>\n      <td>360.0</td>\n      <td>175</td>\n      <td>3.15</td>\n      <td>3.440</td>\n      <td>17.02</td>\n      <td>0</td>\n      <td>0</td>\n      <td>3</td>\n      <td>2</td>\n    </tr>\n  </tbody>\n</table>'
+
+
+

My blog will render that html into a nice table! (After removing new line characters)

+
Unnamed: 0 mpg cyl disp hp drat wt qsec vs am gear carb
Mazda RX4 21.0 6 160.0 110 3.90 2.620 16.46 0 1 4 4
Mazda RX4 Wag 21.0 6 160.0 110 3.90 2.875 17.02 0 1 4 4
Datsun 710 22.8 4 108.0 93 3.85 2.320 18.61 1 1 4 1
Hornet 4 Drive 21.4 6 258.0 110 3.08 3.215 19.44 1 0 3 1
Hornet Sportabout 18.7 8 360.0 175 3.15 3.440 17.02 0 0 3 2
+ +
+ + + +
+ + + + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dataframe-to-styled-html.html b/dataframe-to-styled-html.html new file mode 100644 index 00000000..50ce7f38 --- /dev/null +++ b/dataframe-to-styled-html.html @@ -0,0 +1,381 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Dataframe-To-Styled-Html | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Dataframe-To-Styled-Html

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I wrote up a little on exporting DataFrames to markdown and html here

+

But I've been playing with a web app for with lists and while I'm toying around I learned you can actually give your tables some style with some simple css classes!

+

To HTML

+

Reminder that if you have a dataframe, df, you can df.to_html() to get an HTML table of your dataframe.

+

Well you can pass some classes to make it look super nice!

+

Classes and CSS

+

I don't know anything really about CSS so I won't pretend otherwise, but as I was learning about bootstrap that's where I stumbled upon this...

+

There are several classes you can pass but I found really good luck with table-bordered and table-dark for my use case

+

df.to_html(classes=["table table-bordered table-dark"])

+ + + + + + + + + + + + + + + + + + + + +
Unnamed: 0 mpgcyl disp hp dratwt qsec vs amgear carb
Mazda RX4 21.0 6 160.0110 3.90 2.620 16.460 1 4 4
Mazda RX4 Wag 21.0 6 160.0110 3.90 2.875 17.020 1 4 4
Datsun 710 22.8 4 108.093 3.85 2.320 18.611 1 4 1
Hornet 4 Drive 21.4 6 258.0110 3.08 3.215 19.441 0 3 1
Hornet Sportabout 18.7 8360.0 175 3.15 3.44017.02 0 0 3 2
+

You try it!

+

Crack open ipython and make a dataframe, then df.to_html(classes=["table table-bordered table-dark"]), copy the output (minus the quote marks ipython uses to denote the string type) that into my-file.html, open that up in a browser and be amazed!

+
+

For added effeciency try using pyperclip to copy the output right to your clipboard!

+
+

pip install pyperclip and then pyperclip.copy(df.to_html(classes=["table table-bordered table-dark"]))

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/deleting-files-on-remote-storage-from-ubuntu-might-not-do-what-you-think.html b/deleting-files-on-remote-storage-from-ubuntu-might-not-do-what-you-think.html new file mode 100644 index 00000000..ad28f2ce --- /dev/null +++ b/deleting-files-on-remote-storage-from-ubuntu-might-not-do-what-you-think.html @@ -0,0 +1,333 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Deleting files on remote storage from Ubuntu might not do what you think | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Deleting files on remote storage from Ubuntu might not do what you think

+ + + + + +
+ + + +
+

From my daily driver Ubuntu machine I often open nautilus, dolphin, etc. and delete a file here or there on my NAS... turns out Ubuntu sends thse file to .Trash-100 ON THE NAS so I'm effectively just moving that file and not freeing up any space...

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/deques.html b/deques.html new file mode 100644 index 00000000..c1e686c9 --- /dev/null +++ b/deques.html @@ -0,0 +1,385 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Deques | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Deques

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I am working on a project to create a small system monitoring dashboard using the python psutil library.

+

The repo is here (if you want actual system monitoring please use netdata).

+

I'm using streamlit and plotly for the webserver, design, and plotting at the moment.

+

My Use Case

+

I needed a way to refresh my plotly charts with a fixed window of time so that I'm able to just see relevant recent data instead of cramming all data for all time into one plot that's 500 pixels wide...

+

Checking the length of arrays or lists every time I get a new piece of data feels kind of dumb and I thought "python must have a way to do this"...

+
+

"This" meaning, update values in a fixed length array without reallocating memory or recreating a copy of the list

+
+

Deques

+

Enter the deque. +It means "double ended queue" and is in general an Iterable that you can append values to either side or pop values from either side.

+

The init signature is straightforward enough and I'm sure there's more to them than I know yet but here's how I use it...

+
from collections import deque
+
+my_deque = deque([1,2,3])
+
+

This gives us my_deque, created from an iterable, with several familiar methods like index, extend, append, etc. +However there's some new ones too such as appendleft and popleft.

+
my_deque.appendleft('a')
+print(my_dequqe)
+>>> deque(['a', 1, 2, 3])
+
+my_deque.popleft()
+>>> 'a'
+print(my_deque)
+>>> deque([1, 2, 3])
+
+

These are handy ways to manipulate the iterable that I needed for the arrays I plot with plotly!

+

See my follow-up to this on using Deques with plotly and streamlit to create a quick "dashboard" with live streaming data!

+

follow-up

+ +
+ + + +
+ + + + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/description-of-my-proposed-vimconf-2022-talk.html b/description-of-my-proposed-vimconf-2022-talk.html new file mode 100644 index 00000000..350b7246 --- /dev/null +++ b/description-of-my-proposed-vimconf-2022-talk.html @@ -0,0 +1,368 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Description of my proposed vimconf 2022 talk | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Description of my proposed vimconf 2022 talk

+ + + + + +
+ + + +
+

Switching to Vim opened a whole new world to me for interacting with a computer +and for getting things done. Before I adopted Vim I used GUIs for everything +because I thought that's how it had to be done... Notes in OneNote, code using +a GUI editor, different notes in TiddlyWiki, slides for work in PowerPoint, +slides for church using Logos, etc... Adopting Vim allowed me to disconnect a +specific tool from the problem that tool is solving - because usually I just +need to write text (notes, code, slides, etc.). Now, very nearly everything I +do is from a text-based and git-based workflow... I put all my notes on +basically anything just in my blog, which is all markdown and deployed to GH +with Markata on every push (living dangerously pushing to main) - and that's +all done easily from Vim with nice syntax highlighting, fast response, +integrated git-plugins, etc.. I keep project-specific task lists just in +markdown files and I have Vim/tmux shortcuts to quickly add todos for any +project (todo list is done with markata todoui) and I can get there fast +because my Vim workflow dovetails with Tmux nicely. Also I can pull that list +up right from the terminal, which I'm already in because Vim.... Vim also +pushed me into the cli more - because Vim is so easily extended with cli tools +and I'm already in the terminal... The builtin functionality also made things +make more sense - no more right-click, find "refactor all" or "rename symbol" +(for some stupid reason)... Vim find-replace is so intuitive and if I need it +extended then I learned what sed was because of Vim. Moving quickly in Vim also +enables me to do my job incredibly fast because I hop into several projects a +day in a coaching role - if I was bound by GUIs I'd be waiting forever for +startup, would lose which GUI instance was which project, etc... Being in the +terminal also made Tmux a trivial choice - now I have 90 tmux sessions, all +named appropriately, ready for me to jump back to and all while keeping the +majority of RAM still free for Chrome. Vim as my IDE also forced me to learn +way more about Python (I'm a python developer primarily), how LSP works, how to +configure a development environment, etc... things I took for granted in my GUI +workflows, or never knew, or worse - thought I knew but deeply misunderstood. +Now that I understand them better, I can coach my peers more effectively even +if they are still in a GUI-based ecosystem.

+

Basically, (Neo)Vim actually did change my life and I'm really thankful for it +(maybe that should be the title?)

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/destroying-tmux-sessions-with-fzf.html b/destroying-tmux-sessions-with-fzf.html new file mode 100644 index 00000000..f15b34d0 --- /dev/null +++ b/destroying-tmux-sessions-with-fzf.html @@ -0,0 +1,355 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Destroying Tmux sessions with fzf | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Destroying Tmux sessions with fzf

+ + + + + +
+ + + +
+

I use Tmux and Vim for most of my workflow, but I end up with a lot of dangling +tmux sessions that dont' really need to persist... but killing them one at a +time is a pain so I wrote a little script-kitty nonsense to pipe multiple +choices from fzf into tmux kill-session

+

I defined a little function in my .zshrc

+
destroy() { 
+    tmux list-sessions -F '#{session_name}' | fzf -m | xargs -d $'\n' sh -c 'echo "killing $0"; tmux kill-session -t "$0"; for arg;do echo "killing $arg";tmux kill-session -t "$arg"; done'
+}
+bindkey -s '^d' 'destroy \n'
+
+

tmux list-sessions -F '#{session_name}' prints all my active tmux sessions to the console with the format of just their name

+
pype.dev   main   ×1 via   v3.8.11(pype.dev)  on  (us-east-1) proxy
+❯ tmux list-sessions -F '#{session_name}'
+session-01
+session-02
+session-03
+...
+
+

Pipe that to fzf -m to allow multiple choices to be made using tab

+

Then the nasty bit in xargs... I echo killing @0 and killing $arg because the sh -c passes the first tmux session name to @0 (it's just what bash does) and then the rest get handled in the for loop.

+

Basically then I get an fzf list to choose multiple tmux sessions to destroy to clean up some RAM!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dhcp-restart-to-save-ubuntu-22-04-server-networking.html b/dhcp-restart-to-save-ubuntu-22-04-server-networking.html new file mode 100644 index 00000000..1dde0c97 --- /dev/null +++ b/dhcp-restart-to-save-ubuntu-22-04-server-networking.html @@ -0,0 +1,335 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + DHCP Restart to Save Ubuntu 22.04 Server Networking | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

DHCP Restart to Save Ubuntu 22.04 Server Networking

+ + + + + +
+ + + +
+

I moved a computer to a remote location for an off-site backup but when it was powered on it wouldn't show up on any networks. A solution that got me back in was a friend restarting the dhcp client for me:

+
sudo dhclient -r -v <interface> && sudo dhclient -v <interface>
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dns-broke-after-reboot-ubuntu-22-04.html b/dns-broke-after-reboot-ubuntu-22-04.html new file mode 100644 index 00000000..e7abf947 --- /dev/null +++ b/dns-broke-after-reboot-ubuntu-22-04.html @@ -0,0 +1,345 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + DNS Broke After Reboot - Ubuntu 22.04 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

DNS Broke After Reboot - Ubuntu 22.04

+ + + + + +
+ + + +
+

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

+

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

+

sudo mkdir /etc/systemd/resolved.conf.d/ +sudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

+

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

+
[Resolve]
+DNS=8.8.8.8 1.1.1.1
+
+

But I decided to use tailscale

+
[Resolve]
+DNS=100.100.100.100
+
+

Then restart systemd-resolved

+

sudo systemctl restart systemd-resolved

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/docker-copy-and-chown.html b/docker-copy-and-chown.html new file mode 100644 index 00000000..3f2310c4 --- /dev/null +++ b/docker-copy-and-chown.html @@ -0,0 +1,336 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Docker copy and chown | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Docker copy and chown

+ + + + + +
+ + + +
+

COPY --chown=myuser:mygroup source-file target-file

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/docker-remote-add.html b/docker-remote-add.html new file mode 100644 index 00000000..d59b8a34 --- /dev/null +++ b/docker-remote-add.html @@ -0,0 +1,340 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + docker-remote-add | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

docker-remote-add

+ + + + + +
+ + + +
+

Add from url??

+

ADD http://example.com/cars.csv /tmp/cars.csv

+

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

+

ADD myapp.tar.gz /opt/myapp/

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/don-t-forget-to-load-xmp.html b/don-t-forget-to-load-xmp.html new file mode 100644 index 00000000..8976342b --- /dev/null +++ b/don-t-forget-to-load-xmp.html @@ -0,0 +1,333 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Don't forget to load XMP! | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Don't forget to load XMP!

+ + + + + +
+ + + +
+

Bought some DDR4-3600 speed RAM but only seeing 2666? Load up the BIOS, find DRAM config or something similar, and make sure to load the XMP profile to get that advertised RAM speed!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/dynamic-form-values-with-jinja-and-fastapi.html b/dynamic-form-values-with-jinja-and-fastapi.html new file mode 100644 index 00000000..1160c1cf --- /dev/null +++ b/dynamic-form-values-with-jinja-and-fastapi.html @@ -0,0 +1,438 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Dynamic-Form-Values-With-Jinja-And-Fastapi | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Dynamic-Form-Values-With-Jinja-And-Fastapi

+ + + + + +
+ + + + + +
+

I'm currently working on a self-hostable wish list app using FastAPI so we can +finally drop Amazon forever. (The lists funcionality has been super handy for +sharing holiday gift ideas with the famj!)

+

FastAPI

+

FastAPI is an amazing framework for quickly building APIs with Python. I will have a slightly longer post about my brief experience with it coming later...

+

Jinja, Forms, and FastAPI

+

One of the last things I needed to figure out in my app was how to generate a +form in a Jinja template with a dynamic number of inputs and then pass all the +inputs to the backend to perform a database operation (my exact case was +removing rows from a table).

+

Explicit Values

+

The way to pass back explicit variables is really easy...

+

Our form would look like this (I'm using bootstrap CSS)

+
<form method="post">
+    <div class="form-check ">
+        <input class="form-check-input"  name="item_1" id="itemOne" value="1" type="checkbox">
+        <label class="form-check-label" for="itemOne" > A label for this item </label>
+    </div>
+    <div class="form-check ">
+        <input class="form-check-input"  name="item_2" id="itemTwo" value="2" type="checkbox">
+        <label class="form-check-label" for="itemTwo" > A label for item 2 </label>
+    </div>
+
+<button type="submit" class="submit btn btn-xl" >Submit</button>
+</form>
+
+

So what is this? This form will have 2 rows with the lables you see in <label> </label> and checkboxes that when checked would have the value value in each +<input> line.

+

So our backend might looks something like this...

+

I'm keeping all the imports and stuff here to show where they come from but I won't discuss it all here - that'll be in a future post

+
import starlette.status as status
+from fastapi import APIRouter, Depends, Form, Request
+from fastapi.encoders import jsonable_encoder
+from fastapi.responses import HTMLResponse, RedirectResponse
+from fastapi.templating import Jinja2Templates
+from sqlalchemy.orm import Session
+
+from app.session.session import create_get_session
+
+router = APIRouter()
+templates = Jinja2Templates(directory="templates/")
+
+@router.post("/my_route/do_something_with_form", response_class=HTMLResponse)
+async def delete_rows(
+    request: Request,
+    item_1: int = Form(...),
+    item_2: int = Form(...)
+    db: Session = Depends(create_get_session),
+):
+    print(item_1)  # will just print 1 to the console where fastapi is running if the checkbox was checked
+    print(item_2)  # will just print 1 to the console where fastapi is running if the checkbox was checked
+    return RedirectResponse("/", status_code=status.HTTP_302_FOUND)
+
+

Dynamic values

+

That's all pretty simple... pass back values by the name in the form...

+

What about a form that's generated dynamically? This is my case since I display a row/checkbox for every row in my table so my form looks like this...

+
+

data is the result of a database query, and item is each row, so the dot notation is the value of each column basically in that row

+
+
<form method="post">
+  {% for item in data %}
+    <div class="form-check ">
+        <input class="form-check-input"  name="item_{{ item.id }}" id="{{ item.name }}" value="{{ item.id }}" type="checkbox">
+        <label class="form-check-label" for="{{ item.id }}" > Label for: {{ item.name }} </label>
+    </div>
+  {% endfor %}
+
+<button type="submit" class="submit btn btn-xl btn-outline-danger" >Remove</button>
+</form>
+
+
+

This form generates a row with a checkbox for every item in data (in my +case each item is an existing row in my table). Now I started scratching my +head on how to pass an unknown number of inputs to my backend of FastAPI wants +each input explicitly defined and typed... I can't just pass the form back +becuase that's not a thing so what's the way to do it?

+
# same stuff as above, only showing post method here
+@router.post("/my_route/do_something_with_form", response_class=HTMLResponse)
+async def delete_rows(
+    request: Request,
+    db: Session = Depends(create_get_session),
+):
+    form_data = await request.get_form()
+    data = jsonable_encoder(form_data)
+    # data = {"item_1": 1, "item_2": 2, ... "item_N": N}
+    return RedirectResponse("/", status_code=status.HTTP_302_FOUND)
+
+

We await request.get_form() and after encoding the data we get a dictionary with key/value pairs of the name/value from the form!

+

This took me quite a long time to figure out in part because most of the Google-able resources are still on Flask...

+

I look forward to my wish list app maturing and I hope this helps someone working with FastAPI!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/faithful.html b/faithful.html new file mode 100644 index 00000000..861c7195 --- /dev/null +++ b/faithful.html @@ -0,0 +1,548 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Faithful | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Faithful

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

Link

+

Notes

+

!!! Exodusds 34:6

+
Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness
+
+

Faithfulness - Emet (can be translated 'Truth') +Related to "Amen" which is untranslated Hebrew expression meaning "that's truth"

+

Stability

+

Moses has to hold his hands up when Israel faces the Amalekites. Joshua (and another) bring Moses a rock to sit on and hold is hands up so they could be Emet.

+

People

+

Describs trustiworthiness

+

Exodus 18:21 - Moses apoints leaders are to be "Emet"

+

God and promises

+

God is a rock - he is faithful, just, and upright

+

Hebrew word for trust is He'Emin which is the verb form of Emet

+

Abraham considers God Emet, he He'Emin's God and God blesses this by creating Isreal.

+

Israel, In Exodus 14:31, He'Emin's God (until they see the gians in Canaan that is)

+

1 Kings 1:6 says David walked in Emet with God

+

2 Samuel 7:16, God blesses David and says his kingdom will have Emet

+

Romans 15:8-9 says Jesus came on behalf of God's faithfulness.

+

Questions

+

!!! note "1"

+
The Hebrew word “emet” is translated with words like “faithful,”
+“reliable,” “sure,” “trustworthy,” and “amen.” Read aloud Psalm 36:5-6 ,
+Psalm 19:7 , and Psalm 41:13 and discuss what the psalmists are
+communicating in these passages when they use the word “emet.”
+
+

!!! scripture "Psalms 36:5-6"

+
5Your lovingkindness, O Lord, extends to the heavens,
+
+Your faithfulness reaches to the skies.
+
+6Your righteousness is like the mountains of God;
+
+Your judgments are like a great deep.
+
+O Lord, You preserve man and beast.
+
+

!!! scripture "Psalms 19:7"

+
7The law of the Lord is perfect, restoring the soul;
+
+The testimony of the Lord is sure, making wise the simple.
+
+

!!! scripture "Psalms 41:13"

+
13Blessed be the Lord, the God of Israel,
+
+From everlasting to everlasting.
+
+Amen and Amen.
+
+

I think the lesson here is pretty simple - God is faithful, full stop. His +faithfulness doesn't look necessarily like how we might want... when I was a +kid I would be upset if my parents didn't respond to me in the way I wanted, +and my kids will certainly share that disappointment. But I am faithful to my +children - sometimes the main issue is a child's outlook on a situation or +worldview. I think that metaphor holds true in relation to humans and Yahweh - +he sees the whole world, we see a part of it so we cannot understand +faithfulness fully, in the same way that my children can't understand my +faithfulness to them fully - even to the point of being upset or thinking that +I'm not being faithful

+

!!! note "2"

+
God promised the Israelites that he would give them a king of peace that
+would rule forever and ever (e.g. 2 Samuel 7:16). However, Israel’s kingdom
+collapsed and they found themselves without a home or a king. Compare the
+beginning of Psalm 89 (vv. 1-10) with the way it closes (vv. 46-52). What
+do you think it practically looks like to trust God when all seems lost?
+
+

!!! scripture "2 Samuel 7:16"

+
16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”
+
+

!!! scripture "PSALM 89"

+
The Lord’s Covenant with David, and Israel’s Afflictions.
+
+A Maskil of Ethan the Ezrahite.
+
+1I will sing of the lovingkindness of the Lord forever;
+
+To all generations I will make known Your faithfulness with my mouth.
+
+2For I have said, “Lovingkindness will be built up forever;
+
+In the heavens You will establish Your faithfulness.”
+
+3“I have made a covenant with My chosen;
+
+I have sworn to David My servant,
+
+4I will establish your seed forever
+
+And build up your throne to all generations.” Selah.
+
+5The heavens will praise Your wonders, O Lord;
+
+Your faithfulness also in the assembly of the holy ones.
+
+6For who in the skies is comparable to the Lord?
+
+Who among the sons of the mighty is like the Lord,
+
+7A God greatly feared in the council of the holy ones,
+
+And awesome above all those who are around Him?
+
+8O Lord God of hosts, who is like You, O mighty Lord?
+
+Your faithfulness also surrounds You.
+
+9You rule the swelling of the sea;
+
+

!!! note "3"

+
Ultimately, God answers the psalmist’s cries in the person of Jesus. Compare 2 Samuel 7:16
+2 Samuel 7:16
+
+16Your house and your kingdom shall endure before Me forever; your throne shall be established forever.” ’ ”
+
+to Hebrews 1:8-9
+Hebrews 1:8-9
+
+8But of the Son He says,
+
+“Your throne, O God, is forever and ever,
+
+And the righteous scepter is the scepter of His kingdom.
+
+9You have loved righteousness and hated lawlessness;
+
+Therefore God, Your God, has anointed You
+
+With the oil of gladness above Your companions.”
+
+. How does King Jesus embody and fulfill the ancient promises of God (e.g. John 1:14
+John 1:14
+
+The Word Made Flesh
+
+14And the Word became flesh, and dwelt among us, and we saw His glory, glory as of the only begotten from the Father, full of grace and truth.
+
+, Hebrews 3:5-6
+Hebrews 3:5-6
+
+5Now Moses was faithful in all His house as a servant, for a testimony of those things which were to be spoken later; 6but Christ was faithful as a Son over His house—whose house we are, if we hold fast our confidence and the boast of our hope firm until the end.
+
+, and Romans 15:8-9
+Romans 15:8-9
+
+8For I say that Christ has become a servant to the circumcision on behalf of the truth of God to confirm the promises given to the fathers, 9and for the Gentiles to glorify God for His mercy; as it is written,
+
+“Therefore I will give praise to You among the Gentiles,
+
+And I will sing to Your name.”
+
+)?
+
+

!!! note "4"

+
Read Hebrews 10:22-25
+Hebrews 10:22-25
+
+22let us draw near with a sincere heart in full assurance of faith, having our hearts sprinkled clean from an evil conscience and our bodies washed with pure water. 23Let us hold fast the confession of our hope without wavering, for He who promised is faithful; 24and let us consider how to stimulate one another to love and good deeds, 25not forsaking our own assembling together, as is the habit of some, but encouraging one another; and all the more as you see the day drawing near.
+
+, Hebrews 11
+Hebrews 11
+
+The Triumphs of Faith
+
+1Now faith is the assurance of things hoped for, the conviction of things not seen. 2For by it the men of old gained approval.
+
+3By faith we understand that the worlds were prepared by the word of God, so that what is seen was not made out of things which are visible. 4By faith Abel offered to God a better sacrifice than Cain, through which he obtained the testimony that he was righteous, God testifying about his gifts, and through faith, though he is dead, he still speaks. 5By faith Enoch was taken up so that he would not see death; and he was not found because God took him up; for he obtained the witness that before his being taken up he was pleasing to God. 6And without faith it is impossible to please Him, for he who comes to God must believe that He is and that He is a rewarder of those who seek Him. 7By faith Noah, being warned by God about things not yet seen, in reverence prepared an ark for the salvation of his household, by which he condemned the world, and became an heir of the righteousness which is according to faith.
+
+8By faith Abraham, when he was called, obeyed by going out to a place which he was to receive for an inheritance; and he went out, not knowing where he was going. 9By faith he lived as an alien in the land of promise, as in a foreign land, dwelling in tents with Isaac and Jacob, fellow heirs of the same promise; 10for he was looking for the city which has foundations, whose architect and builder is God. 11By faith even Sarah herself received ability to conceive, even beyond the proper time of life, since she considered Him faithful who had promised. 12Therefore there was born even of one man, and him as good as dead at that, as many descendants as the stars of heaven in number, and innumerable as the sand which is by the seashore.
+
+13All these died in faith, without receiving the promises, but having seen them and having welcomed them from a distance, and having confessed that they were strangers and exiles on the earth. 14For those who say such things make it clear that they are seeking a country of their own. 15And indeed if they had been thinking of that country from which they went out, they would have had opportunity to return. 16But as it is, they desire a better country, that is, a heavenly one. Therefore God is not ashamed to be called their God; for He has prepared a city for them.
+
+17By faith Abraham, when he was tested, offered up Isaac, and he who had received the promises was offering up his only begotten son; 18it was he to whom it was said, “In Isaac your descendants shall be called.” 19He considered that God is able to raise people even from the dead, from which he also received him back as a type. 20By faith Isaac blessed Jacob and Esau, even regarding things to come. 21By faith Jacob, as he was dying, blessed each of the sons of Joseph, and worshiped, leaning on the top of his staff. 22By faith Joseph, when he was dying, made mention of the exodus of the sons of Israel, and gave orders concerning his bones.
+
+23By faith Moses, when he was born, was hidden for three months by his parents, because they saw he was a beautiful child; and they were not afraid of the king’s edict. 24By faith Moses, when he had grown up, refused to be called the son of Pharaoh’s daughter, 25choosing rather to endure ill-treatment with the people of God than to enjoy the passing pleasures of sin, 26considering the reproach of Christ greater riches than the treasures of Egypt; for he was looking to the reward. 27By faith he left Egypt, not fearing the wrath of the king; for he endured, as seeing Him who is unseen. 28By faith he kept the Passover and the sprinkling of the blood, so that he who destroyed the firstborn would not touch them. 29By faith they passed through the Red Sea as though they were passing through dry land; and the Egyptians, when they attempted it, were drowned.
+
+30By faith the walls of Jericho fell down after they had been encircled for seven days. 31By faith Rahab the harlot did not perish along with those who were disobedient, after she had welcomed the spies in peace.
+
+32And what more shall I say? For time will fail me if I tell of Gideon, Barak, Samson, Jephthah, of David and Samuel and the prophets, 33who by faith conquered kingdoms, performed acts of righteousness, obtained promises, shut the mouths of lions, 34quenched the power of fire, escaped the edge of the sword, from weakness were made strong, became mighty in war, put foreign armies to flight. 35Women received back their dead by resurrection; and others were tortured, not accepting their release, so that they might obtain a better resurrection; 36and others experienced mockings and scourgings, yes, also chains and imprisonment. 37They were stoned, they were sawn in two, they were tempted, they were put to death with the sword; they went about in sheepskins, in goatskins, being destitute, afflicted, ill-treated 38(men of whom the world was not worthy), wandering in deserts and mountains and caves and holes in the ground.
+
+39And all these, having gained approval through their faith, did not receive what was promised, 40because God had provided something better for us, so that apart from us they would not be made perfect.
+
+, and Hebrews 12:1-3
+Hebrews 12:1-3
+
+Jesus, the Example
+
+1Therefore, since we have so great a cloud of witnesses surrounding us, let us also lay aside every encumbrance and the sin which so easily entangles us, and let us run with endurance the race that is set before us, 2fixing our eyes on Jesus, the author and perfecter of faith, who for the joy set before Him endured the cross, despising the shame, and has sat down at the right hand of the throne of God.
+
+3For consider Him who has endured such hostility by sinners against Himself, so that you will not grow weary and lose heart.
+
+. After reading these passages, name one example of what it looks like to put our trust in God.
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/ffmpeg-10-bit-videos-to-8-bit.html b/ffmpeg-10-bit-videos-to-8-bit.html new file mode 100644 index 00000000..f8fec22e --- /dev/null +++ b/ffmpeg-10-bit-videos-to-8-bit.html @@ -0,0 +1,336 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + FFMPEG 10-bit videos to 8-bit | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

FFMPEG 10-bit videos to 8-bit

+ + + + + +
+ + + +
+

ffmpeg -i input.mp4 -map 0 -c:v libx264 -vf format=yuv420p -c:a copy output.mp4

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/file-length.html b/file-length.html new file mode 100644 index 00000000..f08d737f --- /dev/null +++ b/file-length.html @@ -0,0 +1,356 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + File-Length | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

File-Length

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I have a specific need for counting the number of lines in a file quickly. +At work we use S3 for data storage during our Kedro pipeline development, and in the development process we may end up orphaning several datasets. +In order to keep our workspace clean I have a short utility that compares the datasets in a Kedro DataCatalog with the files in the relevant S3 location.

+

To get that list I run an internal tool like this:

+
kedro our-liter | grep s3 >> orphaned_datasets.txt
+
+

This simply parses our internal linter for the lines releated to my s3 linter utility and pipes those lines to a file.

+

To get a quick idea of how out of wack a pipeline is I could open the text file in vim, git it with the G and see what line number I'm on but I'm way too lazy for that...

+

AWK

+

awk 'END {print NR}' orphaned_datasets.txt gives me the number of lines and I can alias this to whatever feels appropriate in my zshrc!

+

built-ins for the win!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/filepath-completion-in-neovim.html b/filepath-completion-in-neovim.html new file mode 100644 index 00000000..63822b39 --- /dev/null +++ b/filepath-completion-in-neovim.html @@ -0,0 +1,440 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Filepath Completion in Neovim | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Filepath Completion in Neovim

+ + + + + +
+ + + + + +
+

I've had Plug 'hrsh7th/cmp-path' in my plugins for ever but didn't notice +until recently that I wasn't getting any filepath completion in vim!

+

Fuller setup instructions below the TLDR

+

TL;DR

+

Turns out I need to not be a dope and configure nvim-cmp to actually use it...

+
local cmp = require'cmp'
+
+cmp.setup({
+    -- removed rest of setup - see the rest in my dotfiles
+  sources = cmp.config.sources({
+    { name = 'path' },  -- This needs to be here!
+    })
+})
+
+

My Setup

+

For the sake of completeness here is how I currently (May 2022) configure completion in Neovim usin nvim-cmp

+

Plugins

+

I keep all my plugins in plugins.vim

+
call plug#begin(s:plug_dir)
+Plug 'neovim/nvim-lspconfig'
+Plug 'hrsh7th/cmp-nvim-lsp'
+Plug 'hrsh7th/cmp-buffer'
+Plug 'hrsh7th/cmp-path'
+Plug 'hrsh7th/cmp-cmdline'
+Plug 'hrsh7th/nvim-cmp'
+
+" For ultisnips users.
+<!-- " Plug 'SirVer/ultisnips' -->
+<!-- " Plug 'quangnguyen30192/cmp-nvim-ultisnips' -->
+
+call plug#end()
+
+
+

Vim Settings

+

My vim settings are also kept in their own file, settings.vim

+

+set completeopt=menu,menuone,noselect
+
+
+

nvim-cmp configuration

+

I have a cmp.lua file that gets sourced in init.lua (file structure explained below) for configuring cmp.

+

+  -- Setup nvim-cmp.
+local cmp = require'cmp'
+
+cmp.setup({
+  snippet = {
+    -- REQUIRED - you must specify a snippet engine
+    expand = function(args)
+      -- For `ultisnips` user.
+      vim.fn["UltiSnips#Anon"](args.body)
+    end,
+  },
+  window = {
+      completion = cmp.config.window.bordered(),
+  },
+  mapping = {
+    ['<Down>'] = cmp.mapping.select_next_item({ behavior = cmp.SelectBehavior.Select }),
+    ['<Up>'] = cmp.mapping.select_prev_item({ behavior = cmp.SelectBehavior.Select }),
+    ['<C-d>'] = cmp.mapping.scroll_docs(-4),
+    ['<C-f>'] = cmp.mapping.scroll_docs(4),
+    ['<C-Space>'] = cmp.mapping.complete(),
+    ['<C-e>'] = cmp.mapping.close(),
+    ['<Tab>'] = cmp.mapping(cmp.mapping.select_next_item(), { 'i', 's' }),
+    ['<CR>'] = cmp.mapping.confirm({
+      behavior = cmp.ConfirmBehavior.Replace,
+      select = true,
+    })
+  },
+  sources = cmp.config.sources({
+    { name = 'nvim_lsp' },
+    { name = 'ultisnips' },
+    { name = 'buffer' },
+    { name = 'path' },
+    { name = 'tmux' },
+    })
+})
+
+
+

The sources section is what was key for this post...

+

Piecing it together!

+

My init.vim sources plugins and then settings and then finally calls init.lua. +init.lua sources my cmp.lua file and BANG! auto-completion.

+

More sources

+

hrsh7th's wiki for nvim-cmp is here and has example configs as well as a list of sources...

+

Don't forget to configure and not just install!

+

my dotfiles

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/filtering-emails-with-core-utils.html b/filtering-emails-with-core-utils.html new file mode 100644 index 00000000..0dbfea56 --- /dev/null +++ b/filtering-emails-with-core-utils.html @@ -0,0 +1,354 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Filtering emails with core utils | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Filtering emails with core utils

+ + + + + +
+ + + +
+
email1@me.com
+somebody_else@gmail.com
+
+
+
#! /bin/bash
+# pick multiple emails from list and combine into comma seperated array
+emails=`cat .../emails | fzf -m | sed 's/^\|$/"/g'|paste -sd,` 
+
+echo $emails
+
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/fonts-in-vs-c-e.html b/fonts-in-vs-c-e.html new file mode 100644 index 00000000..f7b73fab --- /dev/null +++ b/fonts-in-vs-c-e.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Fonts in VS C**e | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Fonts in VS C**e

+ + + + + +
+ + + +
+

Jet Brains has to be specified 'JetBrainsMono Nerd Font Mono'

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/forms-with-fastapi-and-jinja.html b/forms-with-fastapi-and-jinja.html new file mode 100644 index 00000000..d61e39bc --- /dev/null +++ b/forms-with-fastapi-and-jinja.html @@ -0,0 +1,391 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Forms with FastAPI and Jinja | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Forms with FastAPI and Jinja

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I just started using FastAPI for a home project and needed to pass back a +dynamic number of values from a form rendered with jinja...

+

Dynamic Values

+

The jinja templating for rendering HTML based on something like a python iterable is nice and easy

+
+

data is the result of a database query, and item is each row, so the dot notation is the value of each column basically in that row

+
+
<form method="post">
+  {% for item in data %}
+    <div class="form-check ">
+        <input class="form-check-input"  name="item_{{ item.id }}" id="{{ item.name }}" value="{{ item.id }}" type="checkbox">
+        <label class="form-check-label" for="{{ item.id }}" > Label for: {{ item.name }} </label>
+    </div>
+  {% endfor %}
+
+<button type="submit" class="submit btn btn-xl btn-outline-danger" >Remove</button>
+</form>
+
+
+

This form generates a row with a checkbox for every item in data (in my +case each item is an existing row in my table). it?

+

The way to pass back all those values is pretty straight forward (after hours of messing around that is!)

+
# I hate it when tutorials don't show ALL relevant pieces to the blurb
+import starlette.status as status
+from fastapi import APIRouter, Depends, Form, Request
+from fastapi.encoders import jsonable_encoder
+from fastapi.responses import HTMLResponse, RedirectResponse
+from fastapi.templating import Jinja2Templates
+from sqlalchemy.orm import Session
+
+from app.session.session import create_get_session
+
+router = APIRouter()
+templates = Jinja2Templates(directory="templates/")
+
+@router.post("/my_route/do_something_with_form", response_class=HTMLResponse)
+async def delete_rows(
+    request: Request,
+    db: Session = Depends(create_get_session),
+):
+    form_data = await request.get_form()
+    data = jsonable_encoder(form_data)
+    # data = {"item_1": 1, "item_2": 2, ... "item_N": N}
+    return RedirectResponse("/", status_code=status.HTTP_302_FOUND)
+
+

We await request.get_form() and after encoding the data we get a dictionary with key/value pairs of the name/value from the form!

+

This took me quite a long time to figure out in part because most of the Google-able resources are still on Flask...

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/fx-json.html b/fx-json.html new file mode 100644 index 00000000..f8836fa2 --- /dev/null +++ b/fx-json.html @@ -0,0 +1,356 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Fx-Json | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Fx-Json

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

fx is an interactaive JSON viewer for the terminal.

+

It's a simple tool built with Charmcli's Bubble Tea.

+

Installation

+

The installation with go was broken for me - both via the link and direct from the repo. +Now I'm not a gopher so I don't really know how to fix that.

+

Luckily npm install fx also works and got me what I needed!

+

Usage

+

Usage is simple... fx <json file>. +The Github has a few other ways such as curl ... | fx etc.

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/git-ammend-to-a-commit.html b/git-ammend-to-a-commit.html new file mode 100644 index 00000000..62f290eb --- /dev/null +++ b/git-ammend-to-a-commit.html @@ -0,0 +1,333 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Git ammend to a commit | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Git ammend to a commit

+ + + + + +
+ + + +
+

After carefully staging only lines related to a specific change and comitting I suddenly realized I missed one... darn, what do I do?

+

Old me would have soft reset my branch to the previous commit and redone all my careful staging... what a PIA...

+

New me (credit: ThePrimeagen)...

+
# stage other changes I missed
+git commit --amend --no-edit
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/git-bisect.html b/git-bisect.html new file mode 100644 index 00000000..369811e4 --- /dev/null +++ b/git-bisect.html @@ -0,0 +1,433 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Git-Bisect | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Git-Bisect

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I try to commit a lot, and I also try to write useful tests appropriate for the scope of work I'm focusing on, but sometimes I drop the ball...

+

Whether by laziness, ignorance, or accepted tech debt I don't always code perfectly and recently I was dozens of commits into a new feature before realizing I broke something along the way that none of my tests caught...

+

Before today I would've manually reviewed every commit to see if something obvious slipped by me (talk about a time suck 😩)

+

There must be a better way

+

Bisect?

+

git bisect is the magic sauce for this exact problem...

+

You essentially create a range of commits to consider and let git bisect guide you through them in a manner akin to Newton's method for finding the root of a continuous function.

+

How to do it?

+

Start with git bisect start and then choose the first good commit (ie. a commit you know the bug isn't present in)

+

+sandbox   bisect-post   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect start
+
+sandbox   bisect-post (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect good 655332b
+bisect-post  HEAD         main         ORIG_HEAD
+5b31e1e  -- [HEAD]    add successful print (52 seconds ago)
+308247b  -- [HEAD^]   init another loop (77 seconds ago)
+4555c59  -- [HEAD^^]  introduce bug (2 minutes ago)
+9cf6d55  -- [HEAD~3]  add successful loop (3 minutes ago)
+bcb41c3  -- [HEAD~4]  change x to 10 (4 minutes ago)
+3c34aac  -- [HEAD~5]  init x to 1 (4 minutes ago)
+12e53bd  -- [HEAD~6]  print cwd (4 minutes ago)
+655332b  -- [HEAD~7]  add example.py (10 minutes ago)  # <- I want to start at this commit
+59e0048  -- [HEAD~8]  gitignore (23 hours ago)
+fb9e1fb  -- [HEAD~9]  add reqs (23 hours ago)
+
+
+

+sandbox   bisect-post (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect bad 5b31e1e
+bisect-post                                                ORIG_HEAD
+HEAD                                                       refs/bisect/good-655332b6c384934c2c00c3d4aba3011ccc1e5b57
+main
+5b31e1e  -- [HEAD]    add successful print (5 minutes ago)  # <- I start here with the "bad" commit
+308247b  -- [HEAD^]   init another loop (6 minutes ago)
+4555c59  -- [HEAD^^]  introduce bug (6 minutes ago)
+9cf6d55  -- [HEAD~3]  add successful loop (7 minutes ago)
+bcb41c3  -- [HEAD~4]  change x to 10 (8 minutes ago)
+3c34aac  -- [HEAD~5]  init x to 1 (9 minutes ago)
+12e53bd  -- [HEAD~6]  print cwd (9 minutes ago)
+655332b  -- [HEAD~7]  add example.py (14 minutes ago)
+59e0048  -- [HEAD~8]  gitignore (23 hours ago)
+fb9e1fb  -- [HEAD~9]  add reqs (23 hours ago)
+
+
+

After starting bisect with a "good" start commit and a "bad" ending commit we can let git to it's thing!

+

Git checksout a commit somewhere about halfway between the good and bad commit so you can see if your bug is there or not.

+

+sandbox   bisect-post (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect bad 5b31e1e
+Bisecting: 3 revisions left to test after this (roughly 2 steps)
+[bcb41c3854e343eade85353683f2c1c4ddde4e04] change x to 10
+
+sandbox   HEAD (bcb41c38) (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯
+
+

In my example here I have a python script with some loops and print statements - they aren't really relevant, I just wanted an easy to follow git history.

+

So I check to see if the bug is present or not either by running/writing tests or replicating the bug somehow.

+

In this session commit bcb41c38 is actually just fine, so I do git bisect good

+

+sandbox   HEAD (bcb41c38) (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect good
+Bisecting: 1 revision left to test after this (roughly 1 step)
+[4555c5979268dff6c475365fdc5ce1d4a12bd820] introduce bug
+
+
+

And we see that git moves on to checkout another commit...

+

In this case the next commit is the one where I introduced a bug

+

git bisect bad then gives me:

+

+sandbox   HEAD (4555c597) (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect bad
+Bisecting: 0 revisions left to test after this (roughly 0 steps)
+[9cf6d55301560c51e2f55404d0d80b1f1e22a33d] add successful loop
+
+

At 4555c597 the script works as expected so one more git bisect good yields...

+
sandbox   HEAD (9cf6d553) (BISECTING)   ×1 via   v3.8.11(sandbox)  on  (us-east-1)
+❯ git bisect good
+4555c5979268dff6c475365fdc5ce1d4a12bd820 is the first bad commit
+commit 4555c5979268dff6c475365fdc5ce1d4a12bd820
+Author: ########################### 
+Date:   Tue May 3 09:00:00 2022 -0500
+
+    introduce bug
+
+ example.py | 2 +-
+ 1 file changed, 1 insertion(+), 1 deletion(-)
+
+
+
+

What happened?

+

Git sliced up a range of commits based on me saying of the next one was good or bad and localized the commit that introduced a bug into my workflow!

+

I didn't have to manually review commits, click through logs, etc... I just let git checkout relevant commits and I ran whatever was appropriate for reproducing the bug to learn when it was comitted!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/git-fetch-failing-check-your-config.html b/git-fetch-failing-check-your-config.html new file mode 100644 index 00000000..7fb7ddeb --- /dev/null +++ b/git-fetch-failing-check-your-config.html @@ -0,0 +1,348 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Git fetch failing - check your config | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Git fetch failing - check your config

+ + + + + +
+ + + +
+

I started deploying a website to Cloudflare on a branch called pages. Similar to one of the GH Pages deployment patterns. But when my CI was pushing the branch I couldn't see it locally...

+

git fetch -a wasn't pulling any new branches, and git branch -a was only showing my development and main branches at the remote... so what gives?

+

I checked my git config, and to this moment I have no idea how this happened but check out my fetch config:

+
git config --get remote.origin.fetch
++refs/tags/*:refs/tags/*
+
+

So to fix this:

+
git config remote.origin.fetch '+refs/heads/*:refs/remotes/origin/*'
+
+

Now git fetch -a works again

+
> git fetch -a
+
+From github.com:DigitalHarbor7/DigitalHarbor
+   357a28a..969b027  develop    -> origin/develop
+   c052ac9..6d40210  main       -> origin/main
+ * [new branch]      pages      -> origin/pages
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/git-repo-specific-ssh-key.html b/git-repo-specific-ssh-key.html new file mode 100644 index 00000000..1913dd8d --- /dev/null +++ b/git-repo-specific-ssh-key.html @@ -0,0 +1,336 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Git repo specific SSH Key! | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Git repo specific SSH Key!

+ + + + + +
+ + + +
+

git config --add --local core.sshCommand 'ssh -i <<<PATH_TO_SSH_KEY>>>'

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/git-worktrees-01.html b/git-worktrees-01.html new file mode 100644 index 00000000..811d0b93 --- /dev/null +++ b/git-worktrees-01.html @@ -0,0 +1,389 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Git-Worktrees-01 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Git-Worktrees-01

+ + + + + +
+ + + + + +
+

Git

+

Hopefully if you write code you are using git, if not go learn the basics of commit, pull, push, and pull request/merge request like... right now.

+

Assuming you are at least familiar with git then you probably work the same way I have since I've been using it.

+
    +
  1. clone or initialize a repo
  2. +
  3. checkout a branch, git checkout -b my-feature
  4. +
  5. work on my-feature and when ready open a PR into main
  6. +
  7. git pull main then git checkout -b another-feature
  8. +
  9. etc...
  10. +
+

What if you need to switch between branches for some reason? Often I'm jumping into projects with my co-workers left and right, and I'll have changes that I'm either working on or exploring for them. +When it's time to switch branches I think there's more elegant ways than this but I've always done this:

+
    +
  1. stash the current changes
  2. +
  3. checkout out the relevant branch
  4. +
  5. helped out
  6. +
  7. re-checkout my original branch
  8. +
  9. pop the stash
  10. +
+

Now, that's not awful but I think worktrees will make this nicer for a few reasons!

+

Worktrees

+

Worktrees are linked branches that have their own directories somewhere on your computer. +To checkout a branch you don't have to worry about stashing any changes, you just cd into the directory of that branch.

+
+

The branch can be literally anywhere - it doesn't have to be in the repo folder

+
+

Use Case

+

I've seen ThePrimeagean argue for worktrees for several reasons, see a YT video here

+

I'm entirely in Python at the moment, or working with projects that dont' have that kind of requirement (ie. this website). +My reason for wanting worktrees is 3 fold.

+

Files that could have been gitignored but ain't

+

I have a .envrc I put in every project, but it's not gitignored for reasons that aren't relevant right now... +If I switch branches I'll stash everything I have at the time, including my .envrc, but then if I forget to pop the stash and I move on and come back then my environment isn't active and I have to go find the stash, pop it, cd out, and then back in and honestly.... that sucks. +Worktrees will let me have the .envrc in every branch, and if I checkout or switch to a new one, my personal branch is unaffected.

+

Symlinks

+

In my team's Kedro workflow we keep a specific directory, the conf directory at a different spot than the Kedro team has in their templates (the why is outside the scope here). +The way I preserve every kedro utility for my own benefit is to symlink our conf to where the Kedro template expects it to be. +But then everytime I stash changes I lose that symlink so I either just don't have it for the time being or I recreate it which is a hassle +Worktrees will let me have that present and persistent on all my branches at once.

+

Foo

+

Because why not!? This workflow feels future-proof, and if my toolset changes down the line then having this worktree centric workflow might be helpful and I'm just prepping for that possibility!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/hebrew-bible-full-class.html b/hebrew-bible-full-class.html new file mode 100644 index 00000000..f9a57253 --- /dev/null +++ b/hebrew-bible-full-class.html @@ -0,0 +1,563 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Hebrew Bible Full Class | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Hebrew Bible Full Class

+ + + + + +
+ + + + + +
+

Class link +Classroom notes (Must be on home network)

+

01 The Shape of the Hebrew Bible

+

Session 1: What on Earth is the Hebrew Bible?

+

This class is not so much a survey of the HB, it is Tim's attempt to distil the +most helpful things for understanding it in a consumable way for laypeople.

+

A chunk of this is the other people giving some of their own background. One +lady said something that might be helpful for ministry - "Maybe that thing that +I saw as 'you don't love me' is 'I don't know how to love you'"

+

!!! note "how to love"

+
Maybe that thing that I saw as 'you don't love me' is 'I don't know how to love you'
+
+

!!! danger "Christian coping strategy for the Olt Testament"

+
1. Hero-example model
+    * Stories get isolated and distilled down into a simple moral model, where the hero is just the hero.
+    * Veggie-Tales is uber-guilty of this nonsense
+    * There's something correct about this - but the oversimplification usually comes out of a massive re-writting of the stories, then anyone raised on those versions of the story is scaldalized when they read it for real
+
+2. Poltical-authority source
+    * Political parties hijacking "The Bible says X about Y" as a means to harvest authority from a book that many people claim is authoritative.
+
+3. Theology answer book model
+    * Treating the Bible like a dictionary of key/value pairs where keys are questions and values are simple answers.
+    * This ignores narrative, and general literacy.
+    * The instinct may be right - the Bible should profoundly shape my view of everything, but it isn't simple
+
+4. Inspirational-heart-warming model
+    * Verse-a-day calendars
+    * Jermiah 29:11
+
+

!!! warning ""

+
Are we imposing a set of questions that are foreign to what the authors are
+trying to communicate? do we need to set our cultural agendas aside to just
+listen?
+
+

A result of asking the wrong questions is the common story of people's faith being dismantled by reading the Bible

+

!!! note "DL Baker - Two Testaments - One Bible"

+
One of the most fundamental questions which has faced theology and the
+Church in every age... is whether or not Christianity also needs an Old
+Testament. Is the Old Testament to be thrown away as obsolete, or pre-
+served as a relic from days of yore, or treasured as a classic and read by
+scholars, or used occasionally as a change from the New Testament, or
+kept in a box in case it should be needed some day? Or is the Old Testa-
+ment an essential part of the Christian Bible, with continuing validity along-
+side the New Testament? —
+
+

Session 2: How Jesus and the Apostle ReadTheir Bibles

+

The Bible most often refers to itself as the Writings

+

!!! note "Road to Emmaus"

+
Jesus confronts a couple guys walking to Emmaus after he is resurrected and
+more or less calls them idiots/fools for not understanding that the
+Writings point to an annointed king who will suffer death for the sake of
+redemption. He's recognized by them once their eyes are opened then he vanishes
+
+

Weird stuff

+

Paul and Timothy

+

Paul assumes when writing to Timothy that he, and probably believers in general, are in a community of people who are regularly learning about Yahweh through the Scriptures as a family

+

!!! scripture "2 Timothy 3:15-16"

+
... and that from childhood you ahve known the sacred writings which are
+able to give you the wisdom that leas to salvation through faith which is
+in Christ Jesus. All Scripture is inspired by God and profitable for
+teaching, for reproof, for correction, for training in righteousness
+
+

!!! success ""

+
For Paul, the `Scriptures` here are our OT, the Hebrew Bible. For Paul, the HB
+is entirely _wisdom literature_ that leads to salvation through Jesus
+
+

The question of "What are the Scriptures?" is covered in the next session

+

To answer the question 'How do we read the HB?' we have to ask the question +'Whose book is the HB?'

+

Session 3: Shape of the Scriptures

+

Old Testament is the Christian term for a set of writings that comprise about +3/4 of the Christian Bible. The authors themselves though refer to those +writings as the Scriptures. One time it is called the Old Covenant by Paul +, but he's talking about Synagogue readings of the Torah portion in synagogues. +THe phrase Hebrew Bible is a modern term that is a bit more neutral.

+
+

So, what is our Bible?

+
+

!!! scripture "Luke 24:25-27"

+
25 And he said to them, “O foolish ones, and slow of
+heart to believe all that the prophets have spoken! 26 Was it not necessary
+that the Christ should suffer these things and enter into his glory?”
+27 And beginning with Moses and all the Prophets, he interpreted to them in
+all the Scriptures the things concerning himself.
+
+
+

Moses and the Prophets

+
+

TaNaK

+

Jweish reference to the books in our OT, in the Hebrew Bible, but the arangement is different...

+

!!! note "TaNaK"

+
1. T = Torah (first 5 books)
+2. N - Nevi'im (Prophets: Joshua - Kings) [Christians often call these the 'historial books']
+3. K - Ketuvim
+
+| **Torah** | **Pentateuch** |
+| --- | --- |
+| Genesis - Exodus - Leviticus - Numbers Deuteronomy | Genesis - Exodus - Leviticus - Numbers - Deuteronomy |
+| **Nevi'im - The Prophets** | **History** |
+| *Former Prophets* <br/> Joshua - Judges - Samueal - Kings | Joshua - Judges - Ruth <br/> 1-2 Samuel - 1-2 Kings <br/> 1-2 Chronicles <br/> Ezra - Nehemiah - Ester |
+| *Later Prophets* <br/> Isaiah - Jeremiah - Ezekiel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi | **Poetry** <br/> Job - Psalms - Proverbs - Ecclesiastes - Song of Solomon |
+| **Kethuvim - The Writings** | **Prophets** |
+| Psalms - Job - Proverbs <br/> Ruth - Song of Songs - Ecclesiastes - Lamentations - Esther [The Megillot] <br/> Daniel - Ezra - Nehemiah - Chronicles | Isiah - Jeremiah - Lamentations <br/> Ezekiel - Daniel <br/> Hosea - Joel - Amos - Obadiah - Jonah - Micah - Nahum - Habakkuk - Zephaniah - Haggai - Zechariah - Malachi |
+
+

!!! scripture "Luke 11:49–51 (ESV) "

+
49 Therefore also the Wisdom of God said, ‘I will send them prophets and
+apostles, some of whom they will kill and persecute,’ 50 so that the blood
+of all the prophets, shed from the foundation of the world, may be charged
+against this generation, 51 from the blood of Abel to the blood of
+Zechariah, who perished between the altar and the sanctuary. Yes, I tell
+you, it will be required of this generation.
+
+
+

Blood of Abel to the blood of Zechariah...

+
+

Why would Jesus pick these two events? Abel is murdered on page 4, Zechariah is +murdered in the last part of Chronicles, which in the TaNaK is significant... +Jesus is saying that all the prophets from the beginning of the Scriptures to +the end... All the prophets from A-Z so to speak

+

!!! note "Scriptures"

+
"Books" as we know it, bound papers with writing on it, called a 'codex'
+wasn't a thing until a couple hundred years post-Jesus... so when the
+authors say "The Scriptures" we need to keep in mind that Jews had the
+scriptures in their minds and hearts, not on paper (save for a couple very
+expensive scrolls). So the structure of the scriptures is also apart of the
+Jewish being... This interaction with the Scriptures is _very very very
+different than how we interact with the Bible_
+
+

!!! note "4QMMT"

+
"The scrolls of Moses, the words of the prophets, and of David."
+
+

!!! note "Philo of Alexandria"

+
The laws and the oracles given by inspiration through the prophets and the
+Psalms, and the other scrolls whereby knowledge and piety are increased and
+completed...
+
+- De Vita Contemplatetiva, 25
+
+

Melito of Sardis

+
    +
  • Early 200s
  • +
  • One of the earliest Christians to talk about the books/scrolls of Christian scriptures
  • +
  • Summarizes Christian ordering of the Hebrew Bible with some logic +
      +
    • Foundation narrative of the Pentateuch
    • +
    • History
    • +
    • Poetry
    • +
    • Prophets then point forward to the coming Messiah, Jesus, and the NT writings
    • +
    +
  • +
+

Session 4 - Seams between Texts in the Dead Sea Scrolls

+

Around 100-200 AD there was a split in the Jewish community over things like +how the Temple and sacrifices were to be run, etc. A group got kicked out, so +they grabbed some scrolls and went to start what we'd think of as a Monastic +community. Qumran community is where they went, and the scrolls this group +managed are called the Dead Sea Scrolls.

+

Out of DSS we have some of the oldest biblical scrolls, they have their own +writings and liturgies since they were all priests basically too.

+

The scrolls were hidden in caves before the Romans marched on Qumran. They were +found in the 1940s by a bunch of shepherds. A few showed up online for sale and +that's how we found out about their exitence.... These scrolls give us +pre-Christian Jewish Bible nerds...

+

Qumran community didn't know about Jesus - they thought the Messiah would be a +man called The Teacher of Righteousness

+

Scroll-making

+

The DSS preserved for us, not only ancient biblical texts, but also the method +by which scrolls were created. They were well-preserved papyrus that was +stiched together - literal stitches. We also have obvious additions from Qumran +community as well as notes from priests and corrections from missed +transcribing.

+

Our Bible

+

The DSS scrolls, being the oldest stitched together set of scrolls, teach us +how scrolls and collections of ancient holy texts were put together. We need to +keep this in mind when we think about where our Christian Bible came from

+

The beginning and ending of our books might/are filled with hyperlinks that +call a reader's mind back to other stories. It's the way of linking context and +stories to one another before the writings are in a codex

+
+

Hyperlinks - language/syntax that remind a reader of antoher scroll - help us +understand the structure of the Hebrew Bible

+
+

!!! note "A favorite quote from Tim"

+
So, you can see I'm interested in a historical question of like the
+collection [Hebrew Bible] was produced by a group of people. What did they
+mean by it? And we can actually know a lot about what they meant and locate
+them and read it the way they wanted us to read it, and pick up what
+they're saying. And, lo and behold, you know, I hope to convince you
+that—and this is all pre-Christian—what's happening here and what this all
+points to and means, fits hand in glove with how Jesus and Paul and the
+apostles talk about these texts.
+So that's different from saying nobody
+knew what these texts meant. The events of Jesus happen, and then we go
+reread it, and it has a whole new meaning that no one has ever imagined. It
+seems to me what actually happened in history was a little more interesting
+and complicated than that.  [17:30-18:21]
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/home-server-refactor.html b/home-server-refactor.html new file mode 100644 index 00000000..a8bcbe4a --- /dev/null +++ b/home-server-refactor.html @@ -0,0 +1,440 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Home-Server-Refactor | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Home-Server-Refactor

+ + + + + +
+ + + + + +
+

My current homelab setup is not great but it works...

+

Proxmox on PowerEdge R610

+

I boot off an SD card and have 1 SSD and 5 HDDs configured as a JBOD array using a Dell H700 SAS controller. +I cannot boot from a disk using this controller and I can't get the firmware configured in a way to allow it. +So I have 1 SSD as a ZFS array that I've been putting my VM images on, and the 5 HDDs are passed through to a TrueNAS VM where I handle all the ZFS stuff there... kind of meta because I then attached those drives to Proxmox as a CIFS share.

+

TrueNAS on dedicated box

+

I have an on-prem backup that is just an old desktop running TrueNAS +I regularly backup the 5 disk RAIDZ2 array from my Proxmox host (managed by a TrueNAS VM) to this backup box

+

Currently there is nothing else running on this machine since it's my "backup"

+

Jellyfin

+

I was HWA for Jellyfin, but hardware passthrough on the R610 is finicky or broken so Jellyfin is running on an Ubuntu host.

+

I could put UBuntu on the R610 and give up "true virtualization". Then I'd manage the SMB share myself. +If I do that then I would get rid of "users" I think, ie. basically forgo least-priviledges since I'm not sure how hard that is to manage.

+

On the other hand, direct access to the smb config might make it easier?

+

I have the media array on Jellyfin box setup as NFS which was really easy with ZFS... I think SMB would be just as easy.

+

Plan of attack...

+
    +
  1. Move all vm disks to individual datasets on the NAS
  2. +
  3. Backup docker data... not sure how well this will work, maybe just start over?
  4. +
  5. Clean up Ansible playbooks on the user side of things - stick with neville vs just using my own name?
  6. +
  7. Install Ubuntu 20 or 22 on a 2.5" drive that I'll toss in this SSD enclosure (or a usb thumb stick?)
  8. +
  9. Re-deploy everything with ansible-playbook and configure...
  10. +
+

Configuration...

+
    +
  1. THE FREAKING NAS -> just import zfs array and configure SMB?
  2. +
+

1.~~ Nextcloud users and connections.. might be able to just copy the data folder? not sure about the database... try spinning it up in the sandbox vm and see if stuff is there ~~ +2.~~ *arr suite, media profiles and connections to transmission... nothing major~~ +3. transmission - should be deploy and go +4. ombi and jackett should also just work after some config again +5. traefik should just work +6. try to bring up pi-hole from the vm that's already running +7. heimdall will hopefully just be copying the data folder from the existind docker one' +8.~~ booksonic can be reconfigured easily~~ +9. portainer... hopefully just copying data folder over? +10. littlelink, small-group-notes, and blog (at home) will need manually re-deployed once Ubuntu is installed bare-metal

+

BIG BIG BIG TODOS

+
    +
  1. +

    Sanoid/syncoid! Get snapshots going and backups configured with on prem TrueNAS

    +
  2. +
  3. +

    Wireguard setup on DA.

    +
  4. +
  5. +

    network share on printer for paperless +4. update peperless in ansible-nas

    +
  6. +
  7. +

    Just deploy paperless manually... monitor/manage with portainer

    +
  8. +
  9. +

    booksonic not seeing audiobooks/podcasts

    +
  10. +
  11. +

    need a smb user to map nas/documents to the printer for paperless

    +
  12. +
  13. +

    wireguard setup now on kps phone, desktop, server (and backup truenas?), and dad's pi

    +
  14. +
  15. +

    verify lan services work

    +
  16. +
  17. +

    Tdar so Jellyfin can work better

    +
  18. +
+

Snapshot business might be cause of all the docker containers and docker using +ZFS backend... take everything down and try removing

+
    +
  1. file browser - currently I just one-clicked in portainer, I want to make a stack with my own config file which I'll rip from techno tip and then add my traefik lables too
  2. +
+

Forget filebrowser - going to just use Nextcloud for how it's supposed to be used. +3. Need to organize those files in nextcloud

+

CHECK THIS -> ran as 'cp' utility in tmux window, no progress bars or anything. it's in ansible-nas session -> window 3

+

Olivet bible stuff going to /tmp/olivet/ -> will move this to nextcloud, ideally by the app via appimage so that the db updates and I don't have to run that occ script +I wnat to organize "home" still in nextcloud

+

setup Sanoid

+

clean up bitwarden +learn nextcloud sharing -> maybe just give a link to grandma? +rest of todos -> document db and sanoid + zfs.rent

+

Check on mom's will +do media thing for church - split vocals on mp3/4

+

permission-data playbook changes everything to ansible-nas:ansible-nas but then samba task will re-permission some stuff to root:users... this looks fine +I had to add group to the samba config in my playbook to get user auth to work with samba +This isn't fully working... it works from cli but my python process can't write to a folder in dump after 777.... need to learn more? +So I can make a file after adding the ansible-nas group to config, but I still cannot make a directory on the smb mount...

+

ADDING inherit permission = yes under [global] in the smb.conf worked!

+

still not working from printer... +I think what I want is to setup 2 scan options - single docs right to paperless, or combined scans to dump, then manually split and send to paperless

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/hostnamectl-to-easily-change-hostname.html b/hostnamectl-to-easily-change-hostname.html new file mode 100644 index 00000000..6e9b2454 --- /dev/null +++ b/hostnamectl-to-easily-change-hostname.html @@ -0,0 +1,368 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + hostnamectl to easily change hostname | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

hostnamectl to easily change hostname

+ + + + + +
+ + + +
+

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

+

+❯ hostnamectl --help
+hostnamectl [OPTIONS...] COMMAND ...
+
+Query or change system hostname.
+
+Commands:
+  status                 Show current hostname settings
+  hostname [NAME]        Get/set system hostname
+  icon-name [NAME]       Get/set icon name for host
+  chassis [NAME]         Get/set chassis type for host
+  deployment [NAME]      Get/set deployment environment for host
+  location [NAME]        Get/set location for host
+
+Options:
+  -h --help              Show this help
+     --version           Show package version
+     --no-ask-password   Do not prompt for password
+  -H --host=[USER@]HOST  Operate on remote host
+  -M --machine=CONTAINER Operate on local container
+     --transient         Only set transient hostname
+     --static            Only set static hostname
+     --pretty            Only set pretty hostname
+     --json=pretty|short|off
+                         Generate JSON output
+
+See the hostnamectl(1) man page for details.
+
+

I learned there's transient and static hostnames, so that's cool...

+

The thing I needed was hostnamectl --static hostname babyblue-aurora

+

pretty sweet tool

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/how-i-use-nextcloud-for-safe-central-storage.html b/how-i-use-nextcloud-for-safe-central-storage.html new file mode 100644 index 00000000..4b167041 --- /dev/null +++ b/how-i-use-nextcloud-for-safe-central-storage.html @@ -0,0 +1,348 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + How I use Nextcloud for safe central storage | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

How I use Nextcloud for safe central storage

+ + + + + +
+ + + +
+
    +
  1. Setup admin
  2. +
  3. External Storage extension
  4. +
  5. Add my nas zfs dataset
  6. +
  7. chown -R www-data:www-data on anything nextcloud uploads to.
  8. +
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/how-to-survive-the-flood.html b/how-to-survive-the-flood.html new file mode 100644 index 00000000..8bdc01e8 --- /dev/null +++ b/how-to-survive-the-flood.html @@ -0,0 +1,371 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + How To Survive The Flood | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

How To Survive The Flood

+ + + + + +
+ + + +
+

There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding in Yahweh and staying close to the One who loves him.

+
+

Note this reflection doesn't address AT ALL if the flood narrative is a +"real" historical event, whether it's a global or local event, or anything +like that - regardless of those points the Biblical authors used this type of +imagery of chaos waters to communicate themes of judgement and wrath.

+
+

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images +of the chaos waters (the winds and the rains). His instruction is that the wise +man who built his house on the rock will survive, but the foolish man builds +his house on the sand and the winds and the rains destroyed it.

+

Somewhat obviously this is metaphorical for basing your life on wisdom or +folly. The wisdom is Jesus' teaching which is all based on Yahweh's love for +humanity and his desire to partner with humanity for the good of the whole +earth.

+

The simple take-away is for us to survive the winds and the rain, and to say it +more fully - to survive de-creation and destruction, we must live our lives in +a way that revolves around Jesus, the perfect human. He calls us to a greater +humanity, an unbroken humanity, which is unachievable apart from him (just look +around if you doubt this truth).

+

It's important to notice though that abiding in the Lord, basing your life on +the rock, doesn't spare you from the wind and the rain. Trials come, life gets +hard, shit hits the fan. The last few weeks for me haven't been my favorite and +I've certainly experienced turmoil in my life but frankly Jesus makes those +things bearable... in a way I can't put enough words to I'll just be reminded of +Paul in Romans 8...

+
worthy to be compared with the glory that is to be revealed to us.” Our present
+trials are not on an equal scale with the glory of heaven ```
+
+By God's grace he's molded my heart to be nearly incapable of separating the
+Love God has for me from any trial I face - it's not a magic answer or silver
+bullet to fixing those problems, and it doesn't make them go away, but I know
+the sufferings here aren't even worth comparing to the glory of the Lord. Amen.
+
+<!-- Content Injected to every content markdown footer -->
+
+[github]: https://github.com/rochacbruno/marmite
+
+
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/htop.html b/htop.html new file mode 100644 index 00000000..1907ee8a --- /dev/null +++ b/htop.html @@ -0,0 +1,347 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Htop | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Htop

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

htop is a common command line tool for seeing interactive output of your system resource utilization, running processes, etc.

+

I've always been super confused about htop showing seemingly the same process several times though...

+

The Fix...

+

Just hit H.... makes the view a lot nicer 😀

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/i3-like-keyboard-mapping-in-pop-os.html b/i3-like-keyboard-mapping-in-pop-os.html new file mode 100644 index 00000000..ad60cf7d --- /dev/null +++ b/i3-like-keyboard-mapping-in-pop-os.html @@ -0,0 +1,377 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + i3-Like keyboard mapping in Pop_OS | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

i3-Like keyboard mapping in Pop_OS

+ + + + + +
+ + + +
+

I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least navigate workspaces how I'm used to doing (cause I set +workspace 3 for communication apps, 1 for my terminal, etc...)

+

Here's how I set keybindings for:

+
    +
  • <Super> + <number> sends me to that numbered workspace
  • +
  • <Shift> + <Super> + <number> moves the window I'm focused on to workspace number
  • +
+
#!/bin/bash
+gsettings set org.gnome.mutter dynamic-workspaces false 
+gsettings set org.gnome.desktop.wm.preferences num-workspaces 8 
+gsettings set org.gnome.shell.keybindings switch-to-application-1 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-2 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-3 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-4 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-5 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-6 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-7 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-8 [] 
+gsettings set org.gnome.shell.keybindings switch-to-application-9 [] 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-1 "['<Super>1']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-2 "['<Super>2']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-3 "['<Super>3']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-4 "['<Super>4']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-5 "['<Super>5']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-6 "['<Super>6']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-7 "['<Super>7']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-8 "['<Super>8']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-9 "['<Super>9']" 
+gsettings set org.gnome.desktop.wm.keybindings switch-to-workspace-10 "['<Super>0']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-1 "['<Super><Shift>1']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-2 "['<Super><Shift>2']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-3 "['<Super><Shift>3']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-4 "['<Super><Shift>4']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-5 "['<Super><Shift>5']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-6 "['<Super><Shift>6']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-7 "['<Super><Shift>7']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-8 "['<Super><Shift>8']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-9 "['<Super><Shift>9']" 
+gsettings set org.gnome.desktop.wm.keybindings move-to-workspace-10 "['<Super><Shift>0']"
+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/index-1.html b/index-1.html new file mode 100644 index 00000000..97d75dd4 --- /dev/null +++ b/index-1.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Page - 1 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 1
+
+ + + + + +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-10.html b/index-10.html new file mode 100644 index 00000000..68bda78d --- /dev/null +++ b/index-10.html @@ -0,0 +1,422 @@ + + + + + + + + + + + + + + + + + + + + + Page - 10 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 10
+
+ + + + + +
+
+
+ +

+ + +TIL that when setting up download clients for +radarr/sonarr/lidarr/readarr/bazarr/prowlarr that you can utilize internal DNS +and instead of hardcoding an IP address of your download client server, can use +just the CNAME record (ie. instead of 172.10 ... + read more → +

+ +
+
+ +

+ + +I ran out of space on the SSD in my server when doing some file transfers but only 100GB was used of a 256 GB SSD? +LVM +When installing Ubuntu live server the default option for how to partition the +disk (in my experience) has been to setup an LVM gr ... + read more → +

+ +
+
+ +

+ + +When working with tdarr remote nodes, they need to have access not only to the +same libraries but also the same transcode cache as the server otherwise the +transcodes will fail... +Network Setup +To explain I'll give a brief overview of my home setup + ... + read more → +

+ +
+ + + + + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-11.html b/index-11.html new file mode 100644 index 00000000..3d0ca6d4 --- /dev/null +++ b/index-11.html @@ -0,0 +1,425 @@ + + + + + + + + + + + + + + + + + + + + + Page - 11 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 11
+
+ + + + + +
+
+ + +
+ +

+ + +As I was cleaning up my NAS recently I noticed that I ran out of storage even +though my disk usage looked pretty low... turns out I was keeping a mega-ton of +ZFS snapshots and due to my own ignorance at the time didn't realize the +storage cost of th ... + read more → +

+ +
+ +
+ +

+ + +I started my homelab journey being super naive about ZFS and how to manage the +filesystem... that bit me in the butt when transfering a ton of files out of +folders and into datasets because ZFS is copy on write so I was essentially +duplicating my st ... + read more → +

+ +
+ +
+ +

+ + +I've had Plug 'hrsh7th/cmp-path' in my plugins for ever but didn't notice +until recently that I wasn't getting any filepath completion in vim! +Fuller setup instructions below the TLDR +TL;DR +Turns out I need to not be a dope and configure nvim-cmp to ... + read more → +

+ +
+
+ +

+ + +I just started using FastAPI for a home project and needed to pass back a +dynamic number of values from a form rendered with jinja... +Dynamic Values +The jinja templating for rendering HTML based on something like a python iterable is nice and easy + + ... + read more → +

+ +
+ +
+ +

+ + +If you use vim-plug for managing your vim plugins, do yourself a favor and snapshot your plugins before upgrading! +:PlugSnapshot creates a vim.snapshot file that you can use to restore your plugin versions with vim -S snapshot.vim +The snapshot file ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-12.html b/index-12.html new file mode 100644 index 00000000..46680275 --- /dev/null +++ b/index-12.html @@ -0,0 +1,445 @@ + + + + + + + + + + + + + + + + + + + + + Page - 12 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 12
+
+ + + + + +
+
+ +
+ +

+ + +TODO + +import os + +import boto3 +import pytest +from moto import mock_s3 + +MY_BUCKET = "bucket" +# BAD PREFIX +MY_PREFIX = "bucket/project/data/layer/dataset/" + + +@pytest.fixture(scope="function") +def aws_credentials(): + &qu ... + read more → +

+ +
+
+ +

+ + +I wrote up a little on exporting DataFrames to markdown and html here +But I've been playing with a web app for with lists and while I'm toying around I learned you can actually give your tables some style with some simple css classes! +To HTML +Remind ... + read more → +

+ +
+
+ +

+ + +Pandas +pandas.DataFrames are pretty sweet data structures in Python. +I do a lot of work with tabular data and one thing I have incorporated into some of that work is automatic data summary reports by throwing the first few, or several relevant, rows ... + read more → +

+ +
+
+ +

+ + +Amazon has crossed the line with me just one too many times now so we are looking to drop them like every other Big Tech provider.... +However, one key feature of Amazon that has been so useful for us is Lists... We can just maintain a list for each ... + read more → +

+ +
+
+
+

Git-bisect

+ +
+

+ + +I try to commit a lot, and I also try to write useful tests appropriate for the scope of work I'm focusing on, but sometimes I drop the ball... +Whether by laziness, ignorance, or accepted tech debt I don't always code perfectly and recently I was do ... + read more → +

+ +
+
+ +

+ + +TL;DR +pandas.Series.str.contains accepts regular expressions and this is turned on by default! +Use case +We often need to filter pandas DataFrames based on several string values in a Series. + +Notice that sweet pyflyby import 😁! + +sandbox  main via 3 ... + read more → +

+ +
+ +
+
+

Htop

+ +
+

+ + +htop is a common command line tool for seeing interactive output of your system resource utilization, running processes, etc. +I've always been super confused about htop showing seemingly the same process several times though... +The Fix... +Just hit H ... + read more → +

+ +
+
+ +

+ + +Unpacking iterables in python with * is a pretty handy trick for writing code that is just a tiny bit more pythonic than not. +arr: Tuple[Union[int, str]] = (1, 2, 3, 'a', 'b', 'c') + + +print(arr) +>>> (1, 2, 3, 'a', 'b', 'c') + +# the * unpacks ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-13.html b/index-13.html new file mode 100644 index 00000000..62ddf64d --- /dev/null +++ b/index-13.html @@ -0,0 +1,420 @@ + + + + + + + + + + + + + + + + + + + + + Page - 13 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 13
+
+ + + + + +
+
+
+
+

Pipx

+ +
+

+ + +pipx is a tool I've been using to solve a few problems of mine... + +pinning formatting tools like black, flake8, isort, etc. to the same version for all my projects +keeping virtual environments clean of things like cookiecutter +python utilities I wan ... + read more → +

+ +
+
+
+

Fx-json

+ +
+

+ + +fx is an interactaive JSON viewer for the terminal. +It's a simple tool built with Charmcli's Bubble Tea. +Installation +The installation with go was broken for me - both via the link and direct from the repo. +Now I'm not a gopher so I don't really kno ... + read more → +

+ +
+
+ +

+ + +I use Jellyfin at home for serving up most of our media - movies and shows etc. +My dream is to have a GPU capable of transcoding any and all of our media for smooth playback on any device... +Now, I thought I'd have that by now with my Nvidia Quadro ... + read more → +

+ +
+
+
+

Typeddict

+ +
+

+ + +Type hinting has helped me write code almost as much, if not more, than unit testing. +One thing I love is that with complete type hinting you get a lot more out of your LSP. +Typing dictionaries can be tricky and I recently learned about TypedDict to ... + read more → +

+ +
+
+
+

Terraform-01

+ +
+

+ + +I've started using Terraform to manage Snowflake infrastructure at work. +I'm still a noobie but I've got a workflow that I think makes sense... +Here's the directory setup for a simple project with some databases, schemas, and tables to manage. +terra ... + read more → +

+ +
+
+ +

+ + +My moonlander is great, and I just recently added CAPS LOCK back to my keymapping but I've moved it... +At present it is where the ESC kep usually is however I'm trying to match my general moonlander usage with a keymap that fits on a planck. +Because ... + read more → +

+ +
+
+ +

+ + +My current homelab setup is not great but it works... +Proxmox on PowerEdge R610 +I boot off an SD card and have 1 SSD and 5 HDDs configured as a JBOD array using a Dell H700 SAS controller. +I cannot boot from a disk using this controller and I can't ... + read more → +

+ +
+
+
+

And-vs-&

+ +
+

+ + +I often struggle to remember the correct way to do and type comparisons when working in pandas. +I remember learning long long ago that and and & are different, the former being lazy boolean evaluation whereas the latter is a bitwise operation. +I ... + read more → +

+ +
+
+
+

File-length

+ +
+

+ + +I have a specific need for counting the number of lines in a file quickly. +At work we use S3 for data storage during our Kedro pipeline development, and in the development process we may end up orphaning several datasets. +In order to keep our worksp ... + read more → +

+ +
+
+ +

+ + +I have a post on starship where I have some notes on how I use starship to make my zsh experience great with a sweet terminal prompt. +Now... I spend quite a bit of time in ipython every day and I got kind of sick of the vanilla experience and wanted ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-14.html b/index-14.html new file mode 100644 index 00000000..fb959d3b --- /dev/null +++ b/index-14.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Page - 14 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 14
+
+ + + + + +
+
+
+ +

+ + +Did you know you can spell check in Vim?! + + + + Vim Spell check + + + Without... + Here is a missspelled word. + <h3>With!</h3> + <p>Here is a <u>missspelled</u> word.</p> + + + +What is this magi ... + read more → +

+ +
+
+
+

Polybar-01

+ +
+

+ + +polybar is an awesome and super customizable status bar for your desktop environment. +I use it with i3-gaps on Ubuntu for work and it makes my day just that much better to have a clean and elegant bar with the things in it that I care about. +The Git ... + read more → +

+ +
+
+
+

Deques

+ +
+

+ + +I am working on a project to create a small system monitoring dashboard using the python psutil library. +The repo is here (if you want actual system monitoring please use netdata). +I'm using streamlit and plotly for the webserver, design, and plotti ... + read more → +

+ +
+
+ +

+ + +Streamlit +I use streamlit for any EDA I ever have to do at work. +It's super easy to spin up a small dashboard to filter and view dataframes in, live, without the fallbacks of Jupyter notebooks (kernels dying, memory bloat, a billion "Untitled N ... + read more → +

+ +
+
+
+

Starship

+ +
+

+ + +If you spend time in the terminal then you'll want it to look somewhat pleasing to the eye. +I used to ssh into servers with no customization, use vi to edit a file or two, then get back to my regularly scheduled programming in VS C**e... +One of the ... + read more → +

+ +
+
+ +

+ + +Self-hosting 1 or several media servers is another common homelab use-case. +Getting content for your media servers is up to you, but I'll show a few ways here to get content somewhat easily! +YouTube Disclaimer at Bottom +you-get +you-get is a nice cli ... + read more → +

+ +
+
+
+

Skimpy

+ +
+

+ + +EDA +I work with data a lot, but the nature of my job isn't to dive super deep into a small amount of datasets, +I'm often jumping between several projects every day and need to just get a super quick glance at some tables to get a high level view. +Wh ... + read more → +

+ +
+
+ +

+ + +NAS +One of the most common use cases for self-hosting anything is a file share system. +I have been a fan of TrueNAS for a while. +I currently use TrueNAS Core at home, and plan to consider transitioning to TrueNAS Scale soon. +Blog post forthcoming on ... + read more → +

+ +
+
+
+

Pyclean

+ +
+

+ + +I like to keep my workspace clean and one thing that I don't personally love looking at is the __pycache__ directory that pops up after running some code. +The *.pyc files that show up there are python bytecode and they are cached to make subsequent ... + read more → +

+ +
+
+
+

Psutil-01

+ +
+

+ + +Mike Driscoll has been posting some awesome posts about psutil lately. +I'm interested in making my own system monitoring dashboard now using this library. +I don't expect it to compete with Netdata or Glances but it'll just be for fun to see how Pyth ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-15.html b/index-15.html new file mode 100644 index 00000000..e080f910 --- /dev/null +++ b/index-15.html @@ -0,0 +1,419 @@ + + + + + + + + + + + + + + + + + + + + + Page - 15 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 15
+
+ + + + + +
+
+
+
+

Mu

+ +
+

+ + +If you work with a template for several projects then you might sometimes need to do the same action across all repos. +A good example of this is updating a package in requirements.txt in every project, or refactoring a common module. +If you have sev ... + read more → +

+ +
+
+
+

Wireguard

+ +
+

+ + +VPN +Virtual Private Networks are a big deal, and this shouldn't be considered anything even close to a guide on using them. +Here are just my notes and some setup for how I use wireguard at home. +Wireguard +Wireguard is an awesome peer-to-peer VPN tun ... + read more → +

+ +
+
+ +

+ + +Git +Hopefully if you write code you are using git, if not go learn the basics of commit, pull, push, and pull request/merge request like... right now. +Assuming you are at least familiar with git then you probably work the same way I have since I've ... + read more → +

+ +
+
+ +

+ + +ABCMeta +I don't do a lot of OOP currently, but I have been on a few heavy OOP projects and this ABCMeta and abstractmethod from abc would've been super nice to know about! +If you are creating a library with classes that you expect your users to exte ... + read more → +

+ +
+
+ +

+ + +Being lazy +I almost exclusively use Python for my job and have been eye-balls deep in it for almost 5 years but I really lack in-depth knowledge of builtins. +I recently learned of an awesome builtin called calendar that has way more than I know abo ... + read more → +

+ +
+
+ +

+ + +I am personally trying to use logger instead of print in all of my code, +however I learned from [@Python-Hub] that you can align printouts using print with f-strings!. +This little python script shows how options in the f-string can format the printo ... + read more → +

+ +
+
+ +

+ + +I have often wanted to dive into memory usage for pandas DataFrames when it comes to cloud deployment. +If I have a python process running on a server at home I can use glances or a number of other tools to diagnose a memory issue... +However at work ... + read more → +

+ +
+
+ +

+ + +I run pi-hole at home for ad blocking and some internal DNS/DHCP handling. +pi hole posts on the way +One thing I've never put too much thought in is asking "how well am I doing at blocking?" +There's lots of ways to measure that depending on ... + read more → +

+ +
+
+ +

+ + +I host a lot of services in my homelab, but they're mostly dockerized applications so I have never had to care much about how content gets served up. +Today I had several little concepts click into place regarding webservers, and it was a similar exp ... + read more → +

+ +
+
+
+

Tree

+ +
+

+ + +I wanted a quick way to generate an index.html for a directory of html files that grows by 1 or 2 files a week. +I don't know any html (the files are exports from my tiddlywiki)... +tree is just the answer. +Say I have a file structure like this: +./htm ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-16.html b/index-16.html new file mode 100644 index 00000000..0b471ae9 --- /dev/null +++ b/index-16.html @@ -0,0 +1,454 @@ + + + + + + + + + + + + + + + + + + + + + Page - 16 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 16
+
+ + + + + +
+
+
+
+

Traefik-01

+ +
+

+ + +Traefik +If you don't know about traefik and you need a reverse-proxy then you might want to check it out. +I used to use nginx for my reverse proxy but the config was over my head, and once it was working I was afraid to touch it. +Traefik brings a lo ... + read more → +

+ +
+
+ +

+ + +On my team we often have to change data types of columns in a pandas.DataFrame for a variety of reasons. +The main one is it tends to be an artifact of EDA whereby a file is read in via pandas but the data types are somewhat wonky (ie. dates show up ... + read more → +

+ +
+
+
+

Tiddly-wiki

+ +
+

+ + +Tiddly Wiki is a great note taking utility for organizing non-linear notes. +I used it to replace my OneNote workflow and my only complaint is I don't have an easy way to access and edit my tiddlers (posts) if I'm not at home. +The tiddlywiki is just ... + read more → +

+ +
+
+ +

+ + +I ran into an issue where I had some copy-pasta markdown tables in a docstring but the generator I used to make the table gave me tabs instead of spaces in odd places which caused black to throw a fit. +Instead of manually changing all tabs to spaes, ... + read more → +

+ +
+
+
+

Stow-target

+ +
+

+ + +Check out stow for a brief introduction to stow +What if I want to stow a package somewhere else? +Boom, that's where -t comes in... +Maybe I don't like having my dotfiles repo at $HOME and instead I want it in ~/git or ~/personal just to stay organize ... + read more → +

+ +
+
+ +

+ + +After carefully staging only lines related to a specific change and comitting I suddenly realized I missed one... darn, what do I do? +Old me would have soft reset my branch to the previous commit and redone all my careful staging... what a PIA... +Ne ... + read more → +

+ +
+
+
+

Stow

+ +
+

+ + +Stow is a great tool for managing dotfiles. My usage looks like cloning my dotfiles to my home directory, setting some environment variables via a script, then stowing relevant packages and boom my config is good to go... +cd ~ +git clone <my dotfi ... + read more → +

+ +
+
+ +

+ + +Sometimes I need to manually set a static IP of a Linux machine. I generally run the latest version of Ubuntu server in my VMs at home. +In Ubuntu 20 I'm able to change up /etc/netplan/<something>.yml +network: + version: 2 + ethernets: + enp0 ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-17.html b/index-17.html new file mode 100644 index 00000000..e4d260c5 --- /dev/null +++ b/index-17.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Page - 17 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 17
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-18.html b/index-18.html new file mode 100644 index 00000000..2d07cbeb --- /dev/null +++ b/index-18.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Page - 18 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 18
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-19.html b/index-19.html new file mode 100644 index 00000000..a300b3dd --- /dev/null +++ b/index-19.html @@ -0,0 +1,595 @@ + + + + + + + + + + + + + + + + + + + + + Page - 19 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 19
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-2.html b/index-2.html new file mode 100644 index 00000000..0d6d9978 --- /dev/null +++ b/index-2.html @@ -0,0 +1,430 @@ + + + + + + + + + + + + + + + + + + + + + Page - 2 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 2
+
+ + + + + +
+
+
+ +

+ + +I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted... + +PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least ... + read more → +

+ +
+ + + + + + + + +
+ +

+ + +To customize k9s use the skins from catppuccin or the ones k9s supplies +OUT="${XDG_CONFIG_HOME:-$HOME/.config}/k9s/skins" +mkdir -p "$OUT" +curl -L https://github.com/catppuccin/k9s/archive/main.tar.gz | tar xz -C "$OUT" ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-20.html b/index-20.html new file mode 100644 index 00000000..4947cfa9 --- /dev/null +++ b/index-20.html @@ -0,0 +1,555 @@ + + + + + + + + + + + + + + + + + + + + + Page - 20 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 20
+
+ + + + + +
+
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+
+ +

+ + +<!doctype html> + + + + + + + +Personal — Theology and Tech + General Stuff + +/* +Basic styles used before we boot up the parsing engine +*/ +/* +Error message and password prompt +*/ +.tc-error-form { +font-family: sans-serif; +color: #fff; +z-index: 20000; +po ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-3.html b/index-3.html new file mode 100644 index 00000000..695a0e39 --- /dev/null +++ b/index-3.html @@ -0,0 +1,424 @@ + + + + + + + + + + + + + + + + + + + + + Page - 3 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 3
+
+ + + + + +
+
+ +
+ +

+ + +I started deploying a website to Cloudflare on a branch called pages. Similar to one of the GH Pages deployment patterns. But when my CI was pushing the branch I couldn't see it locally... +git fetch -a wasn't pulling any new branches, and git branch ... + read more → +

+ +
+ +
+ +

+ + +Video +Sermon on the Mount +3 chapters filled with phrases that are very well-known in our culture +Phrases + +Love your neighbor as yourself +Do to others what you would have them do to you +You are the salt of the earth +You can’t serve both God and money ... + read more → +

+ +
+ +
+
+

Chaos dragon

+ +
+

+ + +Dragons are metaphorical images in the Bible +Goliath -> armor descriptions +Leviathan +Dragon slayers can be enticed to become dragons themselves +Jesus is the great dragon slayer, who doesn't give in to the inticing power of the dragon + +calming the ... + read more → +

+ +
+ + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-4.html b/index-4.html new file mode 100644 index 00000000..fcafc182 --- /dev/null +++ b/index-4.html @@ -0,0 +1,438 @@ + + + + + + + + + + + + + + + + + + + + + Page - 4 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 4
+
+ + + + + +
+
+
+ +

+ + +ChatGPT Prompt: +Stable Diffusion is an AI art generation model similar to DALLE-2. +Here are some prompts for generating art with Stable Diffusion. +Example: + +A ghostly apparition drifting through a haunted mansion's grand ballroom, illuminated by fli ... + read more → +

+ +
+
+ +

+ + + +James +2023 study of the book of James +BP +The Guy +Greek: Iakobos (Jacob in English) +Jacob is one of Jesus' half-brothers who became a leader of the Jerusalem church post-resurrection +The book of James is the legacy of this Jacob's wisdom which was h ... + read more → +

+ +
+ +
+ +

+ + +I was introduced to tiling window managers through i3, which I use heavily on +one of my machines. I have switched to Pop_OS! at home though, which has a +tiling window mode but the keybindings are not what I'm used to for i3. I +wanted to at least nav ... + read more → +

+ +
+ +
+
+

Modal labs

+ +
+

+ + +Playing around with Modal Labs +One of the first things I tried was a regular cron job... +@stub.function( + schedule=modal.Period(minutes=59), secret=modal.Secret.from_name("my-dummy-secret") +) +def say_hi(): + now = time.ctime() + sec ... + read more → +

+ +
+ + +
+ +

+ + +I have a bash script called syncoid-job which boils down to a barebones - +#!/bin/bash + +syncoid --no-sync-snap --sendoptions=w --no-privilege-elevation $SYNOIC_USER@$SERVER:tank/encrypted/nas tank/encrypted/nas + +I want to run this script hourly but a ... + read more → +

+ +
+ + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-5.html b/index-5.html new file mode 100644 index 00000000..41ed38f2 --- /dev/null +++ b/index-5.html @@ -0,0 +1,440 @@ + + + + + + + + + + + + + + + + + + + + + Page - 5 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 5
+
+ + + + + +
+
+
+ +

+ + +I regularly need to edit system config files - take /etc/sanoid/sanoid.conf as +an example... I'll want to play with something but if I don't start Neovim as +root then I get in trouble making edits I can't save! So +suda.vim gives me +:SudaWrite which ... + read more → +

+ +
+ +
+ +

+ + +AJAX wasn't cutting it, traditional crontab in containers doesn't make much +sense to me, webcron is recommended but I don't want to register with anything +outside my LAN... Turns out you can just spin up an identical container with a +different entry ... + read more → +

+ +
+ +
+ +

+ + +I wanted to break down some long lines in a Markdown table cell to make it look +nicer on my blog but \n didn't do anything for me... turns out is the +magic sauce + + + +Column 1 +Column 2 + + + + +Key +Doggo ipsum many pats. Borkdrive borking doggo doing me a ... + read more → +

+ +
+ + +
+ +

+ + +Class link +Classroom notes (Must be on home network) +01 The Shape of the Hebrew Bible +Session 1: What on Earth is the Hebrew Bible? +This class is not so much a survey of the HB, it is Tim's attempt to distil the +most helpful things for understanding ... + read more → +

+ +
+ +
+
+

Faithful

+ +
+

+ + +Link +Notes +!!! Exodusds 34:6 +Compassioante and gracious, slow to anger, overflowing with loyal love and faithfulness + +Faithfulness - Emet (can be translated 'Truth') +Related to "Amen" which is untranslated Hebrew expression meaning "t ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-6.html b/index-6.html new file mode 100644 index 00000000..e25a3f65 --- /dev/null +++ b/index-6.html @@ -0,0 +1,431 @@ + + + + + + + + + + + + + + + + + + + + + Page - 6 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 6
+
+ + + + + +
+
+
+ +

+ + +zfs list has a flag -r, but if you use zfs driver for docker then you'll get +flooded with every docker volume in the world. zfs list -r -d N will limit the +dept of the print out, so zfs list -r -d 2 gives me tank, tank/encrypted, +tank/encrypted/dock ... + read more → +

+ +
+ +
+
+

Sabbath

+ +
+

+ + +Link to study +Creation +Brougt to completion on the seventh day in Genesis 1. It is the only day that +does not end with 'there evening and there was morning, the Nth day' +Humans were meant to rest with God in his creation forever, but in their +reblli ... + read more → +

+ +
+ + +
+ +

+ + +!!! note "Babyblue v2" +Ryzen 5700x + 32 GB 3200 CL16 RAM + +<a href="https://www.passmark.com/baselines/V10/display.php?id=503041456656"><img src="https://www.passmark.com/baselines/V10/media/503041456656.png" al ... + read more → +

+ +
+ +
+
+

Chara-joy

+ +
+

+ + +link +Chara / Joy +There are several words for similar feelings - example like joy has several synonyms. +Sources +Genesis tells us creation and life bring joy +Psalm 104 - A good bottle of wine is God's gift to bring joy to people's hearts +P#lm 65 - Bea ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-7.html b/index-7.html new file mode 100644 index 00000000..3836ab8a --- /dev/null +++ b/index-7.html @@ -0,0 +1,440 @@ + + + + + + + + + + + + + + + + + + + + + Page - 7 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 7
+
+ + + + + +
+
+
+ +

+ + +link to study +Video +Priests +God creates Eden in which he places humans to be his royal image - priests. God +sets humans up to receive his blessing but humans choose their own way. The +promise is for a priest and a sacrifice to come in Jesus. +God cho ... + read more → +

+ +
+ +
+
+

Tree of life

+ +
+

+ + +Video +Eden +Biblical story begins in a garden, which is presented as a type of Temple. The +top (center) is the Tree of Life, which represents God's life and creative +power. Humans were supposed to eat from the Tree of Life but there's +another tree, t ... + read more → +

+ +
+
+ +

+ + +study link +Peace +!!! note "" +generally means absnese of war + +In Hebrew the word is Shalom (Greek: Eirene). Basic biblical meeting of +Shalom is "complete" or "whole". ie. a stone with no cracks, or stone wall with +nogaps ... + read more → +

+ +
+
+ +

+ + +I use Tmux and Vim for most of my workflow, but I end up with a lot of dangling +tmux sessions that dont' really need to persist... but killing them one at a +time is a pain so I wrote a little script-kitty nonsense to pipe multiple +choices from fzf i ... + read more → +

+ +
+
+ +

+ + +link to presentation +Hellenism +During the "silent years" Hellenism was on the rise, even among several Jewish circles. +Essenes +Another Jewish group (like Pharisees, Herodians, etc.) with a lot of debate +surrounding them. They were largely ... + read more → +

+ +
+ +
+ +

+ + +Herodians show up twice in the Gospels, Josephus talks about them a bit as +well. There is a lot of hsitorical debate that surrounds the Herodians. + +Like Republicans and Democracts meant one thing in American history, but +those positions and words me ... + read more → +

+ +
+
+ +

+ + +Link to presentation +Sadducees +>Often we in the modern time totally conflate Sadducees and Pharisees but they +>are as Republicans and Democrats today... very much not the same +Origin +Back in the Davidic kingdom they are the group that sought t ... + read more → +

+ +
+
+ +

+ + +Hellenism + +For the first time in history, Greeks redefined worldfiew to be cenetered +around the individual. Prior to Hellenism, worldviews centered around +pleasing the gods + +Alexander the Great had his own gospel (εὐαγγέλιον - euangelion: predates b ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-8.html b/index-8.html new file mode 100644 index 00000000..3fac7c39 --- /dev/null +++ b/index-8.html @@ -0,0 +1,451 @@ + + + + + + + + + + + + + + + + + + + + + Page - 8 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 8
+
+ + + + + +
+
+ +
+ +

+ + +Link to presentation +Judaism +Modern Judaism is very different from Jesus' Judaism which was distinct from +David's Judaism, etc... We, as modern westerners, need to be aware of the +religious evolution and history of Judaism to properly understand the ... + read more → +

+ +
+
+ +

+ + +Intro +Session 1: Torah +Session 2: Prophets and Writings +Review +Torah +Big idea: partnership + +Basis of partnership / meet the characters (Genesis) +God chooses a partner / the partner chooses God (Exodus) +God defines the partnership (Leviticus) +God sha ... + read more → +

+ +
+
+ +

+ + +Intro +I use ZFS at home in my homelab for basically all of my storage... Docker uses +ZFS backend, all my VMs have their .qcow2 images in their own zfs datasets, +and all my shares are ZFS datasets. I love ZFS but my home hardware presently +is the opp ... + read more → +

+ +
+ +
+
+

Screwtape

+ +
+

+ + +Chapters +Below are just quick notes or quotes from each chapter as a reminder of what to +go back to chat about. This isn't intended to be in-depth by any stretch. +Chapter 1 +"Your man has been accustomed, ever since he was a boy, to have a dozen ... + read more → +

+ +
+ +
+ +

+ + +Steps +sudo fdisk -l +then look for the device and partition +get the Type column +mount +Example + +dumbledore in /media NO PYTHON VENV SET +❯ sudo fdisk -l + +... + +Device Boot Start End Sectors Size Id Type +/dev/sdk1 * 2048 60371951 ... + read more → +

+ +
+ + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index-9.html b/index-9.html new file mode 100644 index 00000000..e1e7402a --- /dev/null +++ b/index-9.html @@ -0,0 +1,433 @@ + + + + + + + + + + + + + + + + + + + + + Page - 9 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + +
+
Page - 9
+
+ + + + + +
+
+ + + + +
+ +

+ + +man can be a pain to read... and there's lots of alternatives out there and one I've just started playing with is cheat +man man will give you this plus a billion more lines of docs, which is useful when you need it... +MAN(1) ... + read more → +

+ +
+
+ +

+ + +I got into a pickle where I encrypted the ssh keys I use for my SSH connections on LAN, but then I couldn't run my ansible playbook on my server! ssh-keygen -p and leave the new passphrase blank saved my day (although password protected key files ar ... + read more → +

+ +
+ + + + + + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index.html b/index.html new file mode 100644 index 00000000..15cb169f --- /dev/null +++ b/index.html @@ -0,0 +1,442 @@ + + + + + + + + + + + + + + + + + + + + + Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + + + + + + +
+
+
Who am I
+

I write about things I find find interesting in tech and theology

+

Let's connect: 🌱 My littlelink is the place to find the places to find me 🤓

+ +
+
+ + + + + +
+
+
+ +

+ + +Scripture +Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!” +Edification +There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear ... + read more → +

+ +
+ +
+ +

+ + +There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding ... + read more → +

+ +
+
+ +

+ + +This is your first post! +Edit this content +edit on content/{date}-welcome.md +Add more content +create new markdown files in the content folder +use marmite --new to create new content +Customize your site +edit marmite.yaml to change site settings +edit ... + read more → +

+ +
+
+ +

+ + +the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning... +Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then g ... + read more → +

+ +
+
+ +

+ + +Context +24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had ... + read more → +

+ +
+ + + +
+ +

+ + +Matthew 7:12 +So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets + +What do I desire that people "do to [me]"? + +Help if I need it - I want to live in a world where humans are h ... + read more → +

+ +
+ + + + +
+
+ +
+ + + +
+ + + + + + + + + diff --git a/index.json b/index.json new file mode 100644 index 00000000..5ec203cd --- /dev/null +++ b/index.json @@ -0,0 +1,325 @@ +{ + "version": "https://jsonfeed.org/version/1", + "title": "Pype.dev", + "home_page_url": "https://pype.dev", + "feed_url": "https://pype.dev/index.json", + "description": "my mental data-lake", + "items": [ + { + "id": "https://pype.dev/advent-2024-peace.html", + "url": "https://pype.dev/advent-2024-peace.html", + "title": "Advent 2024 - Peace", + "content_html": "\n

Scripture

\n

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

\n

Edification

\n

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

\n

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

\n

You all know we messed that up, Shalom was broken and humanity was exiled.

\n

But we have a Great Healer.

\n

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

\n

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

\n

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

\n

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

\n

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

\n

Finally I pray we may all be given, and accept, the conviction of Paul -

\n

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

\n

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

\n\n", + "summary": "", + "date_published": "2024-12-06T15:26:15-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "url": "https://pype.dev/hostnamectl-to-easily-change-hostname.html", + "title": "hostnamectl to easily change hostname", + "content_html": "\n

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

\n
\n❯ hostnamectl --help\nhostnamectl [OPTIONS...] COMMAND ...\n\nQuery or change system hostname.\n\nCommands:\n  status                 Show current hostname settings\n  hostname [NAME]        Get/set system hostname\n  icon-name [NAME]       Get/set icon name for host\n  chassis [NAME]         Get/set chassis type for host\n  deployment [NAME]      Get/set deployment environment for host\n  location [NAME]        Get/set location for host\n\nOptions:\n  -h --help              Show this help\n     --version           Show package version\n     --no-ask-password   Do not prompt for password\n  -H --host=[USER@]HOST  Operate on remote host\n  -M --machine=CONTAINER Operate on local container\n     --transient         Only set transient hostname\n     --static            Only set static hostname\n     --pretty            Only set pretty hostname\n     --json=pretty|short|off\n                         Generate JSON output\n\nSee the hostnamectl(1) man page for details.\n
\n

I learned there's transient and static hostnames, so that's cool...

\n

The thing I needed was hostnamectl --static hostname babyblue-aurora

\n

pretty sweet tool

\n\n", + "summary": "", + "date_published": "2024-12-06T07:25:59-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/how-to-survive-the-flood.html", + "url": "https://pype.dev/how-to-survive-the-flood.html", + "title": "How To Survive The Flood", + "content_html": "\n

There a lot of flood stories throughout the history of the world, and the Bible\nis no different in this regard. God warns Noah of a de-creation event, whereby\nhe'll start over with humanity via Noah and his family. Noah survives the flood\nby abiding in Yahweh and staying close to the One who loves him.

\n
\n

Note this reflection doesn't address AT ALL if the flood narrative is a\n"real" historical event, whether it's a global or local event, or anything\nlike that - regardless of those points the Biblical authors used this type of\nimagery of chaos waters to communicate themes of judgement and wrath.

\n
\n

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images\nof the chaos waters (the winds and the rains). His instruction is that the wise\nman who built his house on the rock will survive, but the foolish man builds\nhis house on the sand and the winds and the rains destroyed it.

\n

Somewhat obviously this is metaphorical for basing your life on wisdom or\nfolly. The wisdom is Jesus' teaching which is all based on Yahweh's love for\nhumanity and his desire to partner with humanity for the good of the whole\nearth.

\n

The simple take-away is for us to survive the winds and the rain, and to say it\nmore fully - to survive de-creation and destruction, we must live our lives in\na way that revolves around Jesus, the perfect human. He calls us to a greater\nhumanity, an unbroken humanity, which is unachievable apart from him (just look\naround if you doubt this truth).

\n

It's important to notice though that abiding in the Lord, basing your life on\nthe rock, doesn't spare you from the wind and the rain. Trials come, life gets\nhard, shit hits the fan. The last few weeks for me haven't been my favorite and\nI've certainly experienced turmoil in my life but frankly Jesus makes those\nthings bearable... in a way I can't put enough words to I'll just be reminded of\nPaul in Romans 8...

\n
worthy to be compared with the glory that is to be revealed to us.” Our present\ntrials are not on an equal scale with the glory of heaven ```\n\nBy God's grace he's molded my heart to be nearly incapable of separating the\nLove God has for me from any trial I face - it's not a magic answer or silver\nbullet to fixing those problems, and it doesn't make them go away, but I know\nthe sufferings here aren't even worth comparing to the glory of the Lord. Amen.\n\n<!-- Content Injected to every content markdown footer -->\n\n[github]: https://github.com/rochacbruno/marmite\n
\n", + "summary": "", + "date_published": "2024-12-04T05:52:44-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/welcome.html", + "url": "https://pype.dev/welcome.html", + "title": "Welcome to Marmite", + "content_html": "\n

This is your first post!

\n

Edit this content

\n

edit on content/{date}-welcome.md

\n

Add more content

\n

create new markdown files in the content folder

\n

use marmite --new to create new content

\n

Customize your site

\n

edit marmite.yaml to change site settings

\n

edit the files starting with _ in the content folder to change the layout

\n

or edit the templates to create a custom layout

\n

Deploy your site

\n

read more on marmite documentation

\n\n", + "summary": "", + "date_published": "2024-12-04T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [], + "language": "en" + }, + { + "id": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "url": "https://pype.dev/stylus-for-custom-webpage-themes.html", + "title": "Stylus for custom webpage themes", + "content_html": "\n

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

\n

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

\n

TODO: image

\n\n", + "summary": "", + "date_published": "2024-11-27T06:07:39-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/the-two-houses.html", + "url": "https://pype.dev/the-two-houses.html", + "title": "The Two Houses", + "content_html": "\n

Context

\n
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.\n\nThe Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.\n
\n

Reflection

\n

From the visual commentary Tim calls out a few things:

\n
    \n
  1. \n

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    \n
  2. \n
  3. \n

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    \n
  4. \n
\n\n", + "summary": "", + "date_published": "2024-11-27T05:40:24-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "url": "https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.html", + "title": "DNS Broke After Reboot - Ubuntu 22.04", + "content_html": "\n

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

\n

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

\n

sudo mkdir /etc/systemd/resolved.conf.d/\nsudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

\n

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

\n
[Resolve]\nDNS=8.8.8.8 1.1.1.1\n
\n

But I decided to use tailscale

\n
[Resolve]\nDNS=100.100.100.100\n
\n

Then restart systemd-resolved

\n

sudo systemctl restart systemd-resolved

\n\n", + "summary": "", + "date_published": "2024-11-22T08:08:40-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/restart-kde-plasma.html", + "url": "https://pype.dev/restart-kde-plasma.html", + "title": "Restart KDE Plasma", + "content_html": "\n

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

\n
\nsudo killall plasmashell\n\nkstart plasmashell\n\n
\n\n", + "summary": "", + "date_published": "2024-11-08T15:53:52-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "terminal", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/opnsense-bootstrap-recovery.html", + "url": "https://pype.dev/opnsense-bootstrap-recovery.html", + "title": "OPNSense Bootstrap Recovery", + "content_html": "\n

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

\n\n", + "summary": "", + "date_published": "2024-11-07T08:40:19-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "infrastructure", + "homelab", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/bp-the-golden-rule.html", + "url": "https://pype.dev/bp-the-golden-rule.html", + "title": "BP - The Golden Rule", + "content_html": "\n

Matthew 7:12

\n
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets\n
\n

What do I desire that people "do to [me]"?

\n
    \n
  1. Help if I need it - I want to live in a world where humans are helpful
  2. \n
  3. Listen to me and understand what I say
  4. \n
  5. Leave me alone sometimes
  6. \n
\n

What is the Torah and Prophets?

\n

I know there's a lot more to where the texts come from and the varying\ntraditions in Judaism. But I think at a very high level, Jesus is saying that\nwe all know, deep down, how to live in harmony but that it requires sacrifice.\nHe calls us to live sacrificially towards each other, to live in Heaven\ntoday, so we can experience the coming reality if our own resurrection

\n\n", + "summary": "", + "date_published": "2024-11-06T05:54:32-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/recovering-opnsense.html", + "url": "https://pype.dev/recovering-opnsense.html", + "title": "Recovering OPNSense", + "content_html": "\n

I woke up to faulty internet and after some troubleshooting it turns out the\nroot zfs dataset that OPNSense boots from got corrupted...

\n
\n

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or\nnextcloud... But if you won't then at least back up your OPNSense config\nsomewhere everytime you update it.

\n
\n

It's too much to recount every issue, so here's a bullet list what worked.

\n
    \n
  1. On a fresh drive install OPNSense
  2. \n
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would\nhappen if you plugged it in along with the new drive and then booted up.\nBecause both drives will have a zfs pool zroot and the boot dataset is\nautomounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it\ndidn't automount
  4. \n
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO:\nzpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. \n
\n
\n

-d is the zfs flag to import the pool by disk id, -N it to not mount any of\nthe datasets (we need to change mountpoints) and the zroot zrootrecovery\nimports the zroot pool with a new name

\n
\n
    \n
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere\nlike /mnt/zrootrecovery
  2. \n
  3. Depending on the mount point you set you'll find a config directory around\n/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another\nmachine via scp or whatever
  4. \n
  5. Go to OPNSense webui and recover from that config!
  6. \n
\n

All in all this process took me around 8 hours but I did run into about ever\nissue under the sun (several bad disks in the mix, a laptop that wouldn't live\nboot into a BSD system, etc.)

\n\n", + "summary": "", + "date_published": "2024-11-06T00:00:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "blog", + "homelab" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships-2.html", + "title": "Reflection - Wisdom in Relationships 2", + "content_html": "\n

Passage

\n
Why do you see the speck in the eye of your brother, but you don't perceive the\nbeam in your own eye?\n\nOr how can you say to your brother, "Allow me to take out the speck from your\neye," and look, the beam is in your eye!\n\nHypocrite! First take out the beam from your eye, and then you can see clearly\nthe speck in the eye of your brother.\n
\n
Ask and it will be given to you. Seek and you will find. Knock and it will be\nhopend to you. For the one who asks will receive, and the one who seeks will\nfind. And to the one who knocks it will be opened. For what person is among\nyou, who when their son asks for break, will give him a rock? Or when he asks\nfor a fish will give him a snake? So then fi you all are bad, but you know how\nto give good gifts to your children, how much more will your Father in the\nskies give good things to those who ask.\n
\n

Reflection

\n

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon\non the Mount. We aren't just to ask for anything that we think is good...\nwisdom is the good we are to ask for.

\n

Tim: Prayer is important because wisdom will flow out of a deep interpersonal\nrelationship with God.

\n

Where has God given me wisdom?

\n
    \n
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. \n
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. \n
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. \n
\n\n", + "summary": "", + "date_published": "2024-10-14T06:07:33-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/reflection-wisdom-in-relationships.html", + "url": "https://pype.dev/reflection-wisdom-in-relationships.html", + "title": "Reflection - Wisdom in Relationships", + "content_html": "\n

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

\n

The passage is Matthew 7:1-2

\n
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.\n\nAnd with the measure that you measure, it will be measured to you.\n
\n

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

\n

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

\n

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

\n\n", + "summary": "", + "date_published": "2024-10-12T05:40:11-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "bible-project", + "faith" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-remote-add.html", + "url": "https://pype.dev/docker-remote-add.html", + "title": "docker-remote-add", + "content_html": "\n

Add from url??

\n

ADD http://example.com/cars.csv /tmp/cars.csv

\n

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

\n

ADD myapp.tar.gz /opt/myapp/

\n\n", + "summary": "", + "date_published": "2024-09-17T06:19:00-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "homelab", + "linux", + "tech" + ], + "language": "en" + }, + { + "id": "https://pype.dev/docker-copy-and-chown.html", + "url": "https://pype.dev/docker-copy-and-chown.html", + "title": "Docker copy and chown", + "content_html": "\n

COPY --chown=myuser:mygroup source-file target-file

\n\n", + "summary": "", + "date_published": "2024-09-17T06:18:09-00:00", + "image": "", + "authors": [ + { + "name": "Nicholas Payne", + "url": "https://github.com/pypeaday", + "avatar": "https://github.com/pypeaday.png" + } + ], + "tags": [ + "linux", + "homelab", + "tech" + ], + "language": "en" + } + ] +} \ No newline at end of file diff --git a/index.rss b/index.rss new file mode 100644 index 00000000..0e951683 --- /dev/null +++ b/index.rss @@ -0,0 +1,263 @@ +Pype.devhttps://pype.devmy mental data-lakeFri, 06 Dec 2024 15:26:15 GMTFri, 06 Dec 2024 21:33:01 GMTmarmiteAdvent 2024 - Peacehttps://pype.dev/advent-2024-peace.htmlnicpaynefaithhttps://pype.dev/advent-2024-peace.htmlFri, 06 Dec 2024 15:26:15 GMTindex +

Scripture

+

Luke 2:14 (ESV): 14 “Glory to God in the highest, and on earth peace among those with whom he is pleased!”

+

Edification

+

There is a word we probably know - Shalom. It's the Hebrew word we translate often as "peace". But when I hear "peace" I often think about being calm - and that oversimplifies Shalom... I think a more appropriate understanding is "things are as they are supposed to be".

+

In the Garden, we see Shalom - the Lord partnering with humanity to steward the earth, to make things as they were supposed to be...

+

You all know we messed that up, Shalom was broken and humanity was exiled.

+

But we have a Great Healer.

+

Jesus is Lord of all, King of Heaven and Earth, Ruler of your lives and mine, and he is the Prince of Peace

+

Things in our lives are probably not often as they are supposed to be... We get sick, worry about bills, experience tragedy, and weather the storms of life. But there is hope - confident expectation - that peace already has been, and will continue to be, restored to those whom Jesus chooses, the ones with whom he is pleased.

+

John records a lot before telling us about the cross, and I won't recount that in this short edification. But he recalls a hopeful word from the Lord -

+

John 16:33 (LEB): 33 I [Jesus] have said these things to you so that in me you may have peace. In the world you have affliction, but have courage! I have conquered the world.”

+

This season, and this week of Advent, I pray God presses the reality, and the hope for, peace, the expectation of Shalom, deeper into my heart. I pray the Spirit guides us all to bring the will of God to earth as it is in Heaven

+

Finally I pray we may all be given, and accept, the conviction of Paul -

+

Romans 8:18 For I consider that the sufferings of this present time are not worthy to be compared with the glory that is to be revealed to us.” Our present trials are not on an equal scale with the glory of heaven

+

May the rest, the peace, the Shalom that Jesus gives to his followers be with you all. Amen.

+ +]]>
hostnamectl to easily change hostnamehttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlnicpaynelinuxterminaltechhttps://pype.dev/hostnamectl-to-easily-change-hostname.htmlFri, 06 Dec 2024 07:25:59 GMTindex +

hostnamectl is apparently a linux utility for easily changing your hostname in a variety of ways

+

+❯ hostnamectl --help
+hostnamectl [OPTIONS...] COMMAND ...
+
+Query or change system hostname.
+
+Commands:
+  status                 Show current hostname settings
+  hostname [NAME]        Get/set system hostname
+  icon-name [NAME]       Get/set icon name for host
+  chassis [NAME]         Get/set chassis type for host
+  deployment [NAME]      Get/set deployment environment for host
+  location [NAME]        Get/set location for host
+
+Options:
+  -h --help              Show this help
+     --version           Show package version
+     --no-ask-password   Do not prompt for password
+  -H --host=[USER@]HOST  Operate on remote host
+  -M --machine=CONTAINER Operate on local container
+     --transient         Only set transient hostname
+     --static            Only set static hostname
+     --pretty            Only set pretty hostname
+     --json=pretty|short|off
+                         Generate JSON output
+
+See the hostnamectl(1) man page for details.
+
+

I learned there's transient and static hostnames, so that's cool...

+

The thing I needed was hostnamectl --static hostname babyblue-aurora

+

pretty sweet tool

+ +]]>
How To Survive The Floodhttps://pype.dev/how-to-survive-the-flood.htmlnicpaynebible-projectfaithhttps://pype.dev/how-to-survive-the-flood.htmlWed, 04 Dec 2024 05:52:44 GMTindex +

There a lot of flood stories throughout the history of the world, and the Bible +is no different in this regard. God warns Noah of a de-creation event, whereby +he'll start over with humanity via Noah and his family. Noah survives the flood +by abiding in Yahweh and staying close to the One who loves him.

+
+

Note this reflection doesn't address AT ALL if the flood narrative is a +"real" historical event, whether it's a global or local event, or anything +like that - regardless of those points the Biblical authors used this type of +imagery of chaos waters to communicate themes of judgement and wrath.

+
+

Jesus, in the Sermon on the Mount with the 2 houses, calls back to the images +of the chaos waters (the winds and the rains). His instruction is that the wise +man who built his house on the rock will survive, but the foolish man builds +his house on the sand and the winds and the rains destroyed it.

+

Somewhat obviously this is metaphorical for basing your life on wisdom or +folly. The wisdom is Jesus' teaching which is all based on Yahweh's love for +humanity and his desire to partner with humanity for the good of the whole +earth.

+

The simple take-away is for us to survive the winds and the rain, and to say it +more fully - to survive de-creation and destruction, we must live our lives in +a way that revolves around Jesus, the perfect human. He calls us to a greater +humanity, an unbroken humanity, which is unachievable apart from him (just look +around if you doubt this truth).

+

It's important to notice though that abiding in the Lord, basing your life on +the rock, doesn't spare you from the wind and the rain. Trials come, life gets +hard, shit hits the fan. The last few weeks for me haven't been my favorite and +I've certainly experienced turmoil in my life but frankly Jesus makes those +things bearable... in a way I can't put enough words to I'll just be reminded of +Paul in Romans 8...

+
worthy to be compared with the glory that is to be revealed to us.” Our present
+trials are not on an equal scale with the glory of heaven ```
+
+By God's grace he's molded my heart to be nearly incapable of separating the
+Love God has for me from any trial I face - it's not a magic answer or silver
+bullet to fixing those problems, and it doesn't make them go away, but I know
+the sufferings here aren't even worth comparing to the glory of the Lord. Amen.
+
+<!-- Content Injected to every content markdown footer -->
+
+[github]: https://github.com/rochacbruno/marmite
+
+]]>
Welcome to Marmitehttps://pype.dev/welcome.htmlnicpaynehttps://pype.dev/welcome.htmlWed, 04 Dec 2024 00:00:00 GMTindex +

This is your first post!

+

Edit this content

+

edit on content/{date}-welcome.md

+

Add more content

+

create new markdown files in the content folder

+

use marmite --new to create new content

+

Customize your site

+

edit marmite.yaml to change site settings

+

edit the files starting with _ in the content folder to change the layout

+

or edit the templates to create a custom layout

+

Deploy your site

+

read more on marmite documentation

+ +]]>
Stylus for custom webpage themeshttps://pype.dev/stylus-for-custom-webpage-themes.htmlnicpaynetechhttps://pype.dev/stylus-for-custom-webpage-themes.htmlWed, 27 Nov 2024 06:07:39 GMTindex +

the Logos web app is DISGUSTINGY bright/white - enough to actually ruin your morning...

+

Thankfully there's an extension called stylus and some kind folks in the Logos community created a nice dark theme here. You simply install the extension, then go to the userstyles link <-- and click install. It only changes themes for the sites configured - in this case app.logos.com

+

TODO: image

+ +]]>
The Two Houseshttps://pype.dev/the-two-houses.htmlnicpaynebible-projectfaithhttps://pype.dev/the-two-houses.htmlWed, 27 Nov 2024 05:40:24 GMTindex +

Context

+
24 “Everyone then who hears these words of mine and does them will be like a wise man who built his house on the rock. 25 And the rain fell, and the floods came, and the winds blew and beat on that house, but it did not fall, because it had been founded on the rock. 26 And everyone who hears these words of mine and does not do them will be like a foolish man who built his house on the sand. 27 And the rain fell, and the floods came, and the winds blew and beat against that house, and it fell, and great was the fall of it.
+
+The Holy Bible: English Standard Version (Mt 7:24–27). (2016). Crossway Bibles.
+
+

Reflection

+

From the visual commentary Tim calls out a few things:

+
    +
  1. +

    the rock is supposed to first call us back to earlier in the sermon when Jesus calls his people "the light of the world" and says "a city on a hill [mountain] cannot be hidden" (Matthew 5:14). The hill [ὄρος | oros] means "mountain" and is a hyperlink to OT teaching of God's people living in the ideal Jerusalem on Mt. Zion. Lots of Hebrew imagery here.

    +
  2. +
  3. +

    The rain and floods are a callback to the Chaos Waters of the OT (and general ANE thinking). It's a reference to the destructive nature that we humans have unleashed on the world - but the wise man who listens to Jesus lives a life with some amount of protection from those hardships - and ultimate protection from God handing us over to Chaos (destruction).

    +
  4. +
+ +]]>
DNS Broke After Reboot - Ubuntu 22.04https://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlnicpaynehomelablinuxtechhttps://pype.dev/dns-broke-after-reboot-ubuntu-22-04.htmlFri, 22 Nov 2024 08:08:40 GMTindex +

I rebooted by server and DNS broke randomly. I have no idea if it was from a kernel update or what but that's the issue with Ubuntu I guess...

+

After much toil and none of the other options working for me (sorry to not have those documented here) this is what got me the vic from this SO Post

+

sudo mkdir /etc/systemd/resolved.conf.d/ +sudo $EDITOR /etc/systemd/resolved.conf.d/dns_servers.conf

+

Most folks probably are good with google (8.8.8.8) and cloudflare (1.1.1.1)

+
[Resolve]
+DNS=8.8.8.8 1.1.1.1
+
+

But I decided to use tailscale

+
[Resolve]
+DNS=100.100.100.100
+
+

Then restart systemd-resolved

+

sudo systemctl restart systemd-resolved

+ +]]>
Restart KDE Plasmahttps://pype.dev/restart-kde-plasma.htmlnicpaynelinuxterminaltechhttps://pype.dev/restart-kde-plasma.htmlFri, 08 Nov 2024 15:53:52 GMTindex +

Plasma shits the bed a little too often on Fedora for me right now but I finally have a quick fix...

+

+sudo killall plasmashell
+
+kstart plasmashell
+
+
+ +]]>
OPNSense Bootstrap Recoveryhttps://pype.dev/opnsense-bootstrap-recovery.htmlnicpayneinfrastructurehomelabtechhttps://pype.dev/opnsense-bootstrap-recovery.htmlThu, 07 Nov 2024 08:40:19 GMTindex +

enabling DHCP WAN port (dhclient <iface>)- running the bootstrap script - sh /usr/local/sbin/opnsense-bootstrap

+ +]]>
BP - The Golden Rulehttps://pype.dev/bp-the-golden-rule.htmlnicpaynebible-projectfaithhttps://pype.dev/bp-the-golden-rule.htmlWed, 06 Nov 2024 05:54:32 GMTindex +

Matthew 7:12

+
So then, everything you desire that people do to you, so also you do to them, for this is the Torah and the Prophets
+
+

What do I desire that people "do to [me]"?

+
    +
  1. Help if I need it - I want to live in a world where humans are helpful
  2. +
  3. Listen to me and understand what I say
  4. +
  5. Leave me alone sometimes
  6. +
+

What is the Torah and Prophets?

+

I know there's a lot more to where the texts come from and the varying +traditions in Judaism. But I think at a very high level, Jesus is saying that +we all know, deep down, how to live in harmony but that it requires sacrifice. +He calls us to live sacrificially towards each other, to live in Heaven +today, so we can experience the coming reality if our own resurrection

+ +]]>
Recovering OPNSensehttps://pype.dev/recovering-opnsense.htmlnicpaynebloghomelabhttps://pype.dev/recovering-opnsense.htmlWed, 06 Nov 2024 00:00:00 GMTindex +

I woke up to faulty internet and after some troubleshooting it turns out the +root zfs dataset that OPNSense boots from got corrupted...

+
+

PRO-TIP - Auto backup your OPNSense config to Google Drive, git, or +nextcloud... But if you won't then at least back up your OPNSense config +somewhere everytime you update it.

+
+

It's too much to recount every issue, so here's a bullet list what worked.

+
    +
  1. On a fresh drive install OPNSense
  2. +
  3. Plug in the old drive through a USB enclosure - now I'm not sure what would +happen if you plugged it in along with the new drive and then booted up. +Because both drives will have a zfs pool zroot and the boot dataset is +automounted at /zroot/ROOT/default. My old zroot pool was SUSPENDED so it +didn't automount
  4. +
  5. Because the old zoot/ROOT/default was corrupted I did this to mount it RO: +zpool import -d <path to zfs partition - /dev/stuff> -N zroot zrootrecovery
  6. +
+
+

-d is the zfs flag to import the pool by disk id, -N it to not mount any of +the datasets (we need to change mountpoints) and the zroot zrootrecovery +imports the zroot pool with a new name

+
+
    +
  1. Change the mountpoints for all the zrootrecovery datasets to somewhere +like /mnt/zrootrecovery
  2. +
  3. Depending on the mount point you set you'll find a config directory around +/mnt/zrootrecovery/ROOT/default/config - copy the file you want to another +machine via scp or whatever
  4. +
  5. Go to OPNSense webui and recover from that config!
  6. +
+

All in all this process took me around 8 hours but I did run into about ever +issue under the sun (several bad disks in the mix, a laptop that wouldn't live +boot into a BSD system, etc.)

+ +]]>
Reflection - Wisdom in Relationships 2https://pype.dev/reflection-wisdom-in-relationships-2.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships-2.htmlMon, 14 Oct 2024 06:07:33 GMTindex +

Passage

+
Why do you see the speck in the eye of your brother, but you don't perceive the
+beam in your own eye?
+
+Or how can you say to your brother, "Allow me to take out the speck from your
+eye," and look, the beam is in your eye!
+
+Hypocrite! First take out the beam from your eye, and then you can see clearly
+the speck in the eye of your brother.
+
+
Ask and it will be given to you. Seek and you will find. Knock and it will be
+hopend to you. For the one who asks will receive, and the one who seeks will
+find. And to the one who knocks it will be opened. For what person is among
+you, who when their son asks for break, will give him a rock? Or when he asks
+for a fish will give him a snake? So then fi you all are bad, but you know how
+to give good gifts to your children, how much more will your Father in the
+skies give good things to those who ask.
+
+

Reflection

+

James builds on this with if any of you lacks wisdom then ask for wisdom it will be given to you. James is arming us with some specifics from the Sermon +on the Mount. We aren't just to ask for anything that we think is good... +wisdom is the good we are to ask for.

+

Tim: Prayer is important because wisdom will flow out of a deep interpersonal +relationship with God.

+

Where has God given me wisdom?

+
    +
  1. Marriage/relationships as Kassia and I have navigated many things (job changes, moving for family, family falling through, unhealthy parent relationships, church hunts, and our own self-development and discovery)
  2. +
  3. He's given me a lot of professional wisdom - potentially through AuDHD and the exposure he's brought me through.
  4. +
  5. Through Mark Forstrom, Andrew, Nick Z, etc. I was filled with wisdom on how to be a man in the life of a boy - how to talk with someone immature, let them be and feel heard, but also on how to challenge them to grow (up).
  6. +
+ +]]>
Reflection - Wisdom in Relationshipshttps://pype.dev/reflection-wisdom-in-relationships.htmlnicpaynebible-projectfaithhttps://pype.dev/reflection-wisdom-in-relationships.htmlSat, 12 Oct 2024 05:40:11 GMTindex +

This morning I finally felt some motivation for a short Bible Project video. The app is great (💯 would recommend) and gives me daily reminders that are unobtrusive.

+

The passage is Matthew 7:1-2

+
Do not judge so tha tyou will not be judged. Because with the judgement that you judge, you will be judged.
+
+And with the measure that you measure, it will be measured to you.
+
+

There are some personal things going on for me as I wrestle and work through an AuDHD diagnosis and there's a lot for me having grown up as a (almost certainly) undiagnosed mild-autistic. These 2 verses are in a larger section of Scripture called "The Sermon on the Mount", Jesus starts it by basically saying he'll summarize the Law and Prophets in Matthew 5, then concludes it in Matthew 7 by saying he summed them up with what we call the Golden Rule - do unto others as you would have them do unto you is how my Souther Baptist Grandma used to say it.

+

I've grown up into knowing it's simply silly to expect non-Christians to live Biblically - I do not understand the judgement some Christians throw at non-believers for things like cohabitation or getting drunk... It's literally what I would do without Jesus guiding my lie. However I've always felt a pretty unreasonable responsibility to point out where Christians are living by double standards. Jesus addresses this with another commonly known question - "Why do you take the spec our of your brother's eye but ignore the log in your own eye?". I'm very personally aware, almost to a hyper degree, but I definitely don't have perfect-awaremenss, and I don't know if I'm losing zeal as I get older or actually growing into wisdom but I am sliding more and more into a position of just not worrying about what other people are doing. As long as my family is safe I'm basically a full-blown libertarian when it comes to people living their lives.

+

The BP message this morning was just great confirmation that this is directionally correct, at least right now for me. I spent a lot of time as a kid worrying about other Christians living appropriately (this was partly driven by needing older Christians to help me live appropriately and so I felt responsiblity to help provide that environment for myself... combination of God's grace and undiagnosed AuDHD methinks). Now as an adult I spend most of my time thanking Jesus for saving me from myself and I simply trust that he will save who he saves. Because that's not up to me I can focus on what I can manage - my own life and family.

+ +]]>
docker-remote-addhttps://pype.dev/docker-remote-add.htmlnicpaynehomelablinuxtechhttps://pype.dev/docker-remote-add.htmlTue, 17 Sep 2024 06:19:00 GMTindex +

Add from url??

+

ADD http://example.com/cars.csv /tmp/cars.csv

+

Unpack automatically!? (.tar, .tar.gz, .tgz, .bz2, .tbz2, .txz, .zip)

+

ADD myapp.tar.gz /opt/myapp/

+ +]]>
Docker copy and chownhttps://pype.dev/docker-copy-and-chown.htmlnicpaynelinuxhomelabtechhttps://pype.dev/docker-copy-and-chown.htmlTue, 17 Sep 2024 06:18:09 GMTindex +

COPY --chown=myuser:mygroup source-file target-file

+ +]]>
\ No newline at end of file diff --git a/initial-proxmox-setup.html b/initial-proxmox-setup.html new file mode 100644 index 00000000..ce5433e6 --- /dev/null +++ b/initial-proxmox-setup.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Initial Proxmox Setup | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Initial Proxmox Setup

+ + + + + +
+ + + +
+

Look at notes in home-server... apt repos, zfs, etc.

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/interesting-ips-between-jellyfin-clients-and-server-depending-on-tailscale-and-server-address.html b/interesting-ips-between-jellyfin-clients-and-server-depending-on-tailscale-and-server-address.html new file mode 100644 index 00000000..7cd86b06 --- /dev/null +++ b/interesting-ips-between-jellyfin-clients-and-server-depending-on-tailscale-and-server-address.html @@ -0,0 +1,407 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Interesting IPs between Jellyfin clients and server depending on tailscale and server address | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Interesting IPs between Jellyfin clients and server depending on tailscale and server address

+ + + + + +
+ + + + + +
+

When connecting from my phone to jellyfin I'm seeing some interesting patterns.

+

Scenarios

+

Tailscale IP of phone is listed as local network to jellyfin

+

Wifi: off +Tailscale: on +Use exit node: on +LAN access: on +Jellyfin: LAN IP

+

Jellyfin sees 192.168.1.1, my router address

+
+

Wifi: off +tailscale: on +Use exit node: on +LAN access: on +Jellyfin: Tailscale magic DNS

+

Jellyfin sees the docker bridge network

+

Q: This might be because of traefik somehow

+
+

Wifi: off +tailsacale: on +Use exit node: on +LAN access: off +Jellyfin: LAN IP

+

Jellyfin sees the 192.168.1.1

+

Q: Why did this work even work?

+
+

Wifi: off +tailsacale: on +Use exit node: on +LAN access: off +Jellyfin: Tailscale magic DNS

+

Jellyfin sees the docker bridge network

+
+

Wifi: off +tailsacale: on +Use exit node: off +LAN access: off +Jellyfin: LAN IP

+

Jellyfin sees the 192.168.1.1

+

Q: Why did this work?

+
+

Wifi: off +tailsacale: on +Use exit node: off +LAN access: off +Jellyfin: Tailscale magic DNS

+

Jellyfin sees the docker bridge network

+
+

Wifi: on +tailsacale: of +Use exit node: off +LAN access: off +Jellyfin: LAN IP (via pihole DNS)

+

Jellyfin sees the IP of my phone

+
+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/ipython-prompt.html b/ipython-prompt.html new file mode 100644 index 00000000..548013a0 --- /dev/null +++ b/ipython-prompt.html @@ -0,0 +1,415 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Ipython-Prompt | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Ipython-Prompt

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I have a post on starship where I have some notes on how I use starship to make my zsh experience great with a sweet terminal prompt.

+

Now... I spend quite a bit of time in ipython every day and I got kind of sick of the vanilla experience and wanted something that more closely matched my starship prompt.

+

There's more to customizing ipython I know for sure but here's 2 things I have going for me...

+
    +
  1. +

    I use rich authored by @Will McGugan which makes much of my ipython experience great. +I won't write about that here but you can find my rich config here

    +
  2. +
  3. +

    I used pygments to customize the ipython prompt with my ipython_config.py and a startup script, next to my rich one, called 99-prompt.py.

    +
  4. +
+
+

The scripts inside ~/.ipython/<profile>/startup are executed in lexigraphical order, so it's nice to name things in the 10's to give room for adding scripts in between others down the line.

+
+

My prompt

+

My zsh prompt looks a little something like this:

+

Alt Text

+

And after my ipython customiztion it currently (subject to much change but this is as of my dotfiles commit #d22088f6be81a58b5f7dfb73b7a4088cbdd9fece on main).

+

Alt Text

+

Now in ipython I have an indicator of my working directory, git branch, python environment, and a note that I'm in ipython and not zsh. +I also configured my prompt to warn me if I'm not in a git directory!

+

Alt Text

+

All in all the customization isn't too bad with just 2 specific files.

+

ipython_config.py

+

There's several use cases for ipython_config.py files in several areas on a pc - sometimes you want a common config across users, so you'd drop one in /etc/ipython and othertimes you have your own which is probably at ~/.ipython

+

My ipython config mostly has colors defined on pygment tokens plus a few autorun commands and pyflyby (see my friend Waylon's post on pyflyby here)

+

I wanted to match my ipython somewhat to my tmux and vim color schemes, which I model after the vim-airline theme night owl.

+

After picking some some colors and saving variables it's a matter of setting colors per token and then referencing those tokens in your version of 99-prompt.py.

+

You can check out my ipython_config.py here

+

For example, I can set Token.Name.Function to black, and in ipython then a function's definition will appear in black text. I set mine to cyan to match my theme.

+

For the prompt colors just match the keyword in c.TerminalInteractiveShell.highlighting_style_overrides with what is referenced inside 99-prompt.py

+

For example, Token.Prompt is set to bold grey which gives me the bold chevron symbol you see in the above image that looks like my zsh prompt

+

Then in 99-prompt.py I have this set for the prompt:

+
Token.Prompt "❯ "
+
+

99-prompt.py

+

You don't need to name your script 99-prompt.py, but I wanted to know that it was for my prompt and I wanted it executed last so it made sense.

+

Here I have MyPrompt class with the prompt symbol defined as above and several other things...

+
class MyPrompt(Prompts):
+    def in_prompt_tokens(self, cli=None):
+        return [
+            (Token, ""),
+            (Token.OutPrompt, Path().absolute().stem),
+            (Token, " "),
+            (Token.Generic.Subheading, get_branch()[0]),
+            (Token, " "),
+            (Token.Generic.Heading, get_branch()[1]),
+            (Token, " "),
+            (Token.Name.Class, "via " + get_venv()),
+            (Token, " "),
+            (Token.Name.Entity, "ipython"),
+            (Token, "\n"),
+            (
+                Token.Prompt
+                if self.shell.last_execution_succeeded
+                else Token.Generic.Error,
+                "❯ ",
+            ),
+        ]
+
+
+

Notice I have 2 custom functions here, get_branch and get_venv which grab some git info and python env info and return strings I can dump into my prompt as shown above.

+

To finish you drop ip = get_ipython() and ip.prompts = MyPrompt(ip) at the bottom of your prompt script and you should be in custom prompt city!

+

End

+

This is more or less notes for myself on how this works - drop by my ipython config in my dotfiles repo to see my full configs for ipython!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/jellyfin-media-players.html b/jellyfin-media-players.html new file mode 100644 index 00000000..92f1a571 --- /dev/null +++ b/jellyfin-media-players.html @@ -0,0 +1,374 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Jellyfin-Media-Players | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Jellyfin-Media-Players

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

I use Jellyfin at home for serving up most of our media - movies and shows etc.

+

My dream is to have a GPU capable of transcoding any and all of our media for smooth playback on any device... +Now, I thought I'd have that by now with my Nvidia Quadro P400 however I have issues left and right with 4k content.

+

What can I do to still use Jellyfin but get smooth playback?

+

THe first answer is figure out why I suck with GPUs, but pausing that there's shorter solutions -> namely, use a media player that's compatabile with the encoded content!

+

VLC

+

I'll keep this one short - VLC is great and if you don't need a netflix like experience, I'd recommend just using it to browse your network drives and play whatever you have

+

Jellyfin Web Player

+

This is the reason I'm writing this post... the web player is great but not everything is supported on all devices

+

Jellyfin MPV Shim

+

This cross-platform cast client is my answer now. +You can find the project here

+

The installation instrauctions are super straightforward for Windows, Mac OS, or Linux.

+

I'm on Linux and so my install went like this:

+

+sudo apt update
+sudo apt install mpv 
+
+pipx install jellyfin-mpv-shim
+pipx inject jellyfin-mpv-shim pystray
+
+#profit
+
+
+

I used pipx to install the player as I prefer it for stand alone utilities over pip installing anything globally.

+

Afer that I just start the player at the terminal with jellyfin-mpv-shim +Then in the web browser I can cast my content to the player and bypass the web player (and thus solve much of my transcoding issues) trivially!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/kanboard-to-keep-me-focused-on-my-own-ideas.html b/kanboard-to-keep-me-focused-on-my-own-ideas.html new file mode 100644 index 00000000..822aea44 --- /dev/null +++ b/kanboard-to-keep-me-focused-on-my-own-ideas.html @@ -0,0 +1,364 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Kanboard to keep me focused on my own ideas | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Kanboard to keep me focused on my own ideas

+ + + + + +
+ + +
+ +
+ 🗒️ + + +
+
+ + +
+

TL;DR

+

I've been using kanboard as a self-hosted kanban board. It's keeping me focused on Digital Harbor when I'd rather be doing something less productive.

+

My TODOs

+

Here's the thing about my TODOs... they're everywhere. I've tried a crazy amount of different organizational tactics for my todo items. I've tried post-it notes, a journal, TODO.md in specific repos, a master todo repo, todo CLIs, etc...

+

The problem for me was consistency... I would regularly forget what I was using for TODOs at that moment in my life... was there a todo file in this project? Do I have a todo repo cloned on this computer? Is this stuff in my journal or on post-it notes?

+

And what do I do with new ideas? Do I organize them centrally or use a repo for the idea I have?

+

It was getting out of hand to a debilitating degree... For a while I just gave up on being organized at all... Things would get done as necessary and if I got some motivation to work on something it was immediately smothered with the anxiety of how I was going to organize my work...

+

At some point it became too much... Now, I have some experience with Azure DevOps/Jira for project management and then I came across Kanboard...

+

Kanboard

+

Kanboard

+

Kanboard is just a self-hosted kanban style todo app. I know there's a ton of these so the TL;DR of my lesson is I picked an app that I would just use based on simplicity of managing and hosting.

+

I have had kanboard running in my homelab for a long time, but I only barely use it intermittenly. And at that rate I didn't spend any real time organizing my tickets, so I wasn't akshuallly using it - it was just a post-it note replacement.

+

But then I had an idea for a genuine business idea, and if I was going to ever have a hope of making it a reality, I needed to stay organized. This was when I decided to give kanboard a little more effort... I knew I could always remember that I'd chosen an app as my TODO solution (given all the time I spent questioning what I was using at any given point in time). I also knew I could host kanboard so that I could get to it from wherever was necessary because my homelab is relatively easy to add another public service to.

+

So once I just decided to lean into this thing, I would take advantage of any moments of motivation and just jot down ideas for things that had to get done... Simple stuff like explore an infra management option, add one feature to a config, or migrate one website to another stack... And I would just write these things downs until I have enough time free to crack down on a task. The beautiful thing is, when I am struck with just enough time to do something, and the motivation to do something, I don't waste any time deciding what to do - past-me did present-me a favor and decided what was important already... So as long as I do myself the favor, when I'm ready to go I am never beaten by the anxiety of not knowing what I ant to do or how I'll track what I'm doing... I chose kanboard and even though it's not as fast as a terminal TUI, it is reliable, simple, and keeps me focused on what I need to do.

+

The biggest benefit

+

Not only is just having one app as the solution nice because it's centrally managed and accessible from wherever I need to get it, but the TOP feature of kanboard I use is comments on tickets... I get to continue to do future-me favors, my jotting down where I'm at in a task, what's left to do, what I'm trying, etc... and future-me is in a great mood, because when I have that free few minutes, I can just read my own past thoughts and get back up to speed without wasting time trying to remember things I never would've remembered if I hadn't written them down!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/kvm-network-interface-via-nat-ubuntu-20.html b/kvm-network-interface-via-nat-ubuntu-20.html new file mode 100644 index 00000000..51c7de73 --- /dev/null +++ b/kvm-network-interface-via-nat-ubuntu-20.html @@ -0,0 +1,411 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + kvm-network-interface-via-nat-ubuntu-20 | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

kvm-network-interface-via-nat-ubuntu-20

+ + + + + +
+ + + + + +
+

I have started using VMs more and more in my development workflow and it's +impossible to work in a VM without an internet connection for me most of the +time. Setting up the KVM networking is kind of confusing to me and I've done it +two different ways. Here is how I set it up on my home desktop using NAT.

+

Credit

+

First thing's first: credit to this post

+

Commands

+

There was a default network already made by virt-manager but my VM couldn't connect over it at all...

+

These commands got me up and running without even turning the VM off

+
+

I went full on sudo -i for this just to make it easier - be careful

+
+

Dump an existint network config

+
# as root
+
+virsh net-dumpxml default > br1.xml
+
+vim br1.xml
+
+
+

Edit it

+

I was unsure what the ip range should be so I just stuck with the original blog. +The default network had the CIDR block defined as 192.168.122.0/24 which is different from my home network so I guess it's fine?

+
<network>
+  <name>br1</name>
+  <forward mode='nat'>
+    <nat>
+      <port start='1024' end='65535'/>
+    </nat>
+  </forward>
+  <bridge name='br1' stp='on' delay='0'/>
+  <ip address='192.168.10.1' netmask='255.255.255.0'>
+    <dhcp>
+      <range start='192.168.10.10' end='192.168.10.100'/>
+    </dhcp>
+  </ip>
+</network>
+
+

Define a network

+
virsh net-define br1.xml
+virsh net-autostart br1
+
+

Then to check...

+
virsh net-list --all
+
+ Name      State    Autostart   Persistent
+--------------------------------------------
+ br1       active   yes         yes
+ default   active   yes         yes
+
+

UUID

+

virsh net-uuid br1

+

Magic

+

virsh attach-interface --domain <NAME OF VM> --type bridge --source br1 --model virtio --config --live

+

My VM, ubuntu20.04 was running and immediately connected to the newly attached device!

+

Credit again

+

Visit the original post for more details - this serves more as as a quicker set of notes for future me

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/limit-zfs-list-to-avoid-docker-vomit.html b/limit-zfs-list-to-avoid-docker-vomit.html new file mode 100644 index 00000000..1b741a43 --- /dev/null +++ b/limit-zfs-list-to-avoid-docker-vomit.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Limit zfs list to avoid docker vomit | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Limit zfs list to avoid docker vomit

+ + + + + +
+ + + +
+

zfs list has a flag -r, but if you use zfs driver for docker then you'll get +flooded with every docker volume in the world. zfs list -r -d N will limit the +dept of the print out, so zfs list -r -d 2 gives me tank, tank/encrypted, +tank/encrypted/docker -> but then I don't see all the continer volumes

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/local-dns-with-pi-hole.html b/local-dns-with-pi-hole.html new file mode 100644 index 00000000..947138c6 --- /dev/null +++ b/local-dns-with-pi-hole.html @@ -0,0 +1,335 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Local DNS with Pi-hole | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Local DNS with Pi-hole

+ + + + + +
+ + + +
+

I get https URLs and domain resolution at home with pihole's DNS/CNAME records

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/lsof-to-find-what-s-using-your-filesystem.html b/lsof-to-find-what-s-using-your-filesystem.html new file mode 100644 index 00000000..004945b3 --- /dev/null +++ b/lsof-to-find-what-s-using-your-filesystem.html @@ -0,0 +1,336 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + lsof to find what's using your filesystem | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

lsof to find what's using your filesystem

+ + + + + +
+ + + +
+

lsof | grep /tank/nas shows me what is using my nas at any time!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/make-a-series-of-directories-fast.html b/make-a-series-of-directories-fast.html new file mode 100644 index 00000000..3e3c40c4 --- /dev/null +++ b/make-a-series-of-directories-fast.html @@ -0,0 +1,337 @@ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + Make a series of directories fast! | Pype.dev + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+
+
+ +
+ +
+ + +
+ + +
+ +
+ + + + +
+ + + + +
+

Make a series of directories fast!

+ + + + + +
+ + + +
+

mkdir s{1..10} will make directories s1, s2, ... s10 in one command!

+ +
+ + + +
+ + + + + + + + + + + + + +
+ + + +
+ + + +
+ + + + + + + + + + + + + + + diff --git a/marmite.json b/marmite.json new file mode 100644 index 00000000..0ca72bf6 --- /dev/null +++ b/marmite.json @@ -0,0 +1,68 @@ +{ + "marmite_version": "0.2.3", + "posts": 199, + "pages": 1, + "generated_at": "2024-12-06 21:33:13.446997228 +00:00", + "timestamp": 1733520793, + "elapsed_time": 13.063972086, + "config": { + "name": "Pype.dev", + "tagline": "my mental data-lake", + "url": "https://pype.dev", + "footer": "
Powered by Marmite | CC-BY_NC-SA
", + "language": "en", + "pagination": 10, + "pages_title": "Pages", + "tags_title": "Tags", + "tags_content_title": "Posts tagged with '$tag'", + "archives_title": "Archive", + "archives_content_title": "Posts from '$year'", + "streams_title": "Streams", + "streams_content_title": "", + "default_author": "nicpayne", + "authors_title": "Authors", + "enable_search": true, + "search_title": "Search", + "content_path": "content", + "site_path": "", + "templates_path": "templates", + "static_path": "static", + "media_path": "media", + "card_image": "", + "banner_image": "", + "logo_image": "", + "default_date_format": "%b %e, %Y", + "menu": [ + [ + "Archive", + "archive.html" + ], + [ + "Tags", + "tags.html" + ], + [ + "Github", + "https://github.com/pypeaday/pype.dev" + ] + ], + "extra": { + "colorscheme": "nord" + }, + "authors": { + "nicpayne": { + "name": "Nicholas Payne", + "avatar": "https://github.com/pypeaday.png", + "bio": "Just some guy", + "links": [ + [ + "Github", + "https://github.com/pypeaday" + ] + ] + } + }, + "toc": true, + "json_feed": true + } +} \ No newline at end of file diff --git a/media/builtin-calendar.png b/media/builtin-calendar.png new file mode 100644 index 0000000000000000000000000000000000000000..bb004032f6f140e0c218815a1c14c66e71c2be13 GIT binary patch literal 405680 zcmV)uK$gFWP)Twf00009a7bBm000ie z000ie0hKEb8vpOvB#6d^jsV5-3w zj1BJ2FOK7U9ot_!F3C5slh}z9;(|Z6al>>F#Rf!CK|(?j>Ztea`^vW0=l92LQ}3Po z_U%eIKA%OrJNL|)GiPSboH=u5F8a!4Hv#|x1RP+%f>#1WHk%k9vxqKeI#N(4fOrn& z#ba!TW4;9hy0{QFpUo0&=wL~ekVQjUX=z?0K;RO|%pWAaAlIX?Jh3LmKTEnVLK^G`mKQ|VoBOscx0!?BNV!JH%+={e=CfgGjo9`XV6AK#g;& z&&WCtHWTTxMK%Ce1Kt`Jc3v*Cm>EoyA{kTfX$694HNoKs#;Fj85GH2Q$^3R=qTbn< z#%A+5ERE?!1X~jkeZF>>%;#VpibO@EX~qaK3~T|Zs}BkInDPz6y6&)DUMPUQUBClv z^0KAN2DnTLW9DSAmd^G=(hWVND?!2`Rt!~c^F-q?X~byF0wP>c>W zwktjhbmeOp2Ar?rFQCK!Dp8E;xW?q1W=?0u%<;YuG&x#}r2*jmQFQ{`>#Sl;Yc5uF zhTeDWs6JmB*)@n3dkB2SB8^!rVAHN0VL^@*3b32S+`7nbVmoKES<8@P`a-d9#-uwc z#2$=34-Wey%6@&d!rUYSI4Jr8eYE7G<3vK|LP)&nW7oSK`7%g5=auyrxi6q#t_lG| z`6Je$;?5-{si%DilZ*n1JVL8MG2}^wlcMnBP;N0OIBpF%5D;%1SY95Pvu5NwoSd{t zX0QZ@qe0J)?%RvqBV~(aMu|Or@iKv{C+%J&(+k?Quq(>}o2sW!=C*EEm$M_|?X@cb z*}UV4=)1K_JP?zLQe>exE`}rql5wQwDjkvS?K6G|z3Wgc*P{(kl~h|ME84;KPI3_n z!IUy!HJ(RY4xd-pV_d^%O;E!5U8OrAbJkS!>bnG_HY*p$aA!J)h^BNi$#!jTJCSf< zRI(9Ml*Sj%=Wc1RJ9uLOWPrD}F+vI*S==aZrV9|UdD_*Y8Do!?5dS6EcAC8_yviQz0;nqu<*&VcCOoW6CMVO_~V4H-+?rPwPda$M^r zNZ)Gqrn9+;sHKj0jzctAh9XynU9D+JN&5z&HaOW@ta2H&zysoq*%_>|T!cLfn$^+G z$%3>vF(scd9s~;!V}+-3Dv04p#V29mQ!0;gzzNoiidsp?h5d5c)iPUG1DbQknv$K? z(2{;6ZN8ifyItc!AT_}33U|FC=zg+1+-ojbs)9bP=!&)?x}l83a_-p3ng*UijO7Qk~gVQ z$-H6~{^UuSHU|cb1Qr#qu1O>teM=WbAc;i@{8FaposP|Fhg462u#p*cbqSFD?8de}lAUw5y zfntEjXgx1}5}Ju(&uXIyGKr1S=@7?)M$&?&z9@1FNX-}eEulPI)B+K{8#f%OW*M7i zw3oOfhC@2BsL(vWz=S#q8$)RWgh93~hIV7Q2U8M4dBY}PlU z(5L7bg<^$U7m_b|Zbo82$rJ6QVcW_D#AAurF#Q||xLJpFMB7Ai+i+T}KE{_q?IgJ3 z2>>wH0z3gpUv;(~Eb3B*2=kX8h;k`YF}Mn@e?;8sFmXRD3av@oqqkoa)~k23vW%L$9iS?v5wVwEO*CDHa8zO@7}&nnom=>*EC8lI1I_si@ncO4J` zT?b<~hqdg?g}vK_qR5?&=y#OTDZo&4aA}wX3sB%xkkdAe~ zQZCO1QQfQ+XU5Kg*KA2NV$JL92~j+_tmBS}X7y2A7R9P%nKqtTBDCRY3%Z&%7X|V- zHNrrmd{ipHp|PE(a4)J;Nrey@6QCwVhyG~GATiU52b!6N9F`$som&(apQJqT(rg6o*jD zp>QQaoFL&#bY3C+1;zl*;~3-HU475m&GLMtAmmD9bUG}CWKhuYulFyw)j#eF080&? zS18*4fTUybt81Zylk+%&w4aKE=IB{s3)SvhQkK8e!gBIY1F$OsA%~O`TQbB%-eM>9 zqTQsau0LIlZZT11T``KiU#qgcMO&yYv?;TQ#3XyOR8QfP)WK&P^JgEkCy|=O=Zz)H zf#O7Minw9bf#aMlI7ci+QDuTJg_0oeIj~S2NGXhY>o?tyg~^=zZjF}eiiFY&+5VSo zmMZ+LgA?WlCsC*n*|kg1WjpL7zIO+^jjm0v8dhk!UdTN?3q@tCN-+ccboV`8_%+e>Y+Y4 z2*Q|tNBV-h6pSu%;l$OLI#72-3U##_9qk7eo_}Y7-OQ8_wR#{`)JW;N7-%v*V9SJq z32U#%q~N&QW0RH8hqBTU@t>?fJsDBI_}(IlF=k5BvkR;{f$+@m0|XA0Hk!q~3PMh| z9|+aEa9KqS0Q$ye$>MB88eC~1B9jMSD{l3SIdqpm*N*6LuBuJ*#VkMMD|gXbO!soc z`nVWIZNOZOFj-XOB<77_PbwlqYm-9_VZi(>C5ir&f+9X*`Ljo6Bt#E;i-rS-<_M~r zGke17RbHR}?3OL(wr#h~Bf3BC>gV&yCC1>)lDjb8dq0iBY{#o?Q8*&FKw zjLOR#fj&_`)Ftak&e8Tth9lWEnq&n6=t_VhK%^ zLg_K~A~=as(E7Y!b}j%AOIQNfVwOatFX3don=Jdb99o17k%$h6A;4gq>{D%VEben0 z8fhFMhbz74<0X9aBLW8;=6Dy;nGQ@TZJ`MTL9QAEi##C_dI^L8*lB_`8f?duXhFbw z8EwznE7+gXrXb>w007KGox(vY1w;;L_7$yViCKX*P!IyR=_4&It!2U@(&_wv|I-0m z9;~5EdSU<|81&9xQq?-MB2pXh`@KU0nbRkRwr}k2?M{)|*<%MLJuD8`_4_@`*VHdq zTCH_}7oRwDXm3Kuo6nC{Tv5MZX^n>Y(i3Oi+Z(5;nX`|vXjOyeOE2;G{QyuoX;Qnb zQH$9pYfVn1vSXR)I3{Yix@yix?*V}5;lqcYe?f@9=u@Bcg+l56fn5(j3=9RjhR9m< z3g64?Awp(tars)#ZVgDyRTREJH>*HF3t^%CDx}2tr`5~1HwOe1jCm7-Ic8X^*3QD` zLsrE6Fu<6KR4K*+M1Z3N)<_qWXea`%u84eV=Hd1#BmJShYZ-g2-$*1 zSMVf?ep*}ktg1EZn|?S#>9Umpn?A+fJx>QP5ap@J1evwMRy3_r>&uoXa@)m}AEiAx zl6iQoDY?yPrR}QJ^PZgaSc@AX#uNIId!dBwDMLHTZRtp zi>M#iC&{DB>jH?3y0Bmj1X7$^19|IPHh_#xNtg6hXL>}U6B{AbwLw{yzU~xIO2VNe zQ&BdI3*UHGb7`5iR4c3S&ze^`y{+Q0UmWi^JB&CDB&5bXPn=Y`_Qs})h~G?$^`(V* zCr&O|d*gT#Gb+K9S4PU%U}tCfgbCSHs(srwcQoAt$waWKO8YS!jfpUkHx%@RLI9AA zM#)!Li@9T`^!JBOk@6{A`tnPGqOn0yJukAuAfIDLPT3@GOWC2~CIuBfDVxfcFmgh6 z;dCk#3e(S4b^sWCCT)PVcd+BzF%Ifb8dFxkvL|EDx$Alr*7CG#wh(X#)f7(uOsty2 zd$k3LLj4i2Jx0I%KvD;D$kL{;y*JW4W2zo0qJBqUK_E83DE3CN2aFV4c5A9uwlR?f zgTps_3~`hGRLkLSu(We)pNFQJ)%OFZ?k8gbkxM8IAH5KVS&g)Q|||yoHIgB<^q1 zbk|`En+p{~GbzE)FJ<3B&k6?~?MIneMA^B%Z6DlaF4s|Tl{-!_Ci8s09UzXy6FJ};By)477)e?5T)nlP}Va;_- znninHcl?c)I#~*in-U0SFN~Cw`2b+^`p)f}dbQ-!Ck7w<(u_dBQ&S(ZX%3nEgCVbG zr?#INe&yM7x7<4k00#Rr>2!|q&smtKhhKU2>@D|AHZb$jQr&}!MN5IJVa0-;GgxgI zwL(18>K*Qjg3JDV0mA#5`GP^(Q^wxtl}iKO-F-*?Cgx}*jak?sEL!UEICoW5*kxf4+Cs>cqTxp5dW}=U)hS zw6m3P5_jLKm3_-D27qx-J!2FHsoI*;_uUHs<@*mbyzrt)DIW|b=Fc0LJ}p~WnG1(K znXE4nFFSO&V*564irP5Ng+sCB%Lk@S%Z0;%zTTQwU&}-)yRW?l02-couI%t(U3v)R zgTdIciw9;*%a@h;;_=F@+e!}{IQhlD!T=>ljy62?j3HtK0K?4_5)0<1#y90kN>C;f z?C7l6v9sjJQK@CX=o3PJRhLa#+4d<9@^{4cnawF)YpRJ;;x*J)(9B9~^7OJBKimue zn_unPwyB4Fb=kFz^OsZu!20Lg_iXP2Af_dZLnXfJZ<{b-QfWSi-}qC6OmCJEP&SucTCW)AC$J zY67Wbe&Z{h`*!w)!hRN0MBfgKnQ7LC?<{SoC*KVB_U--kuPI~<<5w(iTDk-P_Wbf! z`mt0%Wya%ug-`2g_V6Hg}2oY4}49+ECy2;X4_o+U~r={5{y&x&L>MYV`@3uH3%f+SzRl3l@Z{BiUrCd*A-EZ*AeH z*vd&Qb#v#GH8%Q7!nt&2prf;E*RI%!6J(7hU%9q+b{hcf`su?pGp5(hX$w_EvZ!lex{N@S+Pk^lcR?-5Mg1sM^_I)=PQy%$Qvxqjl?ojhhXbc{zf{TfV1qER)=G zw{F{myx%e=Ac2lW{n5G1qDJVrFW%yUpX*foY#4#+Wyg%~mwJ+IHaIzfS(@SlOo&-& zSp5WnPchOuQ&j~3zC@yH?V4;=Ro>_CpFSP(`Qhf~TriLe26|Vm8vod1CMTU&ToIo? z-^`v128WuPhnkz~-rNu|A_CLZ)eOyn>C-!N`Qa9wX5VUyraGhz$C5wVXYp_Bkox=d zL<~4nS$XcxJG151aizT9m#(SlTV69TwROTHzd`w&&VOm?*}Lw_R90w@srve^8?GPw@fP!g}nf9cweFb zRg+BS9{KMhLxVZM5UJ54W&3(l0?gsuum1bU&|nrYs;Z_ig_g7;gd&w}K_Yi)xGDkw zIG?YYI(5Rz6`F;uN5Ci|iQfB}cAs_hv|67jVm zeZ=9i@#DuYyI4!~m-?EPF7bFhr#EcUQV<~I@l0B~wzh4inb#W(R<<-(wltsKu%Tne zPNL!w0LZ3NjTbFyT(nT9=__Su{sqPWsNU=1XpR~nm3ue;{2i~ZY#pSE0*J<&j(_b$1ZJ5(t%#f((Sq83eBRe+_AIt*fEsJX3NX^ zRnnmmHjaKa4;~5%GHH}Nmp9_GZt5=rq+wUD5 z0>{lzqrn2c(#q2D0I==wBSWcP2BEd_k~z&Es4SVV^XTum@5i|O1dUMv1_lz@+eH*;xp$~ z0>I@rjC=k0j$|^|GNttL>&F2=$JyZ>TY5EoSK-^SzO?RvK&YxFXeKgTVSsql@`grg z2~6Ijps3Rk^7y>5V|owtg-a?YwE#ehH);_CjqcsBVE&o6-b(dF%bJ=R7S0DigW z!o-nRg+kzah``@v+wB~CI&4tp%D<8)|R&#}l~{eV@1N&>;YTOa=hFN!>e^ zD=CRCSpopTuI`Dy`yI+=0ia^ve(d!oX3xeRPpYx8 zRAi5+DWoG20Pw}*mhTQAQ=`xNmZvrl7@j-{079ou*REf0Vg`D9Q;p*Qz-LbIWu=3y ztpMQbADHmSuQiLj|6F_5)mH+5Kc4Uy^J}KEd~oU%4Ric&e(UWY0D#K3ww(F+{W@`z zW=S}{bO`_iy1JWw^LtM=3jpPN_hYZOe~vDtuwhawRorNM%=uyg;6&%mPMBO;Qx`N%N1qSPUs??S!$a9U+gWSO=l4`r2LQn5N0(pQ zct1a^PVQU~H!ITz)U;i!3kt4ovsAlF&00>oAX-2Kb>j_p?06;PtC)o&_?%QZo+j@!} zI~F^B908P%AFmm;@slS`yt*DZ@OX5ZotO!7$1Z#(`K&!_0=lT5LzI zqC8hp;vLeB@<4Y_pqmN_9cpdWepGIMN3&=Fz~8C6zDz3_00yV(n2~MUG>aAhd;^32 zXkV(K0Ra5QrtR>QDcI))fXW@aJcN{dq?F8+umYqq0|UdIW#NX!t#`e5_SH;om_c~& z+$)P(KRmg9Wj2@EfBFTJv|S9A1Y{kyyDK?ia;evcDkA=PG>rh-7F21M0PNh_m(Apv zVj?yEd=3Dx$BO{KbtiLK%d=x%{cO2` zC|Z~-5fLeo+JKhK-_pg_OO8q9aWWN12vw2JR7z0>%F8@HKL8AzJu_rL2q67qNfpkvprR6MRbc=EXa^y$)u1_1DQ^k8bU(Dqei6rvdeoez09KN^Xf$!t|pCUpf3i7*VdEGc>4zcutwA0Yx(y2XUrU& zGMTR(0EADTGJmJ5OyijH3+ge!u{aoBReyiKZ(tx>R+foGPJHH5{#e`}iw1h5;S(oI zP8=t7RI;f_dkCF9V-n1l>8|Af!DMp$cgK>z?C z07*naR5QKwP#6I6nM~GLE|%8U>3p6&M`C(Ix>GjQ-)|IZ)TooHQJ}Pxp;;LG@4Vlj zU>LI?NYP#;JsB1~qSwB72lQh0B71w~f`j+9uNeSFxhsu5NNh~$ZKDO&dj!{)BEv=G zfM)z#@Nn=Dw~TSSJXrr1`+T|b3NXBqy2Tld0tOrmWJ^l{Ake4BacVwM0LTaY+IcVS zFYomN0LteA@i>4*Q*+H~2ChFEMS$~xphh!DI6=+hUp#0Ovy`z<%0z2goXu>0NCfvmY18D2oM5fhC}27{(LZC{dql_l>G6y$-g$MAYmgB(33d4Vc(B>5=Sz* z;Y=>c|7np4xqLd686Y!~l#$aPfTanTS3Mp2399P403g<6YmN*!^~II+fQVQ}vZM zGD`!5V6Z>?%5&$mQ+ZXjL9#RrS5zPcmt5W0I6e#j&p=a$~yu4Ma}p%QvD#hl{gHWV82mpy#I*+kUV;}@9CX2zz+8z)9(v8b(GMP;!5q&*Gh`e%( zAQ(3KSTY{d(nAp=g;?@=yxu@Xxt2&)T6;@)h+{%l&C*G0+v^Yb%SwShPZq8=uCwhW zV!o++aAQnLipcH@27Tc$L(`A}BE7J(W)yJGfip7SYJw3$q`QStn`My*Y%oWU4{|)) zn-%BB&Kq4rhof%v6REzXu(StOA<_gn9alUsePphN6~UTw#}mJ0MzcdH>bPSJeA`Ng z8n41+gpeeI%?v8Qw<+7mYrPWjK=w~$Ye9(UAalw`2J_Os&B=iT9}x#*C=hO8oUW?U z()`gVHV$2BuF#Y*{g_t`q%`w19-s6x>w}p*5HvMI*`jG(Ul6nG#YyJpH*NRlOj|S1 z+iTXtw6mF*gy6aMmWO|yY#NuWug_IhWU8u%CN*P^H#uQ^Z1Li%&2Q=1YpMXiJ2>b` zr%V>IM#X)7eP%(K%1Qu$Yz`3~ui=RkG=}|sQ6s_pOC3D_Xs*ahyhISbVQS6#(FTUKYa|t~L#2ZE#@#2v$`RiF)NV^EWd*oJ~@( z@_PEfU_O&JDr>rjtpRH#5;P_7e)4%;fH10`!l4QR*{-Axg5l!cNKtaBUbtPxh&4iV zBByzDK*TemlHFF(%q_{N)Nq*9eM%#j(Dp_Oml^4Z&a4%_Y(gqXDquqa1Mn9wP{lhW zNlHP+0tEA71G=BE1=vKjkU;`!77Nu0N$ME!82rkO)eo4#;=#wTAk;9L1%@#8$6{a{ zy3!3?8^<#rGzLcaq()HPzT6Lk+rA!j#oz2Wi88QJm^85 zEr);JlQ_Z+A*GRRJxlCMoQK|?R9!@O+x1_NNm0MOLT@PoX0 zuo6MIx?1~m?O?YRW$Q8aA4=;R<0nr6079N|%a&=0x}%p;fJn20(}{#0@nNU z7Qr4zm8}ccqOyQ-C`k=pvvD1*Pla1%bvkq;UojSmbTO{vZ{V9f#HcPJ`4Pu}+RIQ> z86yqb)m7;(Dr>T|jms4DYNAQmtL}Mv3R}9b$K_ZP7)CBJ?gvJS&4EdCgA{ z&KwaKSQ|TxRbkR$`-9PL^6|xyvf)Q&vC{nqQFJ&<1DH!~X-*|z9u%`%Noc3Ie6cv> z^4ROq{E%EAMZc2>^kf-V*YXfwb<^@)_ZM zrcASCWf&oZF#x0*8dDR-1Ar%!^$rf2x&1vosd0?}(0==^Wd{yI9uG~OVs-@b+?yt) zTvcU081$rcm)`KCNt%?(3@KTfO!;${Iy(Kz>j_|--*V&^J&7X*F5#&yUUX4UN3yOV zR9@kqIWGbLxh&T2(lU4q1U(Cv)d0XiB75{ueSX|{#1|0Ghx+gEir!VxQUrEf@_4WCjN-r%dq$ zL;73I(My=E{%{E(4*=w{SzZ-sIGR5=o#@Z!tn-dx>R6ke1Lt$d;|)e4p~^^7tBBXr zyn2;}5H-G&0!Y7|Hx*Chi8GWzj^_CVXa8R@Ew51l6~jvgBl@;E?S&JTXU~M}Eo-2v z*m0K4W%xwt6mW1#6$wUM!uujfRO>Sr=2f-D1Lt*;>-rZ_V&_%(`jvtOstzUAm9F&C z+_9QVGFw@RJstoEM70B6+F>u_`qg|s)ZRYa)RglFPTzKW#hyK$Y$iE=LSl9s_IN^F zozL;Rn?eO*f&*p{_3NJXzNb*OnbT1b_!xTXQ8P08p`Ow{O@u zU*bW%t5*YnC!ML@up!XXgAhtbBGKi`0004$9oVn&=^ak`hKIA^aIUnp= zDk>s=0O&Y7d~lDshi;V-2zur&wmt_?TJDeaS^*y29m#Ym7YKSw%6zwdZ1RD3V}McX z%(C$yLV?4FaW~K zFK;k;r7;5<=AIn_JIsEjY`*joZ%8*c0~PxILuAtAlA0O-luIQ~z5WIOAg?D-UJd~1 zM51}kn)2r6Tq;#DabhqM0f6D&-rn~Png#V9IMBFoA@X?vq3W440U#BRCr+KJo;d>m zhWq*~FAKr|kk4uYK_#`d({H*dqh0-h@yYe;aW0P$mbs9vKwIKEg@Lo}I&}h((>uLeo-t`S3VK zxvs%}W>lFsN%=6fW_BuU%ut!Q%)MrW+y%7o>m^z5Dh#9>qEZ}pRv_UXrF@x)L2^Zt z`l%oU+o>9f9z`(<9JPXhmIJ0;#R7CGC(cDVe|!OBl+le^%QZ_p>Q^6_+}6JS`q^7= z%Ln|ahWhS?D@;1!vu7Khc^2||7t$v6axTM?A#ff zJ119Kn)3(ZbLW^jN=}@p-LS!A(w9h-A2`@QYi2&+@3~?PQ|0On8-pF4X0a7JclE7U z4gf<_CJ#-S3;^{n{xP!Zm91iq!c=Pw&9uQG{voXg|SvQu^ZNKE$9zY1&$G9b16+$ z{1{f~_68jr*9rg_-xUjnyupw+pNDte>LKtk0OT>Of1&;Q+a`ECs3H=$Xhp4=x8v;a zx<^kFF&7r2fgtjD^xx@JuIpTqltLzh-~3bO6*n{?1a%Fex~m$^R|ARcx<8y69L$*e z9A;I5K`%+OyFF=^h%l5_`WLUL;VU?GR=M`$;NJM&ol!to1(P;v6;>-=Z{7TPyr9dP z#sQ22fWh{5jZUyizoo11$dQ`qGpeUgH<5Fx)UlUdH1G2QfK)7c_}OR1uUuJDTbE0x z5~oj{*|@3oh7SM$&SWz~0}OMyOgeV-SfsTT04kcBwZzQuu=(MGaFr+|07Fnek%ot( zn%xf=@ac^kX5M+fL7zV<0x*V`J@DUxA~RARIAXkWo7I+N1eInPVRz@L8>Z>v#XP%T zL5OZ(V`5T(+9P*%USpwIOG1=~9&{N~ruiGPt2E;cn609y*(9s_m&+# z0{OgIGm|DD-N5w@4x%(glefMAKx$bb3;^Dt!HK{5ZQsfjgDoxjk`hlQ6X@o2jnG0D-mho@7ober^!!GnXVm%W`~J}5W;|~jk{)L5baHA z)T(QoFnf}2=P%P#m4SJoY}hzHmG199vhLZ5mt0y>Uzg8h<0np@+qxy)pJ0maKYQlj zA09Oyk=IjFQw0D+QSFOstbK6&zu2vtUOni{f5 zo9a9WC1-EPO5O@1YZYtU8Nq^Sn<}0EEg^&%1be?Mdrg82O-cY0 zj&}w7m9Btn?}fVk=BsOOl9sN~Bsvh20(1=v(B7^>3#@X)PJOZaoQO0+M2VP*K%z2_ zC|r!11rv)F_N=)a04jIxs#*UUQxEEqxj4gMi90>YGD}g!jCNB3RioA{S%Lid4VoIs zcGZYlUsUL*29Pygw0QiA6##JLxo6@hPP)xrH*a3^rI!If$BrFmH*I9zs>uNfHr6Fm zs`GZRx(n6Ds4c(=g2@M-DYr%~!27|RwFevi?Z=4v2r6i-8Ah#<(~5=F-y4W7jamxF z#sNj=a`Kz8U=xs_EC>N}%8_VfCMUx7U?XRVk4}}alRSk+t&@EsN_F~_fC})opw)e3 zpD>_B;%LC{m5ABpEp_v?Td_TgdNWeNAAn_=w z^d(j)7r;hAnMR}{RP)LT8EG3xCMr73Zu#n7!&8PInVWZSA;Db`SZs($ED4G$TW-W0 zh+ffe`DK#>8%)$Vm1um-h_E9?G=&sItcuxC>vUGjnv(#Xk+HcQEedlsu@BuQLFu5F z1Pm9uZCA7mbJ2QEf2%&okUqDlPqx@72$>}^6ggT2kNI3E)OFQbCefQpH9YgId7Xj{ z2+K9?RfY0hiPAOLPVM@*atX4Q9CnP{gsLTa9{Ke20;}4Arhzu#6fJReCE&j(sYSK4g%@!A~TfK3nhuV9}2E^07f1LGeU6W z)~0WdaIeFOGudi|=BL1wHbGXx{>TpYAjv@Z`)v=jh9E@6EqZ4^sl`9QP5Q}8gVl1e?AR||b{n~=W5!%cS zxm+5xB4dLxYJn5INr4Wtbfx`V8MO?Pq){txLd&QvY`)j-;~Po%!FjVYM%%o~64->+aV0awRpip0^F0dndc zh4^tt)fDD$s&ZiF!f2E+GkK}IR4)J{n*_yuBUNKpxnY?;uF@8?SuZR}+Ove$QxxgO zR)n?C8#|lLG|BkYxRfvefc51fp;BP0W$ZN4@vn}qX)HCQSVUoVM7R`5OqwPZ8i+Rd zayCR%1hcapy8g>D^cma2tSQL}vhoRyT|38$4HQKmB82Sh0ef?ac&m+cpA3`FLwT05 z071NnxbVQS(Ok8viOlX&U@E;BOZ|~(G0ZbT=qUQFK>ygk7M1nq2#OUG%8wAXjbm3K zy|C*-#t5+E)@%W+sEVDNOp0|#-@aIq7w*JupEmuGn;;qO|TW z`qGtz^62(175erqDEzuokv8!QhcO zF_=65JgnINrGT}6&a+{Cfmrrq){`%g`r3iL*O~aOA~HvO)|0A0Q?clRVJw?Sr9Th{ zNE|U0i!G90gX72ES4;*x75^Bs2pq~V4L$cwuFgF&{>6osrBuoVJr^UOPnnx*IUh)D zb1JvmK^9kUM|eHHJxvl^kUwutsBd4$UP(GFldI6BnR~df`}!yXk_VYwATYY8&Wi_% zd=@J@c}##(uXcFv+u@^9uhD3a!d+@EiCbMtt0_CbjL>*sb+xFFQ30p@oB}$eEF#u? z&A)Xhhz!6LO9~hdsGu<9Bu}Rg13PhPmB|;tU{T5wv--%sM7013;kRn-DZj75t=G2L#S3El zM%({~?CxhR3Vq?+Kf+$bb8K%YtIx$kOgnB7wI4kSAhHRIO21In3A>gIIdD&A6l7N< z$Gr`Rn;p3fKd|?&FmJi29jV|HFDo(8-OL@*!DN%J3k&fJMj=6_ngy@C?U$fzI8>cNA$8xg$-bg*)s3GLfp+GmKxQ2|5euV8 zb}dQJ)mst=0jX)Qk;LIJFZ2Y3Fbb;Gl&{PX{bbov1Q%0+BXfpzV)WmUV(eZyzr=V$#b9+#dvI;2X^KM{Z}~95zu6PZF-4Kt_u{# z##4x0f-nn7u)Mlz*$1zd701NcjFkH^X~y#Es^uTNYAi|`1rTb0Vs))zsTYi?zhV#+ zQ*q>%sgX@TSA;(Uf4>kYCC)Y5_~}z-EnDRAc^&CEVis-M007E>L)xD?HSoB^zhe!5 zuHA+NW?R0n8msgQMErrwV$e9SVM2vH_m*N|T4l_Px<qGQe!__zLUUHtW362y`1s zq##v4HO~_n8)K|{5cih9O3zws^0{aPjxm1Yi*<7sL8!7g7)Oib!im)M2LqSieaq78 z*LwZFEzkT>OSC`ju6Pz+SVx4AY-7;owo3#qTFV~{thxJ^rPp8K_50p>=1+>b+=6-x ztJ`B<>b`JCu12oi01Di@c)!o@vffKRj?MVB97v$*mqi7clH(>f-}G1a_nzx~;U~X- z@9lT(FsC%%^aTy`H}7quF-Z=!-*#PrsvJ*%c!fwb-IazgU5Jij#PBK!t5~~dCN&!> zazk8}N#@&A9bM#%%QGP^nDe~yGXPhFBO}hT<);~%09}aL-r7sLQbb<0HkEtdnI8l@ z4!3a^w_j0|>08FlMpX79%VuCHcvrX10>u?Vz!OJ~w1r1IYH{-0UP z7bgb?-(L61vEBOw_(CQmZ@pgcjh}z;lG|?%go3BvJ3?Vnt>C6&0&&VhU7$2lao>0U zZr1XPl7oX=*S&J=-F*x~QGo9Ec7LW)RO^Krt`5>NNQVb*r6#G0 zl}w5XOVW8dtp2d6mhHwxfqIP0>9f+DNaIW%0GC}{tvv>s!kxc3VJ%369|4hYNJc5y z2YdWks4HI&=p@K&+c5&!2VCHJ1ax#97m}zw}x@mtzXGsHyBj0P=XfUw`Uh z0Ql}L4`kA5r#y5G3Pv!1^2Uog0kx^8Y(Owl%286%DPX&mKMP*3@9R%K3;^G~O_vg) zMk@7xpFeQ-H@?_7rRBY?JD>XDPf~-!=DYIh$X9;*Fhl&icicA^?`Nr*PZ$7T%7VE| zue%BWTH0oAec?~}Y>vbvZqHV)k@q{#KL!9_|G*vDOa{z;2E0zd{y^X(-}qwVl$L{A zcRck2twt<|MTD|Q<=_13hfLzX-1Yh4{sAVD7)xrNHh*@W!vFvv07*naRDn_DVtKvd zgI8bkz+F3De)H)cG<{`QTV2z2a41EJyGwD3I~0n$6?eDbQk(*%xVsf7ZpEFT#oZ-9 zad(H1FZc6aUw-AvJ|{C<&g?yFX4a{XMU^?wx}`kK!PE9ADGh1TotKFn$5MU)X5hea z!UkZ|=N>iyixVlB)JOgfU=ANd;*SbR>X;0*;}rRH+@j$XKZhw~&EL_+2&?8o&b$Mc zx%~cuO`v^Q9nKUKME)l$>EUhdD!CA_H?+v={kwGI`$w^Q4>VUjLTx!h z9DMLSRZkI{I7GqgL8f$K+IlQeBY};P$LRNq&>0#UZ+zjb+d#qvwPYmhi*I}bJw2WsP~1I7#<3lEQ4v5NP~M`Hd4C-1LA{H{xlK~o!3Ul#kccPnYAd|O(A8`^Q4 z!{${v@6|F|CwEX-iM;SdcZ+%>t5_`^qwTvJ-DOoAzn!P1Qnp*)IW37p`tzfSi#Th$ zb{9|b-{SK_afe%kgWjolA)&Mo1&*>~bL~1Mu z?mLCg2r%qMi50H{{tR;fx!C3ckE6;SNxGM*gvk*BX{C$EoXBqS`9i!fPKgRlG@ptZ zXMmR#pT^euUk#n_q#p|z%+YcmGTl8El`sQyz83&2T=%aB-%Kwb&mrK_N&NK88zk;@ zjw_VVp-u3T=W|u6!id2_!9FSvT0gaUS6_zjR88NR>dBgypc($;i%Z*dZyy1wrUyNCB3(vS>`Zs^$7zwDmdQqX$Y+vDf0<{^GXt5fw zCfni`{+=`d6@iAy&YQmFGAX76^l6SMSnIq$Pd&H3u4|xs-8={s%prPw zlNIaO{m~R%YhbXT#!sYr`VCUe9|ZMaNZtPg@_w*M59}F;x%d_^M#{>de^ua6`?{Qa z5_GrxHnCRwc<99DZjC5ekjH(%C;qgZ$G<^ir((qOa31uClj-&fhJc<|#c%urciK$e z(<8s#2gCTE_hMDXZg2Q>`L?I!Ibr? z%TJ607Y||A_au7?;`Z^=C5Ly={WeyWk-5TAY>P1z%&jMsrZV(849ng5<8|bzW1G<- zox$SVeLorxzB;a@SOY!fvWWSf{1)VfFHnQcZFat|>lCTMM<$q(w41+*8~vahAoiqL zZV=HiC2TCjLC1@v1jerN(#qOFJk2)?7^IXYvcU7r*Fn|Ej+C@ni?EdK$cxPvq#tgI zYaRfBdJ8Oac!tDWGN zKG({I`&oza=AXTlbPahH)2%oTXb}3Mp(M`hVgraj2y0+_v+Kq}!r+Fjp%kGfG1pJ2 zCXDy;IbaOf>NZ(CcES+TPvo6{zI=5}deM1H;+(4$@1XnbhBx`3Nqhe5LH)`kZmDwb+6|0?=`?)@ASa*7NyM;iozJ8itSta{R_-l%l4^Ja+OtGhmg36eeaW)2%#*jWFs z??!Fyg(dAEj^>?IetwbWIPXe+6=3)E##;7T$$?v&dqiB<>(~&Fy@&&^vSaMV6Rr+z zur_7;eZ|X#|DI0#+2-q{egk8^SWD#j$npJpY<`FH6>mCp*SXvC#zY*uyn3bO+Zs3Y z>aq!Iy~%XqSl4?h8G1kGE*qEpSTLKk&;sW48{8g!&T?c}`*u3NNN8+@`~l$akjuv> z4tnO(P$1oSMW8P>=)N6!O4lsfAytKpzlstmzTU_#&xE)J4l3(#v;md11FApYwB@)7 zU?6M;zNJe=h6HuL+@!Au_7}4JxB3)r2fbi}lpUlyghIZ+!&~({-K4qSqP_Ulrit%) zCtKKLMPl?h6sG-1Q#$l9dh>bOL|jczry*!=P4(^a-w9=>UoU>;j*)0QbWL@Vyku98 zq`dQVlGKJZ(?m}vcfztmC2!?z7B)w(CA{G-r8`ANqM|lJ_KZAyDt2NH8njp}q{d|M z4dFezFUULhbWTWl=t`Xls%3Ga)5|S?dXvB1v4Z0!Cjm8hOlIjL9vFdE_ns<@v-*$IDtXQd`((Y=RUkD@XvwAL1{y<* z2m0J;$}$NBE9ZQ|L(-yN^XWSc7Xq91x#An zJ0t?|sKAO(&0XD0FIin3L50oMtI{`IBU%iZqc-l{!QzW6kaORtEaY^srzS%xW@_5F zNy9PB!p_{EyH+Rb6Hb(8FE={xtjQ?Pq4y{7RMl(QxF6xM%#( z$pVm@h`+elX>i-jSRwkrF17ym?J7f*fds&1CBk|1_gq0z(o=e^P`6)DW0Bu_ihMQt z!Mw8VD#$K7QpC#G;CEh{hDd>^wMKcbuK9~%RSNrCk9OkoYW0cnxxr&NBilw91ce58Zda94)bcN`oM9ou zmf(b8b6I=&Rgb}1_y9-Oj!gVg!_f#~46QG#7Vo^+qw}V%5vQ=>SD|(Bt(%t$l4Bd= z&N5#^1gV?r4&b89(0AU-xUP=c+OEoS&si;B58G)0yX_(9-ihagGDW^OXIdHYCTGyZ zC~SXM%G_LZJ>BiC7Oo~~Qiisw7nP|O>5UOA5b<&?*fxCHD9>A8oo)W#dKoXU0D_ab z)7WjZgot-u|D9c=eNCCrZU5C?2lO#Le9VJ5u@I7KR8e7wo@4z zr;!oeqQGnK9NW|yYUt|)+P(md6?$ir!X3Vn`+1u<`?W9?cagF(HL=@9&o9}Ngf3Ad z)D1KfE@t!UyFW|_~8`32;~m%-@4qkn>H)yM#+FiWBVXm^? zXD33Qi`QzA%mS%BDZ_vj5d|9_?G6-I@iIm~=GnPTpcL@SON+wOu5LI{;Fq5Kc8iqe zW5giVB<(CFtAB4zF+=K&w#1tiT{@{jylL#Z4PTJguPpA|8w#+W41U_J$NrNeg_G<4 zC^M$VsgyK?jN(10K==jFqq$w(-Cpo;x;?;G7tS$vT?535P%&tqo{A%D? zS4(Z%!D4Q$qZ}3^Z$0BZ+3TBV`MG+;#N5iQtkitZz#U=az_@>(+Sx^p@fp|@4A_#Um!~M3Rb3z-agfO=87Ny zxYOC%@0`Ww+Fd5A_M(Z=X|Z7)2)GKu&1iv~+2|8a+8K2Fh}&$k!jw7z`PtvhaoELI z0^9ym(c~)8z^nV(+E<{QK5yA?%a3w_e7qse$YV(7qwI$U6Fg=#e&y`fX~H+LT&~}@ zwVRFxZNJ-`p35N-tW1zySdEWwmxNiy+8tr($|n zM_~UMmu#ISa9chyO7OlrtOX4QPGd@kZ|JZHR~$e^!MOUz{TZ!}j$*yQ^bQv(9h-CqED- zf2f)Se7~nU)#13pt{$6a47zXH6l;63gB)+eFc$AU*o3%Fu?ZW0VXCvLDroN?o(-8j(8`0H5ug+Azt)93+` z-9ouh_waa*kpEJ9vB<+KRx;x5c5|8<&Ein8)735_et8t1rlXU)?tKXBvB2s=C}8y~ zd-s`QeooNSbwGCWSudH2GVUjhpvQrM)5=!zx&u4OG&mzlG(sCK0Pq4oZ4r#iPj4saqEXr zn~L2->R8tD7Xs7At5H?zJP-piW*&DiL+!_(;NO&0tL9ks0RoSU!Up+%!~kpdj-O^r zgqO~~+fOygrM%uZa0u?m5omzA$@7-Hz>)Q(_1E3#tMd&B0Uk3M7J7h%RYc^Mf55V# z6Yyn(XO=WNK-6Z{8`Mk;C^6jSwqoq6zLVf+FU-; zL%57&2>@^wx%Y5`6|Vw5U$oulL%{rRC+H?(t)9YEy*}z@2;(FxD&(*S1P&17|JVXk z4HdRgUOYjc@ByryZcUN<=!nL?kKXbAJ1@1+H@k^9gkae8I|$!t?oX+2MORC5l4S+X zhyZ*}{jj8k{Qv-q&Y-#GSk+Ddph3rY-15Pv%lYkJ+xwaGi|+sWYs51(fEE@CJNv`+ zXhPrSbaiS8w%h*IdDhiX{3<>`e>8braSpl*0zIrc=X0I4!GvA-ThRg<*|Fz8uC8<) zF%>e37px{*O>Yu%L&<;sZ5#;EeGgEe-9yd~Sz#eS=)r|P@0@d=0fIkmJRSdN$v43Q zSjWT?j~`$8Zu)o_`3e*ldmCuf%S0Gh44&LL1wPYH6e0zSIs+G8%jX2Tes3s>8eg2m zi>0fS@VuVS9e7pS7|ao(c0SH+zHOgu8bGs4|EnmwcUtYe6Z(#Vm2=QE+I)V8njj8wS zj-=+6T}O;F5Ih6Fc0yn&llD$;G0@PYevF>RVc%Ss!b{LdsPwXGnG8?L z)I+|%y&jp4s^`f6R@&j9@%e|$u8q|Cp6_>GPuQd1_al@W1q(sqcU_#USknczT|l0g z4-ue(xL>9S}HBPtt$;R$H6gU)~wb)L0Kg-|DnR7 z=FE~8PT;2-=uJGw>lCeZiK9?}?OIKd@B`O?-((I#u!~+KOIjm^uAWY)NZwnwZIE-y zx*e?2_9H-xckz-~IMx$S&sT8f9G{nWc!!vR$h&2Ym?8iBVilFG_3TloK562RKfqU|1wo=L<~CF)Snpx9UB7zC zF3upilKaB0tA+qhZEz+~FpR7s2xE<*9}6o5;PEvumg8Dm!964My;=s( zgjrhh9VpQMCHiD7KDYh^*Q1!YR$eHThO*&^72qQ>NlEFA^xQ@qH!^?88To4ge1dg} zr=*1O1En|vo(Zylb;eQcEbdjoxerH`s|1&khdXRt57@dQ&{MELFj(y3asAtf6?ooj z#cw$0`fB;G;(j)yLI!SP6g7k;c{%ZE`ooF41c+r%Spyt)WgWX*XLoDK4OuV|?>-y6BS(6$M52rmCqk?V>6tb)PBfnV z9rkJQ*z6D+%N-PUFP@B>slpjWN=K>LFCSYH<5aIwKba`6p9P0t`Cg2;(XBc*>lh+q zb;6+U^c$53z=<5@FH_qAr5yQ5g~!YW2dGu0QWdWM@$MNNRYFNgs6>_!t{-{D|!02f9vVX{GUI2wpF)IHSMG>eUNlGZ?87faPOys z`0gt)H@$hsgRTyfe-%#B&wY07SWj|TGW3L!XT@rNxkQ3bK4`&DXZUEV5jOo_1LW$% zLK)<+{Jto>c4AUEhcNZGKoxIe@sg421fyZ&haI~_?P)?(rOYWA4pc$B*53pC2t*n6 zq2xHv8frhu-6oCSW0PV_UUOLs>XZm@U*HiYq|Zl}bI|f@+YveG&bP^WjY{v`q6<`V zbqoeaeb$qBZET`8oIWDo$@L8>B>05eN=`%9<=>|qDPw%IP3CsDM|*`QU0M)c3UlSF zr#0#!D~Dr71mDSplfLX?Z<{Hu$cR|{vE>8?;WZ`U9(aAh#~obJZsNYG%~MrS!?#?6 zH>61enNuZ?0)oZqT=?SoI&ZEWVBwGIih^!eH%0Kk)f@pE%pZL?emOrE`u5zD<}~XV zh8<1KM~@phxlh?rpGRSObE=hCBv_gU^_A=P?Wl*poAy zFTV|Fw3S`LqIfir#f-+>DdE|?%>3W=ftL*k&Q7W%`37@hW$4!-oL?*FKJf~SD28*8 z5iPA=hfD?X@vYVq31XqFaO`*YYl5R|%v#426Iik%*R3uz6m#lJT&-+brja$gd8!^v0eQjY>@; zN#4MOf1wc2kQrnB9YJ@LMHgrCFE<%%HPUGKJEK-PO9k)VEM@CfW%k=omsxdTPva(?f`Exc@lj;K}*{H`w1DF;&(O1_zizChs z&r&o|Y;0gzUGX#>Yv!l)d;Xyc25pBfO&Pb1^VnO7nDsh9%s2^9g0J;IyHt!A^W|P4 zz4j*k`NoR~55qfmN|i?ru5C7i3+X32eLetA0|Rbq?nrOlJ^nymfHZ6ua(d6Zw&x8D;oDvyD^u6GWIfmeOBvf z*ZqcaxDtFuo8t#S=gX?~{#X6XT*MxkAbsK(GW}Zg^z@k{x3t8&_WBwE0J6F3J4#|8 znWLVVkhKWV=Ct($>)mjeb7Zz7r~LO#T&d@u*5y|={de$ThLH|q)`Z3wTU+C)>)aSr znZl=$iUmE6rUPxqScSL{RJ2)bzDg$rG8VOKL{bnEi~LEUyyc{hdea{1OvY5O!Q}#rNWI;=gP_M3lzE&M6&L|$2#7*@VOeV>2ohRa z-Z;1bkMTH)Cf`;7tIKff2=M3w$~X*(h120ke&^os<6aNZ#Pl~1oOE5^R+%V8V)OsDDQ_Ye=)$IGc`>t^1oo2Hru0Q_oEcaG8PS>h$!kh!AhT8hmUN&KJG9gk& zM4#-j`r1A%) z3dITfk`+e@NS^64Ex&Dz`TRZ+)Qxpe;=Ft$+)=kQVP&Q>sdWT7LU^=Bu*S2keBn4@UUnT*Cr)~ zq>`m?Dt3vD7oeomx%Szi%lwEG@aLx64{16@!vK@S=TNZpVbwhPbAJT6+r1r`wTDv$FhO$V4?&w9*AWa#*U8RWy7oLIphlNS+RV&_$em% zKn+;78Wn?}3~cTN1&nOMnL>BsHSQ{Yb=>Mf-9}!-p>6#e-f6CHGL8**pG))K18TeE zb{&puYEHGnjP4oZGRGp4H7X8UBQ-bXf_l=5bHW>m_xm4SF#vII!-8w7<6TeW-q}8V zLt>}^tPR(A>X+3UMSy8KO?O07oVXYTd zpA8PG)|fOblFDLo^-x48t^N1Y5G)hi%c<-iomYQrc-4?CT^&28Had#LDoe%t3L3_R zkXRlt{Qz_#lA&QwsY4{!H0qqkhk{zeAq7`VIfbQ^y39|z&Ldga*WXZ@xsZ~%R#`aAGGc|)~f5}Zf&-r z1C|K)%Kq07kh;}x0-_N%cz62sS$jrd$q*WRhYw)FTgdmm$(7B8Zg9Un<;Qg#ip(kS zzikoHmuLVkpA~CGI$W+EMZHB|5o|VYi%bN6r+{>PE+}hBTTTX~CdC4d<%hBnSk9mO z^Up#5_D>&VK~JfPYrC4(`+P7PbrmIUxMx;l(s93^|91Ra)zD|)WlC(fYVK>T?o5aC zCaYYV{mQjoQ1?tNE{wmm?J8}D{dHO}J?MT{HL$U=0Ubb*&wa6a@j6Up8327&D+p2J~%o{3i;Qu+nlG{_JS-awUlFSb9IR;tqS9*AK~?A&=gm zXBdB_Lb;Roh8=9+onM|VRJ(2^Yf!AAPy6nSXa3WAj4FaxW%q@t=WYAXD8Q^l`f~7f z@@7mfCvZG&E$BMJ#H7P5Rimq!OavQ{mj}HJZQ1Nk#0Xw|Ud%TM=;en7T;D=kzAdS6 zh`xD1dqe*!Z#->4yN)hzR9Ze!=JI;4+6_7J0@qaiH!EhEEu0}M7pgC};c6VE&6Sm8 zuH@urj!aIFC6GZMoA?vh>w*Gw_ejqEbQM%%)K=jPeOt-IzX5jN5PJ;kGmE&)#aOTl z98?8C9?_sFYYB`LK8NiW#(QIUl^$*Uaz$=?k$7pZDOMQq>n}YarQ{tjiz)WhUn?f) zU7%sV=6%8AwpQ2jdh1;pv|scg#HaOW2=sIq=4#=!{+7f7GIIcH-VjdMGy=E&6h!3u zy#uTV?T{Nv*E3_1@zD)+{`2ao<=fK(FmpxD2p%GRJitQgJSm%w&+&C_uDR0+ZH_PS zj;28tkeak0A?J@$Z2o=Dyj^#aL8U%DN|HZB2RBt$nQrMkbuY1?MNBXu9oTf{RG5pK zgt5{7=N-!*H^6)3y$-)k-h}y|&TU=dZm;io-#2>!F$6ud z*8aSnrFl+)x~yjmx|JgJfBW8L`R$w;<>tPSxi9w=NPT59cpC;kZ2C=j8W|Y{+IH#G zq5xeuDZBk9VO(lUdmn*EOR}JdPo~3La8k%?-p#fS+}_W(7Y9v^B`A>^S}Gekq`-^Q z)Afti{s?DLA>rvLkq+1Xc29oj=~4vfqH19*ZR)i@e|hk0t+6|>6=8||M!U;*qU|cK zX0j$APLyY;ld=DlhRKH4loIYe5gD-f&GW}i4yiNjPnRDu>QkSw$Rsc~4FaFnqTdb_ zF9eShc*i!|U$RcfJ>B<$%+J4X`ag+diM}+>tU258jlSr23AzkpJ0k={H}knOzDzpp zvrM%eE$Za^nLQsd#^!Pc9+oAZk@9uFZ7Zsd8*!dYE!7&eMO8fp1hthn6uFP04aE=% zGgQu`g(9z7Y`(Vcm4dnsgWfj%;)E>k>RZmc_uG@c%#@O!oq?WaTS{_Vc7Z6W6YwFm zA~$`Z-s=rp_Z<@(JOGd878B2>CCnhGU5C=QsTABe!w$Cv_h^cjv6dhqpIw*uB5;N3 zgn`eU4#<5glQC`sm<=a|l3uOV6IJYN{B48~Q|M&C`>bJTE3u!iv+KNgC_nIUas~Y& z2fVOihu1VO5yWt>htN|w)%AEY6>#?xE2j!tmH%NEy|P8N^+pA?uOdcJ(fZ-UvKOwbE% z1Vb3?TF9ZMNk-s4T89eQX87>K8R;7IZNA|KnD;c?g{Ac?O}-|2s~@toxv{d+ws{p1 zkGh(mWI@-jh5+#OmL$eGH=66mBL~lHyv+qcjuQ`ZKOF@>kh#nzI&A9SofZx*1->xq zQ8HB;T%#tF^GPeJhjzkFCgQD+Hz@f5vy(69pDcI(U^v$rTtCiXZG1W@5VrC3^s;U! zV|)8mAT{~2ZG-%t_;oxq9vSq$3I&t&IfU#cQT8Gm{cAM-P1p#N$G)6k0wx)<^u*{E zPay+*_Me$+_n1;WE+TT&wXwZOqnI_! z{T`J22Np4kLEeKirLMC2K4pMu=QXyL=jr=4w-)a%w>@-nXQx{Q`s&zjpZ;3FmV=EU z(VId=@9Qx!VWYDnA#=hjt+Si|af5Tgi{Z>2wuv1F!KfZOH3y6q8SY6~k$QH6N-Ek6tZcXh_Eg(Md*v zRk#`~@tly{SAK^&bBn=d{3CQy$m}(*peooP@E+xY3UrAW+PnHL#Y^+il5yXTScycy zV^~agjnkmz zp{k3H6=;$%Ep=>tLetT}DP$X$f44lzZ`vRw*wo&r{&8Sm<3?d`LX$~%)Q`2`X|=;d zyy=&K1X>S}eO(ld+Y>w0|FBw{6Z85XWUD6FPa=KTTFL&OROL4y$Zu2tVy0lSzF zwu45_z7*Bi_Vzs`R$79YQ}IHjV}F?x90!Suk3o74q7K91d;2UkpE65TIeZ=o(}T_$ zrwkj<*l{P9t@^e#r)p`nP9((Y#G6cKv|)|6utqRDZu1(f@kMN2qnERBQgeXB*hU0c zLcxY6{TP7+%(0OCpdy_JGgPDkuxJ6yvQZu7yf4+z@tGfkq{6t>#@_tMT{n&Zms`0F zz~`A-1X&N|^`KhXNnzTd&TE~0+6}n@UEH6mKieaZ%MRDfvzX&6wNpwdgdV)q5i{Mb z%1}-%Wd(*XRBxnh7hQG3Z@NXELYRJf89uhtckQMl+dd(F^rHAsBsh~~9s7Re`4Qe* z!|{`}x971=;C-+C&(h~gKIjVTGmA9g#`$ft9?7b#h?C@a=8Kkyz2uoBTBK}8 z?9F{~ZjVP}Fe?)p4RvZc(!3XNwEtoF_a1Tkj&orKaCxmc^|qC)qaJR)q!> zd(X`j%7l!vludqjnDlg5oCKYnxAAX2MZHuz4=CDXV6BVvL#tvM4jg19z@;A&5a-r` z=Bn=%?TQmj49EK{PnYPou$ERC>Zv3?!Xa$y8)RRQw2r#+{(Wd8P?}w+FLzz>Um;)~ zmI{yKRL-x*GK`=VG(j5{Fu=;7Kv3@!T;ba`w9=VSZq(&6;H<_N;m`YS=kUT;&j%1ql|t}PELkE$t1~F?F^6^Cxk%%isVO5Z!1U!|zzxAB z|5T?5#*-6z)FRbNUPFx`7U2x`ad=@%f%%)*#Uhiw;tB$0S;Jp1bPw zZpab)wM@+S(@f-QREKetpzEtWvwFV2BBs>}E0O0csZqT&A2~G+Ru7%eSuQxX@!N?5 zv_UJ1f&-~Bc{?X?Yi9jtGOef!{hEj{;|!jzgX z53l478;Sq=USW2w(tNfn{bqv?G6^GUT2!OrcfnDaXKIbraOPca|br`HyCUl11I`m&($)Yumh(^bTF zvdJMlqBIf+3`uLy)gO9Rd*k=?ebd+DHmVuis>SweZlqWSM>vHTq<+O%11d&u#!!(Y zIwkg#{}gXVEzHfQFn%CgIG?TQ`3~cD{;fvmG+|9<-)D8@DrYVIK0Z2~xFeWyX5x6B z$0+Z*{6je!A;C8v)|%5;4dGLLX&P^j^lvTlFGZ*B&~doAAA?xlqBK;)k-gyz$=3}C z8=+O-AZ`4v!?Kbtahhuo%6nTf4emA6cN1vIxG5-VBQ~*mkN))4NEA+|pM1}?xkSEk zyXx&YD9|DpcTW2$;8WXgB;*%lZoa3rf-JG@M?|^!t1wYAGNfz|R-of8*sigJU|NS= z|7vY8p4%^%0&k%YuLg}F#}Tk+6j`Z1jisxGvh!u12_!Qt#c?=r{X{iM0(lO$BM7lYdug8j?u_e5o#(feEdD)%W z`HvWkJ7Ttyh*-ewo$Li(a4NTg6e%Jp1PXztSu0&B=`QD^zK+2#sel59axgXm744@Rii@a^ydHY2lXBiqNQ>-t8lu!Z%adpqh5;u7a#d*B_?I(6o|>c9 z>Dm}x#PXRn82~#Zg=P4ki+_S<&&8j_q>$%*2jgEfz(k_$CW$5b8-P)quuMV?5Vp+a zC4=4wGN7d|sZRSB&x>0+IW9W_sKVt&G9Pnsa>9kL`LY51)EifesfsfbmvT{FiVw78 zY$>Bng;$Pr7-=SY?qq&rk=*&VzD*UuX}oqF#W)mefL7k;a<8y#|NXLWFMHsVHX!0aMsbX4Uu6Z zDgfU_R=A0k$TPl=q!L&q8$9<84jW%3ix5o4A8|@H0 zU)|SR`InZHII9De>Ctag%;A-4<+w18GErO8V^u};^2rhpdq4epIOHcdGUdw(jo~gj z;o29{w#;vNNUOj_i*%CScRP$44u!?1rf97OF|Rp`%GlK=_6WaX+GneZa@eP&83*g}w_ zbPzfRr%d%xS6|2t?6PcK>o~^!j)rk#;Bhf|{Hi^*%LKxMV{k6nF~k^j3ne-Z!Y^{@Z;7tym5G4q50!wy_Bqw9^gqUkejOj7;^ zv*e}eh?Iw;s0_rcwbbi8uXy5eLZtOuY~#=b>>L@zK4Kt!K~}_o4qxu~bE5YbBXrz7 za5$$+zTX^=1fL5~jnzBSZc}!1r_zFzJ~utVcxfW^^SagFD8EyvQfYkj1#x(BuS$(3 zaU)3TzcgY<7cI9QF=jKf@UXxaomFT#xBFZH6$lRTa$hRn)ushTT`)Qk`+izlwq{%U zF_1+2x0ST#o*lO;d()dlc~E7#m%?UCmrtD@|FHR&(ie|9@6B%77IFvLJ8->t-@N+g zs!)y!eO~)&Y%J{#xtJW9#0qJ%Wcz4OA=A&%82rj8{84=7UKd|N$eUY|FiT=3Ps4+t zW(jfZ{@9hZ+C5$`dCuQY=k;N#!ex zEErp;-~Bo%Bk$wWElEoXNk|Do9JEg!m`Sr`Wop5X-A?2(T`1%FnSJeA{5N=m+6%cp zr3mcQ%cF_Q81d`+MqiS8RYaF`Yvij?oGn6@X7~D)roIExyK&|@bonHY-I6c3InuuZ zY9>$j*JVs-Oa*;qXXG5I0)*5yUem^mRgUo-ek6Mb{xL~PpHfsD!&kDOvv6<5+Hkam z;MZuft`J?nad#-MbGrtx>^(6pN_kVc%<)TPJK`X5$6J?ih(p#NINk{3%APJ7ljB8? zb_hFf2j;{(Z@Kit;4uZBT9d`z64Ud1o+I+xS>Gme*WUgr_%2L)ICn6SmyZFm@J*-` z_&S|c+_uN-GrielM~}gMcz%)B|8kY-@F4-J&HmqH+;^honLfJ_QeihLU*%^u0m>6s zuVS#n`~D!$7rg(C4GeNfJ5kTVspbCyikh}_x1ZOyP?Y?q21HUFQQO%e$!qvtuwNnF z!SGvOb+r!n+YfbZHQdZ1<3hpZtr=0+fAg2_uTJ5>cga)bf~ zh#t_bE?N$hpsHcuIt%ksONjY%3X}G7s6Hjbz1k=2+VE%LZ1|MGrAJt7I+qiyDvo}o zLwZ_dj+HVch_S_O35ciEPB7J!y4G6mL{x56+BI>pGov796tcK>jBCF?O_UdhOv5OA!qf6}1?_+x6 z8APTNV0;Ce@G|Guwj3&to>i6;$R7^Ir(xkVsEk7iP?Wfrw}09!0F~JnJXUkHK*cGJ z(*^hLeQXmkkwES`QPznrZEP1W2gy-V{Rtl4tia=h>J7}MtOU{*>jL1S{+9%N*)TwY zsO6(?kcBxi2SVqU+g#t_tU1XCjd7PBeAa^)_dnurm@On@LM&=Mlh}UejaM7;kw;F}RU9 zNUPe!r?IxMf&_qJjPT==WVpQL4Yc_0@VccwpI5isi<$+mp2a=jy*D*dDVF&vEK@8m z&AepDW-xi|U&It5mTZGIU52p4v(+7YpAxwQ!$^(Z`z=37)~*mN8=fY8YzE`@Yz|jV z4>%I?gDk=XaOPV26RKkdnq8-G4L&9hucnQ7H5NI3Y4pnrA2EC*LCMgtU|dq^ea-$e zYk67W*9cdnK-gSipM(9;L|yHPYw&6sCmeNsH#`!rE_ZbvSaKDuUI}Lk&T0bu0Zx#d zP_vCc^EyOBqZa1|lC6Kl&)NRtt%+qS$~2mG0MR9QR7Y%%2d;?!S~JrOP~D}R_EkH_ zYGa|Le7LTU5#@mA9&}c>u1@fwjwi4DIaw?4h?^0qt3hGBjQke_h@>6mQTMi2fxURm zyo4AfEAWdNw@o*)?v@U7Yq7;ZE`~_Tgbefa-!yD$%+_xyvHf`;97Z2yb8#{z_3$@V zP#L@&f*gzSDzwU`lcWfpnImL&{ zYliD8Z0po#_0o^1DMln|mOz91WuY~E{Di6OxE`Pi{A$zfcRwvvB=5{DB93a7C}eqSQ?Hc@mJL4I=nb!Bh+S%oWQEn((Hr=KKkOCy5)tDs=<2qon7 zXU^V#fbCQA6w>E0)`0VHj+|>T+B67iz!WPS^EixmQ~#HLvUynaLoDCkYbodQT@2o!Ama&n2Pwnq1;POqHEUnB9)>2#WoyhyX1De7bJ z5T;pt_*KXkFmpYd^x&hG_}BGCOfT-GWSW7|3UgO8a@%rnOCOKz%UK=jAGZPDxf@pq z<85=H#4my2@51xUN-~)&^Q(k|%#XW1VC^eT|K#($<Utt-{OA$4GCw^7|-z<K{>)JiNyk>S~4uQWD_Do-?H z#DEiCE6weX;v*v!yd7oGu;>8MCu9Xg?`{4jZbAEedJepRvC3&06WT1@+ufa%EZRbt z1U_IRQ)0L|1=4sgZXNfz4~_to_XbIxcS&H;Ajrh}s^cTBOqKTc@Ex;i1p1%ze0a8+ z=U8_AN5BR|5szd*tj%IG#q6`&O-SA^PxfV;yQ=&B*EZ|w=5>dGeNx=SUB%y{`M!PT zIOXSXf@>0nY;k(F?(po}tj1P7jKk+(OyAx8i6LVtF(7tdP^0Fmw` zSs~g1$3ACt?qT(@$XgX$99%Eekv_oZ(WB)IrXq?eW(|IrAVEc!o*T&_ ziag%eR4^-(JFf8G(l1SuL^^9YsXRsdl-XvHUj1CDc8nyEXZjoceAI~_3m1`1PjFO8 zl^c&6Z`NACUVfX=pjpV0ZY{V)?iRvu%E#2g_m0~CGyhRegNus%@wK4Bx8(17grNE4 z|DOwxR60h`)V4T1Dx?%L=@*wB(XS~@G;qzB3mN06*1K+{R~J~~icvRX4eQixqb@YG zrx#|GXi~vcB=DOMj8q91m@W|&8GC6~)^uf!&-xYjPjIkgYtXaa0LU{*Skih?>(sWu zNbc<+nARC4R{GHeH#@Y?`LIE2Ey zEaeS{pRFWkL&!b;9{~P90l%a!4cvxlL&Tx7EwX%_#;qA<1Q6827G!?s!N+b>eJt)f zRI|-OI{b8#*4_)~QC%U@jn-Gfb85MDQ5>3V@L&Y=l#4$)<@lok;1{3&>XY*yN~2kc zV=c<>P_X^lO)U#RS_d*RCwG4Jx=ZF@+LNaI+II|Wl6slsHjudp^?9`d!j#kEWsL{_ z!$8T9>W~GV+7GxztJ&G|i0LxhG6Ht2)4pUVkkab#^FTsmcu^;OC5Zo$LLpxfo5Qh8 z%jnXi4<5MMAaDk4ccZ#fgCmab<@Zo$TWHvD&^}Y7)=aGdo!9 zki~ZumG|G06k3BZfEC6-xP-S~6xXjP%?Jh0kCAx1jz;-N%)B20cBe@B1U%)j?)g() z;3^GVudE3o=AM@`N*M(1R6wEHmHMguL7*(Is&wxheKNXH+@;^%z*3dvG(u3;b3p3j zfc7u_wnzzlCdPfZsnu;D`;T^YGSlEt`hmoTdn;5*rjQc=Zlyz`TLAzJ9zJ~JwqpU{ z{+n)XiTlI3gTaZXuDd~n8HMV=&E7t70TCfPm9kougB^>co`;7L9dV+miL!4AN5qeR z1fRA5Oaw^Ve7lQ#s~~A3RYI-8PIS0Pg%~03ofH<@yOXA4eh|&M@3^`|{v2h^`4zHd z@u{_LK-yyPWEY`0Yndu%Nu8?fg`*Jl4#Lp@F9a5#6S|4NeL%Wj{J7Bm2W@;mv`#)o z!d&J#M*)VS7;PEraXg7=Xf7lmdhE*VW~piyEe#wUE~weJiod?cS#}gF19B^=z=~$R zaimZ)=xPf?LNG@@!n@9Wa^vLtajY0&L(S&k_%?Q>3v1Hc=?9I2V{3~D{DeJs1Az7o z8y4I?Q$(e4$2Zn7A{zP92~R45h+Jxo0=_~a3|K!>)?v~d?nF>QwwCkjv>#gpdHB*< zv2sMPrJ&7*x-M;SEY3VSpg_bHQTwx~yHl5IpP@&!JvWlJ=7b}a`0uKc*cKS^R27 zL@Kqd1*4#;qjnRS;@@Zb9XWz?yU-$i= zJiG9bBta2R=9A*}`2n@tiU{J#mIlS-KcfR=u7jn7t;Ib0}3(v96R`;*>Hl;&Al7=Z*F zRVYZcP-zsF<%xc|mm6UzzKloAT5n2g))oU>S@-}|kk z^AAIZm!e5WHezA2tZ;uX3)4qzeLZQchrLTQQ1Ocw+KeoucTxKIdDYy?^2>)+LzUEW zpBw)we-3ubI9EcxMEox&6|IGG{z%v{GKdLOgqE_XtT1?Aoh<4V0>_-n>t*#)ws34P zK19e^lSB}N^h+OGfa~sf#~_SD1?{4lkqtv!D+Towc1lufcsH6Dm=diWm%y}*C|#8?Vlwj}Pc=zVUA<;kO5m+uC_+N8eHRYeV)XnW`oiMJFF)pV zgu~X1Jpv@%stzABX6Wcq&p-0mtIxm4l4@!Ks}w3v1J~2$qAlDS))9@Fq$KIVe*eT4 zzP7wcsw0HL)ek$(E_YqtWN~Uh_eYo{fVPZDU? zt+gtP&*@C9TA0p6D?7~Izft@!dvFa8Udt}Tl?UYzi)cqv~q z5ggU%z9X$j!U!a00o2%|<_nTjP(X+jp0cv_EClxwuuO0hV~BKTjGEGA3V7)#%Yfk3 zj)A@V+yJ+zxIc?+H%fCXd_IB<|~vB-j@m zBGtZz)!g<=!_X6SjDv6^C%f-~B`--|inyuF{r^#jy)cs)3f)A|q#Qgg{}3_Fz95y% z)6KCd=j&vjvZueb+Y;%pGtcsAdD3s{i(+1gfQ)yeESGMGdd7IA82{#>(#j9N<=Q-$ zyo?^~3B2>6K`R(G7|nhqt1`4ShqXaysU)l^COYG=&OKa)7DoyS$bJmIz{g}D(EFi9js*2pHkE~)wS%l((;{e?aD6efNs#!JqsA@Stm(bhrvAuaaX4c(M@?zWKgccrYF) zyQMVLnlibf#@?{Boi0Yh5EskG0?N-W_~lF~GbekGz8R3@ZE0I*=S~>Xr(y_bZZf6X zK;+u;bHBE}_F14N%UqNZY|1HyiR)Wa(7Kk?&L8htiZQD%N@5N`cL1)H5^S?Hvp=hh zq9n}q%ENa>vM#m3j)_5&3b}Ow=A1Lc$!&SGWMAMXR>ZjUn_bs161*p^Kg|MxWeNfa z?z^K!AQL^ZjZ2Z|mYNZfgs%WJw3SmCUldJuPBgTc$&iY$T2@l*WhSE77sQ*Yv85(Q z0Yc7b7_|Fa*tj(#(JhL0Y_6cJ|3adtkkAb}cTAFKqX{WizA)k5I;$J<2ZCM>S(k?R z#`=JYmeKQ3n5^V`PI4#;(qEz{L^Ed&DEFR);+3GUwOxN?Nl@U&i^@21qE%Y8)(D^M z(OlN4A88OqVZF(UiRz)V_Y34YYkcXe@YK&jtlAKqAeD*0nLifv zrE_Zimv};LU6E#SS6-eYDUk~^-*mA>Vnk8N6c{v=AN=Cige*iW>;;B5rTa^N;wyNw z+Y+4|r$E-In%ePbMie=YV-$PF+J=%%RF2Ywe?a#`D;mEQ?@`r>2vm@#a;qd4>>k~B zJz6lXROwSTY)?`=+U|ykY%0a96)$vFT+HQ>(dLs2)2FJ6Iv_sI%n3nRPVGC{`gc>+ zYQ5Q9uKp`i(E{yJ=*Q*_^3R<1Oi1-0RV!nhsbX-FwEA5Dl=8GGX3a{-5_*ud$WcyT zqz3XFGEqJfO#BHW^F%OCqhA*j&W;or@0PRttdKc?e7T53DaZlV(&9=vH585zs@Zss zCg~jAwD=Y-Ssj~T!h&8@oR^Ks1mH=>F^gb+MxQzHnv)02`JBqV$L+F~`l6_>(}#pM zPC#KwQoUh(gSdqeNasb71%mXoOk^&vqb)7YDtxKF;3=XRCQD(}m_+JMe(3lWU$;dm z2X&>eH$sH!&h57rKT<^MHjhf^sSsqB$k%O3pv-rW&L)KNMK>xKz!fpStNH6` z(bfu$MhA|{XUaOCvLz5uTyKR`TO}|7lRA#uxo(0G8wjE+EOAoV99cwP<)_a}I}XJe zLu!#oEeGuy1#=bZd-oXqTT7$II7T`Ci$C$%LQ=nOk@bQ^{rBLVEyo_5D_ z;o254Q(nrFW7V~e?M9bz-XN(g25d_v@M#rQ6DhtRf{siCN12f!=+ssUjg~FjNUm)& zP-qyrDyt$OYm8zi31m1@BPfYMRsx+W2}>wFe{mD03W!)&S=+RvM$FM1?i&l-&H!z! z-7ro!4$aUmq|BXaF!LCFX*LNe^>xhi(PqOWk4{xGxl(+sxL}lk3h_Zs?1s1nvf33B z0`lydA3oB?KvP^`6e&+rik8@YIT8crHQ3*MTMn8LIlg&c^=8y;(PBc zoP4a28$E%mCZDuQ#1cs4t)j}c93fTiRCpCvcqGV}1;hwaXjP<^UAxgi(PACLlnFlN zptQJ&87c9bGU!<$&{n)MwfSbUc0b5XTP)V7?UVk(L}{k}+-v6Z?&{5$RjwI%m7PP` zeJ)0sOGj^Ys?wt^?qq))Xd;qoc%iev+)#~xkd2wgrMQlYZCy0i7q<6PFt4uEjwkB9 z?O>-bDz7=p{>n4jT=bBaaULTG|1U8JH3$jCsI znG)qf2l?^JsT|@SUMo23M|qYlh}tXg)od=C)?3dOLq!8v-ziXl9+?>*(9^@KgfUZR8gHBn8p~MfX;!0AR01^LJK%9vOyO*e; zEAN$O-vDy;%>C>8cphToW2r)99>5O)@x&DK8-qeWe4fNNjir!JKDNi>hia9BY70hJ z&x)NpEfO0(Hj${4N16~0wQwYz*j{MIG1#1$_wQ+^^$f}o7ePi*jo_$0xy12T0GdZG z7eOgnhPm5x@?QbRT7csKsm!vng_e3}d%F5VZaFBsc6R&Vp&RDSXford#qBN9CaVCN zJ}qQ-;AxB#fQpB%hOI4XfwD%n*j1e%yWR0kHc||r0ouqpJ9mqUB|Y+yN%4%cULqWD z(s3t!{39&9z!ylE?6qBwyv zCngfX;piDAf8V zr(^-E{M#;PNdt3h0iabL&yTb(CTVtdVx)zk8(-ePV$9Hvza=x{_tT$P(3HCSzM5r# z92`MEHl^k^6uwe^fmuYCD7c9v^QBw=!W?^Jh-_vL$+V=s7A22S=HLr;581#t?`UC3?)mulXySbGpv0LwDW$@DTzzC@+njC$jzj(R8iBZs(rh_V~t*BC2Kk2r_8MP#c2Brqc zK1-C~k#}`T36vlK0ZT_sx>O-ZDc7zOuU-j=vjNGT04kd&Q9CMU7`?O3G!Q|!!o=qoiqF$` zb6aU$sJK5%D9;g&3Kkvg+-HPqzWZg^vyYkuyxnmb6#*JpKPWQm-x8f{irYXg*PlT|97Q!8Sk%cP97DY|{bhX4A| z$Gw{$`pOl%?Dw7|Is!LT(96a*m*M{d2q0FliF!)K!2l8?pt0T~ata;V%Ek<=`?ynD z$=&(Q#Rar;Ky8`ra~6wqDMdQ{A>!^DsapQ4ccb3&uuQXKF>Hmh&xPfZlNcw@rK!B@ zxSX7DDMhUv^GFa?Kvm((B)5<_%Y|P6goclZr9aoBlc+4+Mo>B^p-3qD{u7Oe{1~oO z5zeaU6|tDwTp_a>Yf9#MBZ<)_oSnel#5J39Z39Phsm@3x;i@npsTB^3c<)+C7j2QkD4Vd zX$Vpvqkl4nQGxgwJsj%LT6cDKLD8yyxW8U>IpjBLJ|`!(6s?#rDp_gP?hg4*vHLV6 zf#Og+CoH^lin;IIf6AXsWKSTG_vpLn(TN zoL+6p?m1*CM8E9YZX$^NN_36&h@gyY?zST~s8}sPl_!4Duxn6VJ0rhESxo{>o?lnzaD1e$AS? zga80wkohK>g>$jS*1Y3S8n)2?|yy1a^{EDu3Tk`A9n5;M}6>|`~LFR z8?U^|COcxAtq(rqr15)N+;7deJ8;mMCm(m=2X4LUcZ+AwIr_uz+i|x^ef#%+eaYYN z{nPaeXU;Nc@BjQi?{?7CIXB&Q-FJVI-N`)KUcGu<@rR!d8b0i*fBTOo=RRogv!_{0 zu3NJ+wv(U1b%p@ebROnf0czUjC@zS56}i#aL*_B|a0LW)mKmsVIY z_Pucky|vBxwO$S=9;oiaxQF6Sen}%v<&hG>lxQ^$Mqt+@%Ul4o*xjHteIhA`jz2CV3;A9DA#I+G|c^i)C6701y4#zyf2pj^!( zDSaqIH6bL?4n}oQ&`WDD|9si1f+4te)hYmZd-WQZzJnGZWB(gBdEzBM_||^M9W`*+ zkY%sD+R@%IZt}!4Kl{n|UUsQRGlQc)bnbq~9P!M;M;@I$XW-BwM}FYF=Uo123(Yqa zx&X2|<940+sULo8zvGV@IBdw9hWkJJ+zs>}u;s_T{nZg;$2{}U!>_;e_puXpeD7tK zPCMmzgYdv#?*M>351roDr?*{jr#*HZGiD*-+Iih)AnC8&8XdMp@PjVbM*OGY$C<*!%)1< zk08b@fR!^1Q0FMI7%2ZgPV8Bj_-@leKhYImijs^R7pe@T28ImTXeOJ>4a{+YX+IL& zTtColt0D+m@tPCpE4fse);VX-u{31|qJRSL)6HnYP~iV?id&K6YA$^!5u1Bmo#Le& zVvNrC!+`6r^86)|4S`SIF7dr~W^k3V;s}v9-qOF4qXByPHxmER3z*{RtIxjh`IFDN z<>$Yq>6f>>l0I@Bf-nG~6d5J78r8NL7U;6s2KVEMFSoi+#^>4lYMxXxux1YGPDv;;iJOcpsJ^C;s zP+MEufCfYQO_x4a!IDXUcq4=P_Rypjw%Vy3ZXpc;WRno;Ry zQ*xSiYxv8?x|qjuzS610UaAQK0ar@i>wsD>q}k+fc^sqU|C*!eu*vD8!x>K0E31N zb(Mvx0g|C(TW+q?h30n1-~ZOP+LlIgTP7Mrl9tT=BO+Dm3V@Mw%UT_h$ko^j~1mB|X7zyhxNuID_ z1VQJ@Pd|_xp+pj|ZnJe;?>rB6^bXr*Qexx{>(|?t9UI#L zpw||?Fs6q5C6BOFgN6^=`-p=_j2&aLV7J1OR&;IvoHO-gz%37*`yf`C=4aI2;4XM&IKidPBKoF09Tr z#3;d{B>~dv&YjSLO=}ng8;}2h?gHfIg^iwIJ1kwXYMR;LEA|dzHz=FqvMTa7#>_zz zk5IvX44EduJ-#qe6IDL%RC}DlrYR4yd!bQzip(6Es7mO**pi~P&FHSxV)8g8W%H~w zr&jLlhRNt-8JRJV@|l}g8}Yjt!;L%KJ$X@(Pr?#UvHm$ z;FNuiK5XXi|J1u*zljIz0|53R32D%X0ofeDJ4dz!Q?(za3ZelJABZ7vz;|b}QCbdf z`HYh21u+pFX({e$Ykdn`M~U%pf=pGIHa3Kc7qf%H2;Psz$T`$Mo)>|{K1ZB>FIzWQ zvGC~){M%!K){61XeuPYizzHuNh-c-{Ozy;0oCBU>Es&n%N+Y<+N`{~vcHGInnc|xR zc4N&GcwCGQcPKfVL~h71?5~NyKZKwJhdxEE+LyiP)N3Cpi?0UG;o@uw5kU#}NRkB% z?Jlw>d-#VhN3(SeHvy(Do!Y=RrMUZKKV!%5cDvL$04E_UhKcS1uzEQ-GcBx@mdPfXBj9EW^^)iJUO@?>MAhlHKVRxM7aYK>sp zvjG;Q`IEGJU`0~Xq4nDq^>=_lWvWf^MjsmMBlqsp2LL+T+f9*Or{&xqyzMTV z7?t*sC#0+5M+CHk4SY;jNV4+GHIyw0+!@YdiD4 zoV6m>1!cveT*V{0|2aivphDdPydp;{f>Li-8rYzc|D(aC*J!9Fz=Q-yE;3^?Yhgh z@1CHwwvYD;RRp7Wbe;PVC|ZS*FT^Vjtvmo!DnnU7mre#6)VS_~cFUa~x1W7>1T_n{ zg$+~*lH_U1BX0?WPDo%%c)d@SC12YOK(TX*?qd(Qf=&Y{>mP%l6gUSpq;qIFsAxs1 zwT@j@C`o#CrQ~x}XsA6?JX$DDXp@&sWYxm}ORP-vf$;?+f_wUJXw9 z)JMNDib<$Tr8w3(>B4-C!}XHyhAfTtQD@gG>|?05MLembGz|f_%S7#b+4zY%+QlkjPmH zI4xm08YBr(?lErD5R=sL@ycG51d-Aij~(zXiNfj7EMyc!}sFWyD+8G6(*{-!;>Hz*u-_7)PRN}z{P zL?FxXv2c`s*B1aydp$QrJ)24J3Iw4)$GM5EzCD8Nji?BW#ORd zC3$|Q%r}GS5vQzqu}C0&GM(20nNP%5+eeb=+|eb=II{TX)K-qyaXP8!+d15J)$g8N z_{d@Bp1IAtcIw-||C@h*<+1zc-FwYn)~;G@3)b1*@srQ|`%&kgJ89Z}(@s5p&5D)J zJoNA%zxll(BS++1m=o_6C}!_o1Hk$UMc5JbURov)CkbbZ=bQ_9J-l~&e9_y7t5Q+CMs;E zI6OV*{6EHfL2gMlGkRts;?H9n&r2Pw6=lCv{$Dqn!gfX#>L+EFrNHVdX4C{?3K1QX z+x&bCyQ^lFmpjEU)|d3?m5YH}vv|b1Q(ns}YEmp-;l%=DYGn=V*-pEN%KGw?QxM-W z5|rJ^A>|Ks2#4-Ja@k@xhoPy>eTOPLuk*sXMniE@l>7@k3MsL^+SN~*PF`QzspHrv z=8BonJw4}vTjLR5`3e%_RLvQolF3r+YSWfPl}`)F7$cPe+A-5UopSyKUA#)D6gz3D zT2i5$U1LwE1r42{8yUY+3yddtc4{ssvh#_P`zOp}UVY{t7eZ$97S z3Acb2HxY!45l2H)eM-2kmW`#1pwk%I6qj3O8!*@VZP43{ zPhug5DLB6Q~`I3da#g`4O`d?=OXTquD77CTJjaaaBs=W;v6dgcSEIfIJF7~A;XyN9mpjiEsxUC zb85*?60{D&JA^v_dW%S&#LY&hq!iI|)xs(iez|$i!=^)d?twpzMbA6KFk!FV0pOt- z_b?tUAw>)!*YZYn0S(cTSJeU8GQfUeQxal25g$|mfC5b|(Xk_?EX-(JDg=%X;0KDe zgXTRlrNRLcZ_B$v$ivw%A&V>YgFqp?gCd5K+k20NRj-);O0{`FuN0{0u|*yk(VU*x zxS>EdVh2HXAD-vZu2=pJHW-~%kmVd1KvGh6~W zpx~GF^NTgYX?<@+*2OW<#IJ&~xw3jKLXox`^+Tu-F`;eGfOaq-PVLB&Ui?mCtC}eOR7XDkqMSl|P|)b}9{& zO~)^+l|R|yzOeZc#+edJ+jc!58WhH{=rv90g0`n1dhH|#lDYB&WFpE2d&b48v!AO- z<@_4YG=Le_Nc(9^&Z(6T*{Hz=)CZ(uSCFR>DL4 z36Gemsa1=pGImw5Y!a6OT+8N~%kaKB>3DPU8_IZ@0D-T_)X)+f*$Qodx-L*|^TP=S zZs~%D7i@6p6mzt)6PrpVgk)$xU*k5WQp*w=&h@Z);7qxzQNhut!PCC7;fZp>4QuTh z9M^wfOhS~V)8+&O2AnqkAxg!)V^<3}Kf`SqlB%;V$Ae4TR%ykGdByzPC znzv&*0I1y@90dSn6d%XMJxpF$$|`0#wGD%&Ixnzx4FzMYRY>B{YYJqOH$vbDk%OTe zmoa-87K;OV$17N|FphUWmM0n#Er!r6$VWQo0vP{`8c#k8#nTDML$^t}Lr*!35E)4E zo+Xrow%Z&5>Z$A0G6E7bC2G-9rxrP99PvNnO*sGjJD8DEzJZ?3JmNcgF02cItdWG~p-P86h5#)|?yOTX+;r?}8>e5yctB;gbpmI9&KSc63; zL-U8W7MsNB10DR^m&0i13INerx3 zhG;GDC&PLzlu%kX@g#BDE|ggi!Jks;g$nhZes>QQS< zt5q?2F;109k%Yi=~?amAeF2g!5|zP;(3b7ZoYz~15!84W{U zDo};A!tjX11xx$mlw@6s;<3V)p^x1=1~zv*b?Kl8nvaf`YHxg~Ab!BEdAp$0ONrq2G@IpfxIR@Gj-JC``%$E+By!F-cQpzOtDKECWVm z(DHia<5EM5qToHH2MKOC?>r66icJ`>y!IS3xR$Y{ZrbzFZRtU=XaQICd~_VCih9bp z$5_u^RGm1A6yl`NdmPS9z-rrFKn2`z-;|j7Emm6Q`!q}o1(s&Q?y1mhy7*6vn!MTd zW}~oa_k%WHz(Iv7TLd+Zs_k}YMk>+LF^_50Io?8)RKmswrFK}l5@;#-i?nJTm9=(q zVY)w6;F$%Xl_ZEY&RL|e%L%$@3r;3=R(%Y8UqsPLv5q9DE09whUQmfSrb%D8;=wg= zbI^vS;;^`zDxTOHpMH}->I+^y@Tj#^Xk2Z36tuuOY4Bqx)!bRTkU#`(O-|nDK9gHT zOUU?ZASO*evhOLhJ?O^6s6Y!zGyc+ERmH)r%0%m8p+fC7oBNbu9+5iFc_j~PKy<>h zohw&SO4G*_$|a1*l?R-hww05tzIt?$g|&0L6vSsHrft!+ogk&8FY9L$hVIg;PaRreC|$Fd#V%>=H{&e)tHX+>4%-kbuTFhYr=}I00r)e6D1ec z=)?_Uc0;Ce{_-n!s(NU-#;XQ1ODdC7TR(J$ix5pJAx`a(_#sX^?rEbm+kbjfT(X%DT~cPMUgUQLo1jRRH91|ntMwDPn_t4**z$Qr7WcTEp@ zY~qOF+(RIm^Xj3uK2VRNF%(Kw;%1_$NvJ6x*FPcrCPX$)0T}yM+zywMa<^Jn;rk5( zClm2fza)ZcX-H1Mczc5QY35gDH80HoxuB(5M$*Ez|H`el87|yyTNyMI`|S82Lizw} zpA6%xx;Y-<6^7#k7Zo->tGy%=s+6{Wx;`e;c*=d~F2lUOQ_fXU+I6$=efudbvqiyb zyv^zK1AAH(ZlR=FxJ}?PQ~mTZ5F zuos@Cmjm>-+%O>3=lxoR#pbs~l7%D)(Ech0{XsMJieIEd- z6POI6 zQCz5qQ3Zj0o*sl3|3m;AKNGy_BcuCbN7%WBlT6xl89?wcru3}!UDyQF+IQLLQ zBgV?m!R~DKw1^Wc7Y)igrOozRblI_G8zN7aX;1Py!WaT3BM9Zkffd)kj!!0tUwaLt?Prc=C;F|v{RO{{f!90g ztjOIOdEF7HL89LjT;LEzi~-VsPX#ji99(pXm*se@m1m*}_yATMO*ngk1|VPc@MLuM zvXKAdaJ2mJ@JYk@VMJwZ383V64ZKr2mbqe2U^Wda=IRpH=uYm%0`|xiaQexpA&QkN z{K)ogWLjtaL}Qx;jjCv0knsbWjOhZj?+<=6BJa~7Ya`II>3qgFA2?7PCONU8Wg^jr zUMFbbcC&J{riimJ9e{S#wX4ROa7eT^UPOte?d6`OS%$aPgs7ZTguN8E;)*B(e)Hh@ zj&zI&RSAQ9lG8f(HnW!uak-@F(ks$N>KN7zuR&}R={BPy;?z@)J@JzlzVyV?Kf3r| zl_k0P_1Ry3f8@4fNfFnqc>Z@c`WO3dpivMxB|v?Q)ilMwE2N-I-dje|Ap?BJABtkxk3 ztqB#2i2D~$0rqWVyX+4g;~CSf4Cf(P_KKO3T%XVNecc(G39Y&y$%(Z0d<5N@nIBi5 z1$>d>`PW7Dv!+mfQ&_9Evd1%5Ls{(;8dUxg*LASjvwl^sy|$cW4Fr&8v59iNAL9Nc zg*QLL%w3{_T6Ri8qO zhj7k*~-RSt?JFt zueG62HNoVqfI5hiMir0c)U?rf4(>Y?_?$x93=s&GPgiIh8a!c_A`YT?(TYaLgE#SE z;XL-gkXOp2a&~r1D=MqcjGk}YvF1|sq!aLw!Sxj}K)Y&1Gnv3wJwe1bxC=2T~cUYB?BjRY>4dTlm?-xO^E>g3`AU1i_fWDw`MH>tY5RXkvb0=KJ<`t&)8-E zeTIx4+1cK{^!X+8Z=Ny#);r1W)m>dvPd$FhNyiS~daE^Wy|w7hSu=ipO~;0f20?+E ze%8syUi87+e)ikNv*sLq!TZPUKB;g2{%aCheaNU0ogE#oKKtT=Tkl+O>rBsT zA9VI9$6oZo+kW<&#k1xdeZhGS_ZcPkbHDg6yB$3Bfg5kV?%O}Mi!0UZvj6?rpy9)Q zdHGkKeBeQ^`s>%M0f6D4A^C~_1kfqtZ+@rIII%p5Ycrnn~h~=)Hrgo9doB4 z`9}>yJ<@ChMf$y>5H!#`S#XIDUddV5Q>^_n91!Fa)g^&XH?LO=2VMMod(|occzg9~8qKtypofNSHTsiR z{?F7?PZ&OS%(^veRj*##PkQ%h|NM!wF258bcXf77JN?8HKY2m#zI`^VTQ_9X$b;T{ z>Um$j%x*5zSp5bLxahlI8!>jwvkyM}#*)8pJz>YQulV$|(@xO&i^6G!b=>5Mm;CsD z_B-L|fy0I@dwFR`d&julCZ7H;pFI1DQck^5jv zPg0C;!yI++p9P85xtdVc?9f!*Lrzl*2K+yuIZ#TV2My*6Hw{YV|FSFV!KRU?4s3=Z z8)&)g##z#(O>x~Pv@mQDRE*RLGw0Tv`hE7Y-gV{Dnsz`{Osh zvtsERpkUYOQ_jBp(mfA9=+S%ce{A*xHnP@w_d}+A=YmULdwvN3OgeD?bN>Ca@7ib2 zT@ReHc-9<`@&P9wJL6YZ&;H{L+2uj+J@uFi&pYbF=gz<7&JF9<0SLT{a%(`H@wtop z^zS$0msj6&^|hVt?EtXr^aIZM{Ac$#{GbPKyX&d>3laC@X8h{v*?+v=;{Ji7K638- zTW4%|dp!U=`{1JGuPhxtcFd#$r!1N|%M{$>@aX{X@LjXJI*A;EHE*qKU%z41vK2AW zyBAu$QPBi69=mOdlnr$vpjnCTabu*P1Pkt_g?l7?Dg_~cGqG05l~35fv{EujWF`us z$P(^r{Zh%%E@z6u2s1dj(oBS^GDYu%V_E&h)a5eq(ZE2AHvbW71m|os=YEWrAFaY= z=`$}XT8|hKaBWnId5J_FpPBst#Co&sRLp{(I8e zmx4J$65Gui*}Nx{kX4_b3>Q%e4;nuGppb({!=V5GAOJ~3K~yA%rO&bgNO@ zPulru90Wy8YwJ#1pWc7{;Z>a-olnhw$UIs+>;46|&fNF-BPYCP5A4*gSo&J#(Pk|= z>zeDPoOJBatwwD>@!c7Btzq8HcN~4edHWoD_@bG!GPJhdZM#lC000)wxQFbDrO&?b zh2!2!Jjg+yt;r>vvMhQmwWk|aluk+n=B`;g69xsw48$s7ZS|7!g}L|ObwRqPj6*o} zAbt>#b%Qx1agzeAn3>i_9W=KtW!s{BAi6*$AOvbjlNN8fD04h-NQCl{=lfE!iJf#3 zw8V23v7kKK2x=6sL@a-~zJ;8A`I38RQ(jrWgJAnl@(LkL!ns#00$DaDEWe1M?~*4a z66_3`fADg6klQA!)~eItnS{?SqI@|N`MV~Bd#$xOwL%y=dKA9dw|_tLd)TN^s#mX7 z%a*UoJldi*OCEa?0EUhkjqCT~qmS9X$&$rS0Ko9EV=R<>bMfV;pR?jbO6#uIURW}8 zt5E}o4F%U)DL1u8`6EbmY;1pG&H_OBpl>XB836hX9Du9&^3%`Rmt9@@wda=%-D=dp z;X@761-H&T^89nh@4fqw0K`B$ztJOBzP=0qcHVFA{sRXrfAzH`k3D73FoaK>4d7&N z`UZ3`WYhAzpCEUha`C*?u15YAdmt3WL=PjQxKYtb;Zk*DFjunl0`m-;@ubjGI^A81-xZ6_W~9XG4u^b zS(+9=*?&;{E9&}7cN7Rkhk&~iUIYa-kc%z{O7PV%F%|a~FGlEOn}`@5bp}B~MDPsj zge)068F-IAzuc5gt?8}rUG$k(pM5^RSv<9SaEsn;0I=ntfgk?n|FbFdA2mAi-nPHIwr=$r0O;MjHz3%U{{{AS6h?eF>k3>rRc&m#^V zvCYmNMx4FAcKj1w_A2#zh ze*}O%4x0`D3uoLDmasBt%A;+ao2lJt7p#W0ZqoSp>1GV?n2LxYyykBC_sV62E5;Zq ziJiJAQn5+VfxtpDbx^&7bk*@e(mmQ*jGe1^N{KA8NU^dbH{xI_)f&|+9BEp!$V%Er z3^=GnCNEBVh;w1%uA2{Z&lKrtug<=@QdwoIg2<`GIc>r$w|H)%3Pj6%XzSBw{9e0@ zP%ZGiNCCX^%yX|i^IROy=2AGO`=4~oaUc6o@4kHl$Yd1LWV*ca^z*Mg{k->d?oGF6 zPVHU4{bTRGeJ4)c7XTJnM>NPGP;DTgt;JSADuZxy;pj?qnd}!xz|MfArBokT{4EgrQ!_Ay^nj#Aulq8S7 zLMN0nb+K$Fqo3~RD;pf~y&0nun$;|R{Y{c&;FqgD7ik&uq=%;kQ_P!=q zgOt3KEK=)!$X=m4epZXE2n3QfFtlHs)S=8dUjE9`Z=LrssG=T@bXa6N`@qq1x`(wx zN|!&zPT29}PhHg2+4<-H`rf0n=4@E|cJ^f2=_elli4W(@Wo2uIMh6DxF>l3I*5sU?;M9|Oe-oM;tAR0tjhN!bV1x&(F6r6WGOxPeDYQ1 zv$uf-3~9!~QDa4Q7RGFOKnp{_CI{CI{`Zyz&=#fdzH;k6BIVIB&7~eGhIC(OM9CqZ~)hIy*XgL*KSOear&|kX>f7Wke<& zxIX|ayyKn)x6UN0SNz3ue7M0B0BAk`uXh~zk@xL7{eS^O1_QuDZtj8GCP6i+{c23K z{ZprGe@&EFJQaBH*nnEZHR5hF^b|u;GIVm6C?&v3?ZU}Q`V z3@Ivti_ya-k1c1f%yoaMPS0|$)RX`Fq( zPyhZSw%K~n@L{;f4wEO^m*aMu2ms5MzQ*#f#WX*Q-z(o(1^`>_xV?=yW~Uv@BUQ)) z0IQZQ_ef?rwE@rqRa|lJ(Vi|Sr%JdJPErF6e9K6~z zM@y4n{A`R?_Kwv@!R}H@*(;6MIoUCCErNK+qk)$02|k>e`?-C0C3i2myX(Q+wA7pca8t2?|tL5zy48n zxRnhZ8#f+&_Nilb+#yrOU8f&#z$wQ8z~lGLjc_WHhH^#D#C~GVd;mD+g7b!s9+maf z9!DIs%K`gpt)F~gfr-kz_S_2qFmdX>ZN1wJiOB~YFn+Jy4E>5t0I+)biYM-$zx9M2 zM{c*xvkyMJdU^60w4{kT`O=SlZRT}fn|WP!Xqt^_@I$t(iQ(nZ_jCp;PcvpsO2VE9 z6l$Bgx}6MWKiHDOG*XFUex|r4btAI&ozOlk)4|A@N)-navM&>fc_I_gVBdQV2YQ^? zBEj|~N4ElnaQWjU*s7~|UFw6%g!M+F@_OCiqG4M}xfGCEWa|M?to)}T4yDBO{o)_4 zug44j6KN^x{iu$+qk-vntFf)tplvC5w_Ij+zoQ0{LejwXYzW=UagH=nQ5#w|O3rM2 zS)!$zHMTB-k{mUUj$G#px-|wS0zdr#fKCj+ILf)oFmog6WCxRJ2HySP=}{Tn^u3>s zeb-K7#*h2-FTcO$t(Coc^~$mlo_t`z{G0Fa7;Rj?;gNg)cFE7a^VVx`^xd+5|3L!* z;F$%B7SH;dM*BN%y)=MQ%85q`CRw@;o4;{ zzmiv0>qRqX9eCEsTkW{RB|rbp6Zg+kN^Q5x&ZBnN_OCy<>Ws@SDd=aqtcy)CE5xD# z`3C?1b8oyY%WzmU<6d@8Etq*=|IJ!GbGVni{OVJ4A5vzm!k8wCogdQ6ktyti5Hd%? zmM2B|74gg2+E8WdbKT&9*<`Q{4Jd2N$`~J&ZF>0!3~H|yX6qKp(PYq7;Jr)ocxqMF zBU~L#{3@gnCJZI;JH87?*fcb<1Rvf?W0CX&tJh;SUOpg*WgwpbIV?+K>U zpq0$)6>xE!KH}Kf?o`nzv~f50L-tnLrpr+SH#-B3qTIv=r+E)2Vq)bs%>^F4tqwzl zlrFoIUGmzTHyklb@UZ;V*M9KP&m8=|Gu}OApCO}0Y*_pDl1HC-@V1!`-Zrzdv(uZK z6u|6juG5`e`<-;mpngMFzOii4o%hWA)iqt6UAZvM+Q;?3l?KS&T0?RDnzdJc;&X?d zchlM!|S*LdRjFhs=dQf;AIgV2}yQ_+dt0@16>@z6F1g+j8Lt`~ zL*_bLyo2Sh1Ti-uFzC*7Dqe82WJH}R$EmGij93ra zwSi5!%T~9R4zaspv8rK5urhBjb6D|HXzt4{{}6dv%^In1F1vfKnlsPxW@3KI~YtU3ym7$=&W}mN^HXR z?|ZT^9*yX!1f+`rITQ9sugF|h!QpetD*!4W)*?`<8n2K6DiB07ViVK50=35x2Lr&u zJMO7ZEraoU?+yS9@3=eS(Mq5gL6XV_Fw9=PxI|^BLK8VR0ZhDJQ`UVAuA6Iq6do-p zvBH;}8x-A+=N%vaF%i-9^1OT^p^*_?AMpi=`c@lUWOAe}QP91S~jKF^yIED(?e zV(F4|Dz2P<2~R%eiND8KW3)+6(=0g&WR!}8`xHCk_5vxbp0uVZ>uENvc~1&Y-0B!~ zr(A5%&Wf_wu#$jZA*U}WXR%l@mN6!xpbKbCp{V=*GRfe$0uhdwRhkBSddNvAqHdN) zTh(oXyn3m{yw;OjfPg=5p%5R`0|4}Wv0Rt5=4ue09ik3k9UzO7@>KCOTk}ORYbl}8 z9e|*mt$6=Di6&?3n1QbCSpILXLb}JEFXN2KUU9F^HBwLtbb}J@r6V5E{odN~DdTmiKP$n4TX3yp( z%*}`4%yguZO*VQ&>6;zJVqOVsky=uDz%rn``rGYOM>~#UybOnfl`d~np}Q}20*KoXD&i~U zAj9Ko71+SX1h`b0qQ5K$S~$MMpn@|c(v^TqNZt>R)39XVj29}Bgnx76(ZVDRuI1B} z;FtjA>8BN)a9G+)bc%^z%EMN!4Wh)2`K)dqxuuJ>ap0+6R)e+kL&-v(zsm^#mbLO} z`L3z<^F{o&WqetIcHuU}QF-v~bzyHv^5~`(2@(foNB0njxv*n8Rh%e>aCz|mv-jq4 zw;ff1=vuY+Ip6o)do$b&gapaRkU3$_gyAWO5QYE>YC8jpV57FSwB5~5McbjZeNTPb z5Bq7Wt&c_&nMVmS*gLqGg|Yn%_}is_yo=DZ0g6VGb%gf*J7e0qSkfI`dBIxd#TUEC2V{KiN7KLKbW z5Dc;2wm11({Q*6pM(giLF{V}tgO@}~ z1u9jk`v>ELacvVq%PZe|xn`J6i2xBhj-1x*VhPhz2m1o0Hgv^V^C_;NAUe}U9>lFe z(89r?Qy%^#&r^vALNCs}Gk-s&HtZy))8oeur8dM7_id8q00Ab_87)3_Xds-|kWiF6 zA=TlmB3_O)iz!noFB_P*#Jr6=I6trFfk-AqD|-xXhDC=TlwHQOd!cI$&1sgyMmaRg z;}LzxbY|ZO!sT9O*k`o#;Kl9x-Y~@Pq=k!`J2TbUEkIpaT`(hX(k$hiIgwap0i>vVM7;9Q_ zz1-!EEQICR0+|{I*A-D)WOEkOSn7r813T8EI|?OQb;?<=FdFoK^$KK{N$Vm&e_c@7 zhyXxpt_igwl1?Q%F?>|Uz;Q7b=1@(S*Ty8~Va^b?3UzOrFCBM&(iMnibK>4z`&@0K z_gS}IZlpob$CHOno7zM!%%FtmNT<~JidQQBHTti@B_a51EP3`Of!9_mecCal4vCjj z;$t8$D%Xq94g9edCnnMZGK`!nBqetKFw}-VSv~L>o7N*E(=oBfa+xr!l7*4B_%?QI z+k`q#FA>Cje4(2La&IAZghfjk=E}zQQHq3=QSDFU2&vt^(PFySkhD7vIeWU(o14oL z6O$*euSz>qD9i=H`F)R`f{=juYwzz*S|Xrbd0b(w?=IKw*`N#p5wsUfX{VC*y0BZN z!LreZQM$aa%uZYha0^Q+HG^dd98zLDhHjsfN3fK1&nS6O&M*&`HL!KV z5MD>G^=M8sGRU0BLcwoSU%-Co|0gKW)>Y8m9a$1uI#-Gu?sZloN72qJ(~^0ht)ldd%it=rvK8R z_0fj+GJ1?9r6ehx?@Zd8Xk7@cf`4V1hX|Oh?0+4v80NBE4oi^RF0huf(38C7v?hP+ zS*F%b&uC}G3x~WyyNG#R;_YoaCO$npU!{kUnUh}E!svodSg2CF=#FA%i06gvi6?&n zWbb{m4u5T8diUhX#mCh4m457TtMa?|cH3gmpPT`=jRK(ZTB))`L~S^lt)8T8ng)ds zh@z^5o&Hk&Bk+>SY8bba3=AnBR}PR4Ctl z4Zd(RpHiFBxLavZu!}G^EPSX_j33UJe+3PPU2W~JaV{G_0)RdZW<)!xJG>M^Ni>-? z)9FMAA%qwKpb*iyT>fKS#xxtgtDs9iw4u8NbG4Dxnadyy*9tNAD&Du=g0n$E9rMkg zons_QS2oymOQFj2VswH&fs}J$B#p5=KH>^QI-<>pZjfNwHWU~Ia1cyW2kRL}G7 zU42-B!G$?uN?d1jTIuN+*Iu^Ku7%X~K+CUK*9#!q58*0@g-~P>$%f=~Hrv{sh^nfD z08v%7dTCcYf_9WB(c$bUvR@tRN&6DK0x8c>*B)QVtNE0B9(lMD8%0HFgh`I-p}_Y3 zOl}ffq3#kpT(+hsICbUm*{`4*$_V0-_N}bb!{_FSUXb&m#23tc91auDNn9^RHgZQzj%lPJE+TAP#5B#D)Q92 zayF&EI^SMzS&sGBE@o%2e^`hmwZv@9;7_@5OSJ!9;SJy3W@iVK+xE~)jo2B8E-S@$ zQF3N%B}7%%^=KrUW-^&nbuGtZ0l{kVFPaHy7xv$+P_E; zeYYtp=W2oBCtDXiVY-}{Eu>s@EIHopB1Zb1t~bw#zBb&omi2@9)(7k2@n&VwH5?40 z7=NmtgCP#@f2E|S4FmtDUzL;122@%4vP&8(7TNSUgKt|_q)*7}fX$)k4#Eh+`r_)roc|F(>-3+`FDAz;&!fBPKOpzRv?m~HQdHLlp zU!?|AF?bRdcsB6R6-d1NC!G-Z$!!WL9YaMAw8KiIZ}>t)Y6xXRO+$@@hHwVe=2SKt zTdU*I+IXavFaaQ(dm+{Ag7)Swj4MqxJ_(7QiavJfXNbfFLY`f;(&6y7Wr<{|B*w%- zJ{Lr57CA~uhB|+%%6oE^&cH_*)Rl$gGVFY|PW`w0&<92j0O@6_Ky>gc2Zs{VW?7&} zb@fZqAJ$bcK1URmG1{?dSL6%o(1LR`_zcC5Y?voWXlk%y<=4N?C+9iU`8qXyW>wK% z7-sGVT3L3r?&TTs-m^MITr!-^8QhMol>RXALZE0m+6=bXJPIbUb?F;;T*~;IJW&MQ z6R{7p5qO5H#_)i1Y% zIP^XC;wS#_fBDY<@YX;0(@(tPy@t+L{@EX#_^8v@?|Xx*3 zpp(ttHj4nFQ=G9$LI422`N6jWz^^~^`)8901mi|zI?m;@i(YWW6{_v8{PzJx@xVJe zSs(<;nOM(4_x6wI{^>Y>!oyt*zV^{s&`{}wjCRzX*Fw<|KbcY{PlzpL&*T*0xHjhn z0%!}fJr&k6lRy;8Yde!Plh{a*5*iW>RGU+|HQNRdFh44ol6hK=o5 zAX~G7uaYA~O(bo6#!`to*hs6bWU;#J zfzC5)_@VzZCe|Syw_P$zN{qln$-cJ`gnB&l-dB;V%t`rN-7aD7tma9uu(Y$< zkxw8^g8>0bD|MD%e~(mDm8hy(h)RekK2}xRe)1D2ZzX}N(330qF8J=t&GY^fA9muS zPIt4JKNrKUf?Yur@xveVq1TzEn4`aW$TZZZG0k1c;RMw(_nvPRfB*!fLCvhXu1BNs z+S=N_Ble9~#!5kKnnq=4v8da?0EC{TOMx`vytInnk|sDzcZXHSWb~$Ur$LRS;nrBl zwJu1;3Qf$%Qb6awN$TdSVkxlO=otVGXLcxYF^~(3Cv68HE94j3q}?k6^y-vdrgkwn zD?Rg)OV=rx#_~!)Z&oj#9Yf{e3R{Q(03ZNKL_t)WJt(H_5$&o#5CVk|O6QeQk|Y4B zsA(f&TtAI_I!0T)CCl))?)us(=bwG#amOC~)_nkQ&Uaq2ao|CcGR{e{-?8f`@^El4 z$8FfjnYiq_1_ojVCVvJ;!~?{8>smDBW0|Kr<&&7BwWZ*l8ZjrJt!@N}SP6kx3sKdG zD=5}C)|;jwpr&aA3Pfx#Ro2rDg`oMB7(SA%U$+l{*t2LKxvnj_e50QvWf8WCHaeCV z4}|v+9lIwMbBw1K*ckn#k4#T+Jkhya#f`_*`S%cmc1CBm&%^xovEzGM5lNtV0_}3x zU9c3&`VjOia0BskXDu=e&fzt(W#=JvcZEsnBx|Qs;ru*aBoVA4llM>eLSK@JtT5Z1 zrba2W=dB&TfSPma79s(nQhz9fN^-Y2&{(ye>(BOxY#LBsPD;B8Z@>O?ayC2nX_u;> zXFv7gFMZ-V6oMs}jFmuHV_b=$E;W(FM%G27P2S7&$~2Js+#@hJP{pZovAA2 zJ?&6)2$1{Bkr=-9{I9vUu6f4G zf8^Bj&l#_+e)G<|KKjPDT>noW3TAILsxN-wbI*VJ<;S1=2qOCC9d~`|UGM+o+utkM zEmV@1eBbk)^!#V-KjHWX@4fH3_gwX%zj;&BG%TBL9z2w8yBpcI46CTcU&=CrNkINr z?3wE}z6)p>K;|5s8}M~`mF>60hyb-l>n|~cAPJ$_^SOU zo$#2aJW)2ymp=Y!5qWA)J@4!v{hePOudQxxY~1_RdyY8f=u^%+`;_y}KH~`&zUepr zTa0#f-`h$mbPycSukw;wf=69Gp)u{fl|N3jEU3eY< zY_D$sz)6oe1y9jBfd)`|8^^s`)?>#P@_1Hodas!z~#$s?=PFA z9IkVMV_z+D-q}&m=Ia2}FWo~dn+zNII8DKnad+*Csf`~U?{c-wtuRQ0e7eDr* zC*Ag$8#WFe4D$fK;Fn)LUR%BDFW>OtH~d30odLi(-+A$iU;9hvfA@D@_ui{+`NVZW zk*8ew?5qCr4Ojo&TT~rS{ec&L&rkj6GhX_`pMLiTwl_Cbo{L}f+|w>R@6dhszwvdy zfBW^H1AsH0aN&zz`-_jg_(@NG-uGVnmUp=bWh2kI{E|QZiGTaeJMSWZ^PYCui(mUo z=Ujftspp-2#|<~ety+KJz;tW-!F%uPf4FfFgf?iGLuC#Q?JR1vxAr-4h?H}$FnyJD z%f#V$si367^hE%+|FMRjUisRS=jfY;tx{W8RaFU)!cH^mNTtw8I}dr*^VhKrUa&Ca z^DJi%0^Nr~{RzXLnbp}$oKy}zjyA=mnJ!9szH?+1z8&bt(vCz_DFz z_}v2zUycZ`-dxTkely4ODx~(R`Y8H(=@7VkXM;z}wcK|aTxy)kIcK?pG@#l^E*F|Z zm3Xg`Xb4Itl%?SzdT8%3!E$@6SHwLGp+>Z7t64P(Kz*5B63Iq3GnzFtYp9Xbo)xpc zCTHOe(6*bU_uO*ZuRrU>?|uDWAwc|R;L!aK+;PK==RWPSlg~Z#^B=y(i)kW2fOx2JPiQe^(TL>G+F?-^;4gD+yC|d0Kns){qz7~HL9LYm$4^3P9cj|n zSOV&K+Qu_F{eu7)bx<$zqtIcNW=M<*`5C~^z=9jY>CU1U4@<4{*KxH$mT9cxY>E7D zshhu&xU;+d4A*dC3f-I-c0)<*tWO5l#)zWKXw5h4G6beBXCl6hWusJUMZ)=h5daX7 zlx^&vx=TnO@j|_Gs=Q7{kG4h8zd!dY za@NE|-}$+lR8y5T{IxIMa^C-O*}h}<`>kS4`^e@fv{z#1Mwi`6$&5^%r9ys^0JtQY zDd&8GCgYLye_Fdf6GQ3LRn~lVZR-ZI)v0L`wnDK2g491zv`e<~DClhZYGs!k>LFYb ztvu{o>C36V%a2G=)kR)9j`b|N@m)NqhsmL+sC?(_NGHZ*cSKiq<8T=>c!e&0#4tyz zz$z0ksK||Xwvn%?Z@KY=^2yo0VqB{T+;;)gJ=>3z=v{S34SEYJZwuE_T)0auk;a(dUz~Tkl zKp1{tE~*9qbEl@`z;9=o)_uL&=5g|W_NtFmb-j7;(4qV8Pvtq{nEe+#<5crQ2N2P$$Zo5GwUPA1Q5vm1xQXC@M#KJl*!9xg z16*8htbFL?Ilv3`EDI>=5#g6oeljcSztkPo{vVnhRLKsiGHD`|UL3||^s{-g70lbp zMF^tEgjjIT&mDVkn3&>OW-&uRn0$qdNYT?fWM`?|Z-ZXMSR|vXaM^A>-~_ZoB(SUmjT8kdtXn_tI4& zXrerwQDZw3vzv!98U{K)W6ucy#Qq-FOP#7$`5&@DR&!2xa;6OWYm#vU`88N#uvLF` z%;$ne){UcGEbNAOHMcumdcug+E;K&QTz=Hv!Z{o7epB9QLw^k>UyFVy*~8)LOwB4L zJrO+5RMFuK&IrB01KJn3kb-dRqrlYum0)piv*q=iwX3a+@F7iY?^=k-9P&LN3Kyf6#&2`-}k&{z3QdQsB!tgY|`}xBb^fK$l+FXH873K zD3zUg!eu%NT;Qwhu6hw*WTu%!?G<>TFeT&s6SkP$BQa_2{^l^@y1WK6n3pgAoo&^4 z#24LG{oxE_baT zhNshcV#jxn^05a1W}-3`kxq%K_c_QauPL&fSIJJ`IwhryISd^XM=sI**)5u*SCoDg zwM_Rjg>M%QCF~tbm?c3HKT^O_@%Tq&c{{`5$BsHXf!RC^iON(F>W2iO6~6$e0bJY8 z+HiVF2J&Zz{n`y{<_$RQ81E-Vw%%EnT?7EvzyF^<{a*i8+StC&Yt=4hqS<6pkH@R~ z_8hu@s!{-;8r9!%=3`{jeC5V36yb?~Ca7~?bOp-x2X7teMz=7L5roSzz-c}@Z)#0& zbB04|SS(8C3?%O#-V51!VSXpy?R(PsVI0N6Rfs`pJ%Dw4AyEG*AH`HU_vF*+r4NE5nmhzJDml zkXX^8q_jRdYMtxQ<*64i^*ZLmu86W4BBqwKb=oDXG6l1@i!cRv4_PDuI<(r( z@#}rM#jBeY5(r3PJgEKRmvw)kJLNii2mA82i_xCE^k8Le6#yQ*_kIA6*N;Etk5HvpV=!MSeYnU_4}WqTv#ZZL=EO=zwzICDv)aSy~J2QAHik)4iNv-D^~pwu$)5}Wp5cRLg%SNBKGZ3{k1>M9ggCMCc|LxSG0vf+TSuq zb@3_of+G6v4|@y#;QAL2yNVbGmby@f9}hECwZoGd-ChgrGC}Yx>}a&1L@xn-MrKiP z&#kuuz?qjksUB(9GU7RxUvkFd&TlJp7alEC0vf`0AYT9ee+GbOz4E1}oOhN=Iqh-h zJ?|G@0RW$R=liTq?1wVN{eg+U47dyR^M3wkUiX2wyzT>UN!GdbaNsDhJc>Bq z$nz2_K!_a^$K(n}maj0tA9T5=E%Nka8evHbRxqampJ1o{EdK}X!iZ+DXxJ`|C=42< z)nRaH?u2OJi59>hqeF<(I{T3C>G`HbiYwZ%tDFQV!dxO)`qE#LGgz| zKmVhfulWQbe#e=QKK_(PzWY!A{DrUiIa`NcoC)9X;hKMV`=g)ygwrlO_hoA)mpQVI%gm#4!cyA+dar)!V1AzO!diR&2Pe}9wZ0RWU*RmO?)v=Pr z+gNJ^_bg4G*}bj1b}>s8DaDzqD+ctqu!AGfr=j<((_QFBRyZ6IUp#5@fMyj6yNHm? z-Zhaw3l|P4H>Bw|Z!4z+q5l&T>E2t9Dg7r*j!PF!jKB&+p5f{N?8olSDgD6hQWH$w zp}7}S<-~zeygf+Xzh#OMTa90($sEsO4C4Sp^kJ_efPb*e1e$B>Eug3L02jBT$n;Od zie6uNKhT5hp5&8R5| z=AamwC^sh{OPPu$93y9Sre4{T$T=!q^NCGwX0yNeh5z*3Kk-9nU3$^QFMQ7W{ReLS z^!0E4uYYvpamTiWJjtQ|%dd+z%WO9L>(~6+MK65r1y8^HxJRA@0AKs!t)F_=`#<@P z_en~e3}q8lH^mj$U&&EB;<#guedHqm;M%vnJ0Ct}4C>r985n&Tz0(wO{FB6?XJ~4J z^LWf`g+VJQcnnc=klZ7i&sx5+pAwNedzZ-8FTK|U1o{qI#W8I=on^+k47JS9Ew=&u58JB&M^x4a9O6y|9sOr$Tqg5uQ{Gp%j&37xNQrzmzSFdL|HPNC* z_ZM0$A)6a)rhsE?1l@{gquZG}y`FRwVl+9N-Uz+lY2A^Gm{etq#^-BpsPT{^CQ4Yz zu9lW&MDL|XPl`^LM)z%*)~NZggc~~vu~-YR%?l3au*6_G4};A76Z)hWX_kwTE%(A& zdFYa8jMZ42Bvu4w67+;2MTz-|>gx%w{jTSSnaR@V%AsL2n+=6Qr4u+4>706zDCWuA zo?+Bnz0p;INlJo_xZvqed(p4_{B(Q!_g?&y!Hv02@hoFGDU4y!n!p)8Z+>J6qy+)7Vxj|&fl@UU`=FGNUOms+K^=nSd9_tS%9O!L2oKcI_2 zWbL((uk@vKT;0A>8yZxBmgyDEJhAkd8a^kkPmgDOD(?n6i2-TdAvjvr4V~ z4|+ay+2JXRM?T)Z62p|4cuGFN)Vf@U7pTRh`3Heq)**3L#>B&1Z0^14#WF&{Mr z005^y{(Jzq{+~XywZ4(!3%lSYtH;uu{eiPJd)c5J=%bYG1+@%Pc#bRMhl=0X9v>~7w^ zltj?c-a=?4#`2C~bz;s3zZ5iaiS|nbHQVcpTD^7(I*AQKb@)ZC2f`Q!=M9hZM-`ub z;dub?@wdJ!RgHEJxMB=>{Ts2px_=Nb(P~On_J7W`*Wg+i!10-zGUxqu9eA96;uhV$ zb^GQyG3n^8#?b;FV#9DiI=vzR20xBS|L8Q^9M^Pybo>GkWz5mmgL#y$k}FU)SGh4B z44$OmF;kc^2jo6_`bvy=Zb0Y3(?TJlm(qQ2W9rqH@a(dv7GRIl*(y@1Zi?(&Kg9N@ z%QxN{7xig4aN6Q1bP%xdD$eZ9F|Q*g>}PeEc5?jYr^I?YQ#Juij<61gF5gvDSkDr) ziJq(Vf*`L!loK+SKRDunOuc17yr|aR4pq0xh2o4y!IPjhxO3jIAU!%vyiR~DWdx-x z(M|?p zrXvhxTy*_d$@11?;pOi@9jddMO22HJGDJnsC=?DE#xYCbH=NvMpZC6J)hsfnW$Z|y zN@aXKev+@pnx!gGhdX=RK zlqiOCI9_#yMW*(Cb1>dX=JNDHnM5GpZ^VK;Y)$AWa~rT;_`O zm;|wOO_?+Li$%zPQ7o@zE{0)zau$yAAp!S&?Vi^@{RM}cihi(w(ciJ{vH74hm}FiU zYC0cANXI1f?3%piV?mHq40jD5&Pzxyzi@xlt{axKb8H+J+AsiAN|y>y)fz2J_Yml> z3B`%#yhn23EU1N@z45`}xgc7O7bt>;P6CAB-io2n5%p1kz#+-toR6jjLEl(d_U$rG zCArv36a6d4rs#jI|46hfsDTbR=jlPbZQfL*557Cuej%~mA!JI0)5#0|@7tdgc$WH_giaRL3)1N@9|HWDmrV9<2No)k#5_ICG}R(1A=u)W#V~R^`Z_M?ng66pY1_rqCxNwV@r>FvQCo zoSXJE6Wfk*CUgQujUU!SjzFfr3OqeU$#F0)ZPcS-rP&;WD?p&~NnuNnm0K;!iEaJ|4M+)j(exC(AU%M+( zMh|j=?Hzl_$uOAm?7fD)u`&^;shp|7aF`~#)1VJTk*{Qh|3J@5Y?CHDUBoDkM~ zPXv|b>a!Fr!;(*-r06YUoN_y@FvOlSb#N-G^Ol>l{ze;z9}DQxH`{o{OrSuFnQW$z z4r;AieUUq&{y3B=5Q+x!p2<;&eJK<@d0<3G_W*<)ZM?`KI&ajuBm3zZ+*({|Jdlem zs@Okg1s9s;$KKKc(j(gX5!-g-GUjPK`JLu;Rk+0cic+AQ3?p~;cz~U6ElLVv4^Z0} zO#hH6(q?ougF)_9t<(^3rd3I3L&>`m=MF0~00E$O18TIv?w1X`CJAf4bYWwN?PtKJ z!gO6aiAgU9_XrWE&XiHbM!x2k&u+*>EvNU_Ldf}>*+>05p+WNl*wH$}P7H;q5i77& zx-y_r54qJXz>jPe19`5B6jKv!NJfupoi6AynHPGDjwR{dI?qs*N$S1gMY-)-!S6FL zbEE)YZ^(JIJm`<#TR3B7Vjg_#?=*+ErwMsAIuFB_bi?Y|@l~M(qhG<;6r$lwA(W`G;u)d+&-T=UoG-OdOk{ zo!}}99gSZ)bO_<0SbORQ1>38RXxF&g)Ht7?1;AMZSpkXB24tXYu_D7}E^1_K{dH#T z{t`-pEURAi5!KG^BNUNnWE2o_S9)df_R8KH?J}G+X^spyh*J!F8%Y6UOdeL_a5uuP z?+|w_ir1y&`nrIM?SB2DV{;b+Xxt5Hu=*3Z!3P7Hlat0f1j`PvOVr4Z}^?s9ZgPQ#cnh5zEt4?zRO%ZKH6yy0|0`4ZDn*RM?Y#+oP!% z%E%PvoY|bX+SUKzem6BiV6SlE!6G0o*zxtm1<4xEY0+u3Vu@aqswny*+B}dz#M~TN zTC}KEC$J5JWmCBUJ!jL<;}(S!mNvw(EIqR~jX}%G-ks$ev3UkgzUfzG5`VyNiBsfR z6yDEh%cgU5LpcTj*~rKxDG&y&$G(UF7({9+3R_PNsZZaTs|~#7x;NLNTU<}{j^$$R zmNIv)GdJ%dxIF1tn`ntIrX*IAeenB{!_1|d0Je0sfjQyS*h{+PSLlKJAf<%{-BbGz z)2F@Q#<^+l>@2f0_z>%+Il%YSa_ue^EXI28oXi~+=JI!x82}76E>>hH6((Bh09R?N4^|A|bMSG3rn#Xc~6!TB@yD9g^VS^kk2V zf?HLWB&FQjj^i7V(fgoL-y3HYqM@@XCY8fqK!oOAjQD*X2t&`IbN)Lr(@F5N%(0Q( z6Rd+)X@2&KE(G$=mziyMvt&YhxmW8SX=80sBU3J2@ZGn*pMM!Z&VM6+fHT_?J2S*R zhw`VZ_OMiDjZ8_@ybYd_#c6svD@{Y+0z>E5(paPS?Wm5K#=Xa0p2yt!*vW+uQ9pm6 z)EwU0Kv&LxS9MM(5f-X%YKYCF{N^h{JdOOOq^4$phT=I*7UiqRx`GN`bn|PDp1H?W zt-itf8yn7Od<iDa03ZNKL_t)CiHznP)aW$`lN=TX5GGA)Fm(he?(qh#X9oxqyZ;@Q zsyFtLWvhRn;S`Kt=4!P4N&edoPIlYtQfCV%$}-7*U__QnyO#sLI5JPW2%=_{MBJtT zBTnlugS#=R!A|Q=ehu6eP1L(d{fX}PjWn|VmdM30rq){Li}GJMn0xIknEZ1tZ>hMS z@}+c9lpJO_thCSb3F2J@hlv4##c_BamV^)iL>4$pQ8G{e4g7}`OB7LSbklyghshbO zHO}F3DWs}hG1V;xmJMYi8!4yL>1;L=LI@$Ms;cW+2vJqSK?H<^;gQEySq8&ZjysnV z$IR2hA=WnLggLSK(FLgEn<4ImY&eJeL{@c491~&qsn5+2oiO(ewMCV1i5R^ta8)Fb z^^2GAD_j7NIX4?*pv)YLc&V&-3iN^OMUJd#E~mY>KU$@h3)b}g3fay_D2fam@a>RZ z`IiToVAg!}+foCf6SW48Mb}Bf%_8^i^wzzU@KTV?vn;^OuaXkODrG$?uJ5hKLdyGH z%PFw}25m676Y3dxfP(6?$Q^A92XUq&N)RF`;bx4;GVSV7@j_=%DvGB|a>a9BKlt8r z|E4?6e3(<7WqN};f`LN;Rw!EA8xO!ywf(ERRI<`&x3;#nx3{aRs;X)<8WGWGR14u( z)W+Zj>!?+qn9$IWvGjp8$J-tE47;NFc+%sc+*N@s8RSjahrLHQRlrGSS0AVC{pxde zV0v8A5TXEpzWQ7-`X%5T2t&NE38%xtY@{w>w{hBS$aB7eGpKc{%arsN`^&|jM# zg|pNB?&*ddXnT17j!ZOgB|b{@4q-GAba3Q@TX#p6%Dqv$=e#f)JW z_{e!$^EC#=6Yl`p(8P4-MNNycF4l#;Jm6L7B4}!Gl7Et$5c6zBBnS>PgG$@>=|LjsvQJelWQ)FGH!gR=5Ww1#_p84 z==smS;#DuZ>*g=L{?)Isltjf4@ZbFUuRQjmCj!7b{_p>B?c3iS;`M4w1`PKI!S)rS z(;s)dV0I#+$yCBf-hu`iXQb>QS1N_lwyb+<d8B8Ujh-*bCM>?W;Tp#(CwO^rs4KbXFrp ztJDe-Wt$aNZh43NeODxVsXzww_o%W;QZVCnR~n{j-LC-DD(?2JrG>&@M1(54wJq8) z6V*uISl~>`?FXl$Z%$TJ#gCB9xN25cR|N_I4HBtw^D8qnAb}*^{Q@LH1FhUcKqrjB z6_A!&eI~&uYhG6k7HSSHSIYaMp3hVkvumFM#xybDaewbQ=1HV51UIg8$vdJux#Mcb zBHgo*8zR>wT6-c7J5z6VP&pq$a-w&7F8jRFbG7hDW+3ww2KS%*LZ2Jy^vzMu%w;mM zT8~eZKfOel`EURVJoUV@AN+{?Rfx$T>G-bGU0_|a>WMr%OIX8ryL z%%4TJhB+`yW*XS*8G6$6+oml%bjN(dmB~sZXwWq}pQ3#8J9Mg!TG)MSt?cS=^ zZ>Y>=R|PqHA-3R!0~F^kETn^0(Cif|?>M4qRNFHvD=SAFdBn=fDhgqu6kJ5^xRF+k zle`rf_h9h|A)zalOFS^mA!kezv{ym zKK=63&Oe6<(hnVD{W>V|jTVb}{lI}gdilR)%dQ`I@OOUTC(O@Zd&irqQLXfl@J50z z8q|ZczpM;6&bvmY4EjeaQZ2C1Nlr(8?R!v*f0!T5Cy%!%k}S3bBhK+rK?iLgzR z$azZAVER1G4}O9jBKI3#0Z!0EJZSC?R%w}nyHY=PAZZ8Ks8q-0&5Z}56B3N(s@Ybf zMK8h^F^OfS^yX^ z;C?d<0EIv)Ny@g9S5{WW~I7fl}ApJEiN0=c3*`mI#Q?e>YqLNFq=E2)uMgystfYBb1G_u7e}_xnS&S{gmG3& z|7Q`lewDl3lhkRkOY=T_5D#x2+-%OB6>1jw%k7f1Co-t{l6+)o`UGDQP;L zPN&m}tR__J^Z6BEC4{JiSR0EyV+6nkK&a4AsZBS5hN(#?M+71^sFfWA6jW=^_3-i4 zM3*)n{At)J!R%-`#T*7eYEM~JI!)NC65TqquKt@D1Ozz!!t(*(j?dkA%t;SF z{lfE4yWrffM@sGM-uvdw2M_+%_y6cc&%fd+&wbYZho7+izyqKC;76|dn>Wt3CvMJ5 zzwi0aeEE;P|1bXL#;ZT}jGz4BQ_nqnytekuuiSO@-@o;^R1)jC>WW>}S%wwYbYa zkgU-=y5eCAi896d`f>Ucpy&bEc~*cj< zCuI--NCE*06gpm0B1o;e3P6MgTD=wpRRmhubIG*NrPd5}WOa?hw2LC=8%qd__P{Sn zogxU0Cj!Ym6=$pCR^2X zy0&MuM~tvlf)POwHUN#H6A5*|wR+UiaYP8xYm1JB@S2E<(x}(?9iFJ8Oaf~^a~b0w znv%S1jId=Qedp59N~F>}_(RIGPR1oefyvmzqul4?ra3hFfme&MqJ!eAc0*dMd_f7Zh(-GYk9~ z3tOibxa3Et>?ugk`GI3^R&K{#gX4Bc`*5+t09kEYq zwE__Z=)jUL4n_YnR(#w2S*;=oS?`$TRsThvhD=8OSVW?5D0&8;AWVy4-X}O%ZHRfe zq==~Po8#Wtv?et>6U9fg>5Ni=MWIUSWE;oQV`W7 zXL2^9*=#nO%_cK?09Up*M;jMq*~#Mg;0IKLi43%yzM^DAiQ1^=(M# z5JS$v5+-Ce!~;_@mD9b0%DMYW0!UL(TCGU{2&KXz$X2mMa$S;*tY@;CP9~G-bZdR9 z*_`5ZTGLblHbOvMi>eYUVzh=hs+%@~S^F$pdEu^u!N)9IZi{80)5*4!ufJkjmxnY3 z%rcBIks7^oM_tafTEIMcM%j(Zi|yU;t_wc*QgvLVsdm0CSvCigsY7GQuTXUdrY@~F z&s>H~Wj)gm52WoPBjVlM^H#UWgJJ+fOv2M2rvhp}ugczW!;OzT>#?U@aNgH$z0GFQ zIPduUO>Ud-yz%Bs;raVdJRwGV_bs$l%|)WeS7cg)e;MKD?1jILrc03nKxWgp`tY;i?i${(tA~i;V-hOWdk$VncB0Q^%x{y zJHN8XIV*t4k*})Dt>xuJ^Ys{N{e;?osP$1G02t$RMQkfue>Q{dDQ?S&r0wlyyaB5l zI9j1<&j{A)w)7sPx}LR&E#INO@mAG|tzwsQ0J>BM3<0r`$9WyO*S(y8?Re#Q3B8>D zBqQgy{Rl$a&+To$0>M>A4YM~?&6?GX?PgNw*l?3nAZ$Gv$CxLZTS3YP{_6kx#5>=6x2r23Mqnfwde8oO|HA-93gmJqZ0}3k zE#_u$X;|JBu$!S{(R4+abxZBUKty%{0DyP@QxM@`x4VOV14kYsjK|}B`^G{D0NR$- zjA%BS0RT;!nP}7pU2B?+#Y_kxga9(0B<9-s*5|Uz2RY+noENb=1=b=Z$Lps4ky6fP zvz3+A(dz1KI-SmD8x2fn&@>WYa`51+p3U~|-Meq^UUXfit$a!lD$EB!kI~R4}t75xn)i8Q(`)l~MDZy9=J-dkZ?wUTEAE=*F z8wkhLU8J!LP4o9@7o3Yi)Z_6_{@!n>lzKb{fK$#r3x%NAh1pue=>F0^1CypxeM;`W z^){=~#$M7G(s?4|kYm^6Ep+z(fp@}Fow&%+q^B*gs0NEv41VPhx%XX|pUefreJ4!W z?Yyb7^Fy${Msa(tqzdas^JRJfXf+^;km$FRd^I;D`W-vQ6adKjD%_O=~uj(3uOGo&RXOjbrY(YU$W zskxF&numd19Vk^np+3FCehhtpq@Rp-_)rr+d@>$axDLcF)v8U{L?` zL0{ZO1&2`ppiaH-u4kU$a}DaEgVlX|Pd)D(H(hyf@A~2`18~ki$x7Rm_osGoGdp*K zcSG8;$VueY9|F5GHFa!_BfDk_O>*|@nW%|X4wRO^OA zWLl&Nh>BwPHs5-$uZpteUogGbULfxJO`RKG&=yp?uUd;CAQB)2NF;Szmjo2*h&tiQ zR0=r(#HyicJXWX7rYqIV)FMF`jT<|fXUCl}M6=LgG56%~xVjjDJ7WGPi-pM`tPCW8 zMkznoUIL)zC~B`Q)S?k$vTrYr>eYHIN8|OenC%(MYNe`HtIf^L&CM+$IcchitS7Pp zfC^0*16jAY`DC=A#xa;%()2feI|QtrT&5V`7Z7BNl`3~Sa5`(*0ELn?*kLFv$iEz* zS(2`Gm{v;B!*ED@5Zw9-Dk`A`y$@vfMa)d4*k9k3p{%OHS3BuqEv;*Q-`YHYIZthg zg;8jQq_drV!Fd4i$3OMzZ+_*g0Id%GyjQ>CiO>F?Q!h9-R%%!G?m0A_IzRUUz-%&s zPUxk228q1Yp7f{Yp}j0p|L`zc0Xm3Tt@!Ohk?+YM@Fu#y5_E38Mz1N6o~4KLd8Vt# z(!=HMcik&nX|7;2a>zWo{o;%}m5zH)&k9TMKwB)z7w*{fG?TlkQ{F)GXPoIU>pX40 zEC7Jk973Q9NB{{Sqz0f-H`@YM5-ZujtbrMc%~`d&y0S*AN3OtX-I!BnQdb~|%-x5) zm)`Z>M@DhV7waj(j&@o5jHthdM2WOP4mPBynB!Gx+wQ%#z>5=g>+k*9V1A&~AyLJ$&!wQEt& z69n@qN8X4qX;u%mJ)D7LG;L5c)@##v+5MS5ld*@=+1D^OBBxIwop+cjyc3Y>1|u*c zgMxwN>w-q77hg9$jmS1&2Yc9Kf`kXA2cs-mt!4eSj`ZX2sa@X9e=h7h`lyGUdh+JM zL*KgVYc6GX-gq-;eK&xU&pFHedCIwG0l@wDe0|xZ8klTt0zkd80{;BzCls6l-dDo? zT=tJmOjpT$Dm+okzd`}@x=3%p%-OXA)WK-!%R7hEmEc;4gqSrX9W78_W~;6*Xj5lR zv%S47n?@k6uB{z?^wCEhb<~kZ9=UJtzO}Wr@pvpM0RT-i+uq(@UtgbWPo$JmN+M|+ zw#;E!fS|?f-Kc!rORu3L z66Q2!NzmVC(T%ce#C#asv~KK!+cnP(U)`8XaHki+l*pn!e~W-pls))2g=q=YKcqn* z2Rl>uX&1I%#|2}F0|4SzZu$ZMoN~@tRaLpKn%V5B-+$!^r=F}bo_*OxPkHXM0pRA3 zePRLBM6E`bDh=Pb^DY2*(zCw@7bowY_p?9!x_7_%b?t=VsToEy+H}mGk+}7nDp*$ak2IQzMX|= z9G{@~({pFGSNf~pq_-HcX`1cr?WSo^h_$t~{rmSTy>{=uy=!Z0qw%N`6%oy5&Gz=z z`uh6zWV_XANqe6o;RFokYy!*n9M5{rN`u4y#ywbIn+4pK`{bJ z(%ihJVsNFDRaLF5tc=Iws;UGE7rC8ZoZqumdQ;F9M;o@mP2i?T7&q_tURa8$GBpxO z8Vx7(o=ioRp&>bi!?w#ox(qN*{T;w1H4)inT|a_(8LdBb0*ln=e( zO&@#PyMiJgebZY`Ip?hJ{DBu;^!zKP+uLr={2J&`Wjj_a0;gSYJ^xO6sl49zh0&OBZ$^IVPh$M9fhbB_>ZyXDUE96Pr=F{DS=E zN>r~9dBtEUUL*g5rIx0$A#e^vw@aOU73E7J(dC`9n=XY#l(0B`BrIEMZqOrOX*CKE z5RueBL@Q4T#}(nqjK)$*!qEgp`_;f^OpSoqXf|7=L)&<0OGrsl%BB&M8CG>wLxpW5 zE&u`%HUvuj(K8W!BH1PdEp=X}OJ~FvHws~H^fPlrp}Ek4P&x%re|s3z-L!3PLI8;b z0NBPP5a_93#1je7lSbWt282j8%!syEV7jMjCQ?o%2{k;31VW7?dLJIvcZs!QZfKY7 zC2l}%>_OnY_j<{4yVoQAp{Qt4rbtc{=kD>+KfIN%qs_YfO9}?mfF06kI4J<>307po z4kpXzNq2ccKTq!Dy2)3{AYnXPhA*sS3xsSyWJiroTI*Q|o4x>uHB2uh`l47!l}k|B zi29{?m6ibXDX}|lyeY3{nzu_KQ;=D6=T2>`Br$9uTz_e?2Q*=%_;u)v&-Hv`6ygx)_{ZcCi< zPPLQa-T~Hm=YEXA=`QWuG9U83UWifmOhTniBw*X;o}@@9xG7v*syl93V`11bjqJcE zHjH{QoW4Av?Jv(xW1klS2yXUXA&n3jzlG@k$@>e1MTKINJ11SPyk2-={Az()=mvI&g@LdTrsycWdX7? zE_>V+wdyEA=npPPr1s(nbzG}*Fru#5>gQ%6sk)psLIO~$bHWU1dj+R!m4t?72m(n6 z<)YMIZbO0QqYtFMG^X&|BYzUrVL_sxXM)L|GRV_1!Q|w58M=nhbWHMP2n6lrPG!6i z%Zk`YiSne}$qX^w^#yMisBN;hh!~qDrlGUL3Tb28SSq%xUh3CoWod`<9O1F+Q8s&e zP4|S6|0---rWW(L!Pe?6>=5R55l>#Hk6AMszW=r`JxamXKI;V;dc*2VAXI7t#fx!U zB*7{Ax_7-90Dj}jADB+2wGB<0YkHIi}o6Z9YpJbg(5HL5#LHzLhO38i*O zC0yB1`f*Ba4vg{OnQ%k3Sf*Sz8SxEk5so$o0U$I0TB&t*rHKTAP&{z|*69AN(ZVE+d*SH4xVE;owzeiyIF`3U z6#YCV001BWNklTLMSzgG$RS61hW+>%_iB+ zUTboSX0|PEk5gCv94Z}xMgTx0rBu~qJX5s+MT-+a=ksjQQ>Q1 zgHV7*F&sk)TM$3v79Yr4jL%bQmtlnE%!FmqWDq7oOy^;nxrRDu5ldQE(Y%3~u1W3A9cJmVTM4X$T?6Vin@EHUo}3B6uxXb(7bn? z%;n($@z{IgvIud@G%jV@u>H_e$;&Y(aT&-&yoLm58VLbF0stb8a8~0stxREUMkoP^ zu#qqmL_(@75D<_6rCw5m?gHQH3VE`)k?a}Le2Jho-kJ*A+BkEHo4GU6~Qp4X1{bID_9_lu}_E|6F5Jdi+frRAn^oRl7 zF(_PBdLay;Y}Lxki!RtXr8d=Jyi$t*eLm0?qAMq&cY`|BY~Dej|MlK>+=Iba5sg9| zG2Fd8&$HMSL(jgAhMVu6LdrOeI+QAoQVX7^o`Qb?5hc`w^<*;H-kwNkB+XV=S65b6 zYAI`}B2Niy2yR-b4aju#uC6A{B>+>4C?@6)sa^pfBBAeDB6SvyB(~>kb%;WX-KdLh zTT)6bR@5Su0tnk{o*QZ!l2s*ys474KLi4jdcxe=91SD)gf1rT?+#_NsrPj3EdB$KK zMJAv9m!iZFGgmOciBUyEjum*-P)4a8JfAz|UCG-brM4u}*T4R#SCnvCsU4=+4^?VQ z1T`Pa>-MMFkU&p&ayvTJ>BRl$ug@SxwR1G*=qY5T91~~zIXwzW^X0!NHm{5eK4;`x=q2Fd3@VR78c~6KnM4I`?{&HYI17?x zzvO2yz4;P$zh1zZ0S&S>&KYaC1016)#JJntu8+UXMD%Unme! z1UD@Ph;_(u``bHjpy^k=r~WHY)PhvC>WgI5X5->kPRpBY0Km9VX(8P;&Q&V)`8Qbp=U9-IIlFOSPz{WmF+zy zNYX~zqA+;`5W*Ay0Z|ANh(ds%29Ts62WJI96dwX8S)Wt4tfWhHL%+hl{YM~B5D*H& z_A6}UnPa5S=c!A+toNZ+b5*dhuZ-$zxr|+eL?EcWz6$ldzeE5+-5At<92e|iMs>xl zstAEVfRTTmrP6jluUVJQ++RLN#4HUgdUeeb({@&Fu&R}7$Z0&8T2nooDO=bZ6#VN$ z{1y3y-qursYp0d%@UteF9t!;`u8faz=ZBf6q#tm8yngw$zbN!bu>}yELpA7U)IT%# z)T&}Vd z)1Tp1Z+LLe&AJHw=ZxS?ccDWe5xSuWLSIcqfPk$#7O6pMKnOrVs01Pb5Ftt3Z-Od8 z!hS23{kV9b=me%N*A>2|*#~&X0FOR)gtif=h=39V0THzyH)ttUw{o?4{Mn^r1qhJr z-N62eOh)(BF%AHLAdwnH6oK>IX>|D$o#6r_$6U{YNhtsR3%jz10}`!7$&dyI=aL}F z+wt|GOaFMn+>jIklz4WE&R4OIxr7WBjk6^&IL06%%lkdw80vQR@UC>;u8_0P6FbkP zjY#EZ`bGWgjbN~bLns^o0P0}H_b{vBS&&{k_t^ESEY(9%#+^6H`om$QkU93SI5TGn zkWhbvOdL0Kxi%E`h3&RGIKNF{K^EOkfO2w3b>81ec08oUnbwq?IDl8&UltIn%mq`))ZR zZYW@1e`9S!jyM+_8c$U@q+EHa%Z*dW6Em|AiB;B7f887E zQYktI(^d}XO!%&>5WDRF2qb|ZKbuDBcn(YaAtpxUtBdvSODSbD^OV}E zs_VLq8`gRg3L%^?HS(3^1DkbUwRl@y3^m7Kj|PN1<~=T1f{x zD(W9SEf*{vVj}&ySSFL1`I|Yr7Ub-JY_7bQ#@U5tZr0x&s%h*MPWXnHruxD8{E3$s z_=93|fn~}_%VBzXP{%WkO7)TZiq%u2H%fa6(*1R$Mb{?o7O`i}UG&`u=tvEl-BEr~ z&^6bS?_-n1&ISF^`)-uz;CRbyR?Q9T-sMx$yr5;LXS0+ISEo5C4>sJ8VS3e8_y{N~q!@2#;eeXOIOj5s)a-JNmP1#X*>`+1_EVA7 z!RPCCgIVh>$mxtH=V~_`n5;F~0>|&xdqQ+EUn!P;%XxmWVZ@)K#E0ummz~qm6wHiN z5hU0%W!R82)$H_hKgyuK32Snhr~@Q{RO>vl{qg{jM3lm?J35p`rARdji zwiu*PrhrmYB}YmAWi`r+ics-?WMKq>kQAPOZJjOI_HS-`Q&`ikP%S^Uus07lY%e^=-+4DtH7rJe|=w4rC~qpAiE-@g3ck zWtj6|&d*`eqf@Ob*yRXQi~4g2xiq|J4=8Mbfn4C9n{MzXRJTO=B?a3Rx)tUIqYY>5 z_|mmxx#PYZ@Hs;_le;WgnM!t&hx6QAfi({;seX2%;>eRk3j{;}5JJ>Y?cKXq2(dX? z-I}aUr_Im-VLCoo>#{=lK3`vgu$3B-IUC!+@%b; z`S_Ms3Z3y{xrN)pMIE(jzY(h&PGkWjfTB@j>*MVrYL8TAfL?C>!?Pawipu> z3T|?`6fhoNYDtUV=>#<#*M8N zNq`c!CSqd~>rp+bM+7s120-19CJChKTtR5#XhAlWd#cP;;x&uvP+Grz03e-_a5Q>v z=at$yfnRV>WPoCXf7m|wN!;xoA!6A=dxdpCn+ja;oGmU*eo;)L=*w-oaeDme!{8GtfaNu`;A$&wY?S;pTegt9SIkv}5N8Iv1r6Zg(6Ock0}Awwz?XP~kvQ<8iyjJGn&YrbGo2)yI=HQkj`T%-epQ z5gW9bJbr!YrDJEH-I`p?dR|an>05Wn<9mrS_mkl+XtQ-THN5PcvER5V62S6sKwI+m zgPjxv=Ux8PPrT=S>iOss9(LmCr|CC6#QP3Fp^mCF=EJcw)hZag-@^Q7>EJInS{;^B zg7!q}jB0hHpk)90)JnI64tF&oRz#<|yKgtaTf!v(h@;?xXShM zJ2F8VB<;WhN?lI@AG4jto}ut_x}*Sr5JKJiFses;_Uu`o)+>{GHk;07v&r`4;K7+B zLPUYH3TGrqN?ET^wbHgzJC{*YY?;jU7vzU{&f)LwsO1GUI#Ax;VuZ^2v|m~)FPcZ2 z&Dp)$c6FzH^@r$i;~ zD>S~Y9*B|jC*Oq->RBsY7H!)Gt-y8TZM~!2l<)`(DhXql%w!4E=K>WcfQV8`DWzc_ zs{;X;IPSz36jAka`^JU=7@km0UC-1F*hdrN1~(*jY7kv@&40x_xj#IY5ra4qL)s`> zAjEe%wmS)$HI-u=gz})PL=q^35Yzxki2@Nt>xI=ZgXpQSdOQ%IoyDYEuM|);rP}=q z<8kk&2s+wiLW^~hkVq1c5JCviNR*OBqtSRgJ~R=l+hS{rX0v88nH-#LAYxrrwPLVm=WKZZcVi=CntJ*^f%Iz}`3K~6NHD6#)vOd0q zJn?dL=h+po1Z%2fOw z`e6?{_p(c`dFwj>;Ot8;y5-Z?KkD%pkknIp`Etpjb4S3sh}vJwY*h=NvrkGv@i;aY zy?;6gU?4xtn9szdqfI9O6bJxDZ}8WszApK&GnN6EZnE~W1)g!OEZG$M?4OizQ3?Q% z)ZUzm0$NQHiPZh6ttQ$ky9fv%ta^$@&9&Rs7#lWD=&hTq$#GRwH)MhedKW{kT>z9i z?}NERU?LophUgh%T4f||j8NNzS_36PO@*yt3Dn@EX_}^)G&E_q9H_3usIC+sNCA>s zyMsWI5JI3(pW#JP7rqif`{4mXBoOAZDs5!UwJ-&9!M7K^?jj&b5)|_hAi$pSc>fXA zgVZ$J8x7zl?V-tN`w$6~6->wD@o2PXgc4-yMI->J3lktv74kl3qPTQ*H^x4uJHcMMc>fd^?V(Fz4Y{D;MCM-Lac(9#SyRZB7e^xG!V60#2womDee+B>Yfk z$>#bx0Bo(VCrTp#Ot&XrzTt-RFMsMaZ+pj)#~$;@$3EuTcf9+Y%P!tJ6qY*nq!TZ_ z@_DD9f9{dT9oNie_uPKRr~l~#pZUN)ySqOxdCf1LbLqvOc=!9>{@?%1Eh~ihrT_W* zef#(SuV4Q!U;5N_0UcY14z+X^Lm;*~{?$FkFcU!ez;%4CA`uWiy$P zIxBY@fyQNm(1sc6m)QQ#xUu*{(wVMBwW=mfrZjCG5S_3#$~Ol2_*ur|P}RNv&}y|Rwi6JMgjRZifXH0Hs<+CuuhsAyn&3o_mptVIoB&3d?4wXqj(&M~ zl4W~CMx}}74guKh4Wy{S`oAdkh}yfR5Gur4d1^@tq8fz|C`bxu#AIu0YpXfb&>^Xe z0Nk@8_N-Ln@pwh72#^Aaq_RUKN?BnAP$6v#n&?I}1dTFC2!#Zpot&*BzTMa-kK%OG z&B|k~5Ke9&M2XZM_L4%ionUPYRb9*NW)n8IU~L=rZcoI)86h zn*b4zK$soV8yr-wPkE>t_)nPcstK%xf2K8Sx7ye=u6_Qi zUUAIBAO4spK3+D>mp*l!5aIEZQ_eo?M}F-;jaOHGfz4D%rh=H z|L_0XADV2ReDC|ux%A@mFTd(gb-R+v0pI-$GJ_Ow;N1P+A4<9hPWURxU}wcTWaQ%8{$}m1M~@TbBYmKGi)}S zHBGayUMv#0C^us5d7-yW@nmMl4m|x_=d~?3fv8rT?*dKFw5_&($DMs zi-F8RF$^9c>yKnNT-Fa9m~L+$y#M}00Bc+D3)g;xx@cGR{p>m0c zFZj7vj#pPd_=dmx$lw3tY&r#ivoE>m#sB^n&cFPrpSkKow_NubmGjHj-*EpuU*G@m z6VANo$v1rXqekqWfB91Z;D(P}Et>`+aOo`fxyFgz_fNFB6aGcZi!7Ul52o(+fj>F! zmg?it$sUE)NWs!wtz=x4A6QLxF$&wC}q zWxLer-3F?%_Px?;P#^-ycI(@C3x!bLJFPLOtGXOlI3ju-+M+aiQj#TIS{&mS(dp0s zpS?GYwl1j(1ow_O=id9iFXw?lDnY20d6L0QP$maTrR^3h6`UHRu&Nzc-NkbCvP$V* z(yN!fdbO5V*0Nb@*W_wvU8vBaj0q)RLS{;t%*t3~W|PA=yzkw6&pEOCN6h1ibBFg{ zLT-}poqJBijvWy@BKF>~V+Uape?^5SrB3Fj@F|hVXKM0vMcqvHbCS2v1U-^ZItYbq z+`jLZ%jKm@{n24J48tJA64{z@>66+I-I3@y)yW_9kf9u=d`OFu8>py(@Q$BUu zZHDYy-u9Q@_9H*|jBowskKFuTwWruLPkhde0Pr{OzByTiJ3sT8H+=0H6T1Z;k{EfJwoq>qOTLvsp8r&j9W1qzE!r zsFLAOp9#|kmejl@bh8oyS+@so+IEec$?>bi=uC{Mn4xR#c^L1-U_|6mm4Uz)utL>` zfo4+MJIcdDCKv#qX~hB<}jK1y11Oq>FK&nNd4K)p$FI4m^09g09 z8rY@7;nJmkJAYZ-sz?2OJH2syqkn~Ya=001BWNkl3ZCo$B=@F`=Mlwk_G@;p4D>Feqkivi`|3bm`+@7Jfc9zJsO z`*_nFUA%bVzWZ`%F1z}wr@ip`*FOAVP20*h*FW+Gh*aUj`_FysgSR~KIX8a&H^1=R zzxxLO@YLsj69D|pdv4xwZTD{vr`;_ktMG^EOrRvWncFl?t9#G_x+nv4Pq^pk zMbs)c`RQx7X}AOyx(!yC>CQS^O(>C&b70h@EKLqs_t&&&xhUvkI_`85JXp2$F- z!3pu0oy?edKaOHbUyi9}HleW$rpy>7xEiRS1<*8{cq6@-1huO*Ngvb20b86okiOAk zKpIfpJ=+gm-xE>a_o5XRZJ_UrPaV5qW#8dJdbl&rVLqRq6|Hoon71@*g*0@tmbVMG zS}vEXRo64oqY$F&y7gKtm!fH!rfK}JTH_tM4IAzYj8wjBb7j%{Vnle)f32N-9Wnwc z+~1>kj=8%|9e0#qBY*CV{cdwNz?Jiul6KOzr*Zr`&=i_xGwop$Q4Hbm+`0Gt@tb{# z+k1ZYcf9!9U-cvHd|rd^mOuZCCqC!KXMD?x-u-)j(9Y+Nd-gK{;P!XFS0c?q(jYj+ z*NwKG2eWEY`DLIOXSA7ok-v`YuC5i)#L^fI49I64`fy8Cf16KDhCea~(6-0+q`3jmC<)ryFS zGd7>iF2DTX%B#5SA<+X3xLht*tJS5Wqd^EI)Cw!q>Vs)vkx@l3{^%XEE;K{xI}wn& zo{j-B0BO?4`Mf>L*nB>p&*vOFhHEL*&K9$SzCC~80uc!S96(xg*Xw?@>Jb-h+mOo$ zMJp?6vM`qR5=nOqr$oc``!UhK{?}@)Z%Xx&qWc5G;<-aArv^HxTPZe>skXP*y10TO zo#*kW>UnEGIMq+5Yj5o3%0H+=dSxIZByDz-Y65Z5&xb$yYrpHCy+#bfAHDHc?|AC=K8F`Jxpfrzu&9L_G5tJP|`T&(~uP{TQI znzo^)9b{t>0&!t|8J({41$n2hojq&MWJFBu$j3L?LV9hrTp6y$3S**pbW;R4D<{4D zGOv5e7y0b!9rLrt%fWDSOsQJ-Ktve2^|~KctMz)lnzeY{)oeazvl*YwdoI140f`X+ zuz5dkhJzV)XPbr-=c{=GC=hkHVZp2xS7S_>x(}3DKRJMQ>;(WA5Cvm2o6*^3;G7!P zaRMetnUi6~_!?v^RMvysoa^shMY}(>|o+oI7HGya^BlrY11vo z<2W-=EW>EiMfZb|<#-AdM1S-RC@FaSP2T_jx4-K>x4z?Dm6Y7_mv8^pAAH3VpL^4p zD=r6s+u!}3?PwkOvNu4-fLW0?0nxTvoM7Ar>0H76 zR;v~C9keaZW*im+ZyE{L_mE(1L^pqPTl?K#Mg~5 zG_6OmmK~n)+qzngQ8X(tw45d9e34rMjeM`A2v6K1lUMTXFo^ZCU$0iH)#}U{e&&j1 zHe>TS6T=|HfXEmiB4I;wGr3Ybh(QcJV+~RxWmus)$#^0tPDTPYZEJYyyu>9>5&%FC z&`U{t#zn&jpa%dxG@M##*I_s`*dLrhJlo7#j*MTVu3vXuhlfYl&iNTwFcKVBN}xBo zgKFoHxWsIRn#V@#;>1#jhyBi`=N*YbqsE<)BSsp>P9*KPtP>I7r|&{7wr#sz= zP05-yi~K|yGOL^WI*baCvm4~?3E84^cw$JHQpQuIFk?xmmAle$Bi6@N*%ize3jm1S zZ69*OKgebI@L#^;n_vEYk9@-8=ZggqedOl%?U%%_B0y(h%G=DymG+cOAiWMa=juj} zteCx1?y5ei>VOu(QY*@i{qD5Dh=@QalmdZ7@&FPb0145H9sr04S;w1>G0r)+(x(!Q zBI{Rpy2}!car;}zZo&ZH)jH$I#i90K>oV1Ux28lBn9A9kb5Q8EQWO#A&3xWAO*5a* zXD!WU#5q$TU-iuyM$ItwL1c`FQjV@r#7tA!zgFulVmEb{3Xaj^9EGNB+p}j6`o3SU zSBQPrb;hA0viy%w6L0sawPsUU^`zyUS_t&_LMqLdnG{=_Be$BnDE0Fg`oOPtIJ+eq zD>;Mj15VV;AG&hc3wL&Kk$XJ>yNuGXDQKZKBRi+H=S+;%{lT4|`78iD?%B_J=WqYs z(D$b^%A-Aj*As44`TQL>ERdjbh;U|ISI^)muoL;nbWa; z5aqEFQ-Cpv1%g8gVN`|Sgol%vuExTMihdC z7>H;X2FClQ?VAP|Ly*^5*np!Zv--y;)AlgBZ$KJ1owQy+i9{=flY-9$y6+vc^r*?o zp(ku*9jI)AJX_w5^h-3f5)m4Mp?9x678ii8M=jL9ss*$iiA*Xz~M(Gd+w zsFjTCENOPpm@b?rY$#zB3P+sMY_^@KvC%@ekpo^N$+Efjp^H(ezGc0~6E zT)HdRT!^X|`;*MT*&{2lpb<{(yMyd{lFwnh+58#4=u^A#h}t!$eB{0F`^NA7Zyx%n zNB-m+|Id%#@?k`L#Mk{-*Z+e@y!AK#-OFD46S-WsyzMWZaML$HGVVdS)_J}2F;96i z0NnefJ3sm1+ssP}GmKWgUa^gBq7;2~pwRNJbQ^@s`)=Y$VQvuY_8>^?UVKhMSeZoOUKZR3_=LecQEuI1PLJk7=XON0eC~4L(}l4 zX#fSnpu{UgbtMUUeWImGBi1K0qqr$O6J`8{yf-mKld;Q?Neh3diG?v4l*!8`!l2Le zy~Cu%J}@l`#vK7w$0H%E_1(|HqYa$`RSL3zsi?eic7jvgHwSCV)Bs!Sobi2&$Ya z9L+Y=l~SoGp|m((?K66Rb_?4rZhD%i!Ab6)+|jJQPJy!e0wj!i6UR9xrp~6{K%%9%WBth`y}F^%HY@QfG+BqUEFeHW@Q#ye zG|6~r!BFrqHm)y0t;KPSD1_`KPi~s=BklU<(D%RjFJJ#HKlq9#-1zL9Uh*A>=gxil z_K*D08-MkRYp*F3aqi3a06@R)KKfT52oR2(PYfqSRhP@Jx#rqOd<_76;H`f?g})~m zRXjeGZxGFbIkJ_2V9y#AOLPp8@)rrA?RD<8jHuEefVut1H$x<+5*;?kDI-XW2v$Dv zCP?jCn!uW=jDtEi<=5egQtC+p$(>Lsk;eJy($7rHT7tp1q}nuyjO5vJHYlMMfq_8m z=Zk?i*fgB;cD-J$R{hZt9325eLN+kQ4;D-dMt}e`h`t+^OSW9$(2IWPff@pa2n=C1 zgZZ2mbI#cuaZOByZ9)PNh9P9gS~RR-BeJ2qufU%?l@ya;+f3Wa)YiGzUwi%cQPeO> z^jx5|gqB_ZFX=RnBrI7G!BaZ`l-LOXAmafm+6Tb3#%4P*JYc8Iwn@E?z=`Rhj+Yre z(Nt7PJu;!4!<`G<=UG^t{N+K;(K8?GH`~|3TwHTNh`NI!|W5(OO_${|Ak1mZ9T>;We+pSi&zT=%cL0Ad3A*a;8nGHvE029YG z8jCfe@J%|#?O5#F@rfDB))zY`jt;6*&+%rN-t9sfEgM>?Gkz3|2oBDi0p1=g4p2`d zY30$Gb2g8P<5D--x;D84^G_i~j)r(MYge`29?8xi9L#~8xYjgyQczD>QawK@&<-2& zIsRIyK8)e_#D`N-^=Z(+Mx<{LiS3y2Bj8h?|2zP={oR|~xsZg%JoPCO;qvg3Ka>l4 z!^r!rp|gai@FCdpv_w)=7@5yR;IBytK(1U1fn{w>gY`6KD795+VNKU8yE+>@Ko(6(zP{ZQC|Y!+ATKwdXIKUmh*Hu3N2# z*=%NnTCQL|n=QJ&>$|@1p&w8j9j%9<@7DlJL~J;pF>G4xILZ)_fjpU}{85xlD;a?? z9q^0Dm1(sfu(zy*jUNgLwuYG&C<_!7GIaK(%eM(0#(-~A{u8d!=#%Ohd23lJ%34UD z#1S44$+u5Jg$TBOj5v$##w<#nCL%ZJ-q1-`% zGGr1%NyiN1Oym}2KkdS zU=5sI0HcO+(f32s7`=l~io@6;6HOyHr)FS-;D`tex~}Q^`MSpom-@EnvyMyaEa$}e zz}4+g1ELT_L;|%Ff-qigmfamk>>LEDjq^IEO?dCIxL)QVGjh;qcGe~h-c%Z8)O}>H z8b<4>p_X%p6P*1HBOj7)+P3`fEgshKf%KP}dKaXtxOu)JPgB6BQ=jJqY`Sig_IJeLXeJZiJ~5f=bf2 zRa+8*K1KiJMEqz5&dIb}5}BL<0`WVSaiYPz@m81++h#gVZLXb$?F}(J?FG*RfdBly zzZ&{JmnMrU>;MFSYaaU0E3d!qGk1LSOP~F$U9vW?`B!{1#KP3cjRZ=+6_U&^w`!Dk`xNWaa=}Y(blJgF4u}g*uUQ5rd1z zK5OR=+1jZ4#snZhU_dkw^|D7Aj>r%fFl*Y?dcEof5@ZE0L}Y-_p;$F7GGu~UwV#hb z$UDJTJuSPg>9AclLI@(7wPM!d!2xgh0Co zKRpED=)CV9GOy+~O<3_#L+r-zDbG1PfaR@?A+KA+tx;hZECD9wlb!f-WEPLSayx=; zi_f`S`D~N9j`RwgHsNfqoaDepC&(wMLlh=<9HdjpU;onYJt46##HeM|>U z<(LSrc#{?aTtnc-xC;g<2P;3bkeY4mY`N zYphuag!1@1G9;l-)5}&zQW7H#1cOpEs6lGw-E6%WdNH(ZJ8Nfv0$c%FyZH-h31-s2 z_Gn2*OOXD!jB#X2aA_N88<VO&Ea^TCZ_9@&Hb6O$~ zI~8gRrI^W=V#-R}(9T602xxZhj1Y?e0!cVlc_X{33omrJu236m1{(;qX-h2vkX5uO zE7UejTWSUN#Cj>P3qT#a0hus?I)IoUW&+k?+yTX{{M2yI3bn3b9L>a3Ttre6+9>2x zq3+%qp*E#yq;pMEPKuz~WCyEaf>dWGue=syM8x`@N(!~xfF?aB)HW{8>7#<2 zzjc~s^r~8@ja@QK{nS4;;^R0eJB5r;Tic3J`bwcTc~Gp}hn19+L7St}c&4jHJM6E} zX0Sb!)rv_NVi?6)I&-7`AfgaL5HUn#DnyhNWf&sUa!r_1KGq%E$m#M4GIyhkmlo0J zAZ)!SVxk7o0jfMzfqBa2N9ol{NJPSVswtTfNqP@B^Od}$jbk%&F(F950mhJ_=`{kP zwrOTQA-b-k1IFal4vZPcN)`Ca2O6z>h{={n&Wa@P(&RTzD1can)l;zR%iE0QlR8l$(r6>Sz1<8=3Cd2 zltq^k`Un9tvNr`!s2+D?t4M<@l9%pF@a?Us$4pt_xHAczvK;xAKt>5wW@GQry9+l9LRfLp*)PiW{etNW)Z`vShF+9pxzXI-A{*AW!W!>pMv8`l^9BKI7!D->kJ>7nF4vpO=or-0aABxJ`9RG$ zmT_k@GXTbOMF6BI3@)P1=GYDIWY?1Mv6K6XnPlWW+de|=uuAH^j1vo5mp}y30?l;( zjMY2?iA4?>kh2=@A zEJJ#o%pePz;d^uX^n~B_mVZ8qYL(00>|FH&oH|uadxd>dCcxUoDwh^ zZQN>VhARw`uLceVl(LOSX%fTEM}CE)ho8V~($NS{ z#2+#L$w3bqd%Tncre7i&27!o-q4d<$OOx82cb&AnAf0M9@aT|pdLjb3RVya>~ zb-RI5y#%`R1_2>5#uy1{xz!S_Q{C*riE&y_%Gd&0e+w;|SU1=0m$b57ZQrGjm}3n0 z9velQK+ua){>jR<$y^f(OUVW`M+_l%6Y&Tk@#;3!vn4vZ=;26lAkf+{*7H1v<~4lrjI{~I{`MB zuG1T&oIruJR_RK#5H4c{-NlB(y$>IbSTKECfOb zAp~O#xe2qcsB(P~GDfHrJEbZaW-h8x6&6+t`KcePc{@XNQQ1Z(Bcc^_h^)`06@-*j zp@dE%4q~SB3Wh?8lYnc&P8}0NiAUPWkTDdxcMznp7lDWbS;qz~)FLO&fgvFqh4 zFhqvXayql%M@NgJ8{OGf?#RhAGW$gQC-%GgE;4R*mVw}Hde&4_@hz8=--J=35q z*V{BA<o9({ zSv;Gu6l$Hi=wQg?$1Gq#Ty+iuU{b#!2EdU4$b*f&^YZIOu-$Te@9a*L;-v@47 z@#?VE_!^ZLGdGH%^Y5P2!eAO7EoD8lFzqV0yQB!uX@b+_*1;Vs69Gg7Vsyk|U|X(a(lqP0i;Kxj8Gb<=H-!5G{P zNUN{DQL1U0#e&N?xNXD8MC~RL!uZf)Z7esLJhE~r$6zT{Y72pRuMH2((m%FLEQ8TA zpSoVJk1qAn6@+tWILzj=`F!5apyf)G&_agxcoru3KQP8*SE9D_NtTmNwhZk(0ZuJ} z^d%1xnzrHXTny4qKL82&Ss_vp!}Ni|ti3vPMDRNUP3cyyHSOjo_6bg?=zq_rd@QRU zF|VGVmENCWGwlMB{t}m4S)7X?ePAI;PQbuvpL?e(-68014cXfzoSt$GAUlA7QO3sm z_F=q?VbIiVV(u!A46;o9vieIxg)e;-7>V0QvbO9TXuPEd)Nn{!}i1?5p1bXuO%%Sz0#N zCjFpHxs9Q4-%oA{=GQPAi7<>e#H7US8(6K9V04-B zkp3PXa{g~tPUARdck@gZ)?kATFyIXWz`9@0*o-3w9b(E4lq+Ru^(5UcwWERz*v~k3 z!mzuwasBpm#q2O}M$csZrW&G&UJ)bZD}Q%{DU*uh`5E!2E3=wZL@?-PCg0^irgQs8 zffnb8r#gqiv zgx}xM+i`l_;fWBs=c>x;`7k#h1qF}RHA|l(2c)>%{xWl^XG(An45PKWJ-VNRjr(-t{ronXb6MoF;49B{8(MGQ)kd_88kVW*uK~1g^$g=AhUi5Z=tfDrr=F1j?5RhL96+ln48|)vvrqXgqyzo zAHC$&ul&L%KlOh(HL~&;n*V$1Pf`eW>yw2Mg;Ax6)<(4JsKj7oQBxb;R*WO#4R3H5 z_d1Bsro5zZ$W;l*$v$|lj zr{^$hh}|y-$9P6fjm6eBky|F%<9w+$+3N`_TCixC*U578ja9#!1pv{uWNC03!ich^ zR5+SyX*x@1l{{l*a!16@C98v2!t`hRFkL;yallA4sm$jk^))*uP2w?y%Z$#DXQN}i zsAPd~f31?{8Yl?-VGKx~iSeD+@jGFmiGZcdhhc z)L1nEgmfm>o!t;5MONFwF~Q1`syyXXR4C3F=S|xR&N=$igqAwx0)faBa?Uv-XKWY- zHVm{pI_jHd-F2KHdO$(X;q2f zD@ucy=i(w0lU|1zV+c5#HJoAFw)6RXwdz-^VHgGgXc~~Rt0I+%h=hzbED#wob-LYO zSIab$GkS{_m>MPPfd(T?mX)2d>3tn@;=ta?u5pdufX5;i#K>a}5 z#AN^h0GfTA{&8?-kxOB!TdjWSCtn+U`k|lspC0>+XFz#UPFiuIulh$pXT&IpQ*5m^ ztmIm27C@zlYCX~zJ>9#x1DPsaSl;jvRmJ?l(5K4CxLS+_BB5e5DQS{122CS~TE@82 z%ZzQ;k=*rpBp@QrdDAGN_R^*0a=B!jbIxb8c0O-a)LUb#AVLHw5R+r`)MxiK!P(|d zcT(l~=xmEQ{U7UNMJ?3*62eT(gZ0t@)(-Xrl3Ss#(2{J=S)}EX%Hpv zDEU*0$3#S802GX4)3BzM?wuq=zg!MY({Rq4hVe#j!OH^4Z6W|*%9+nJ%kC$@Xe$LQ z=aB3volyH5II-Uo!!$bOV@%Pu5cRK=>CI{#p;V2kH4G91sBP8(00;&_1G1hsVm_bG z=kun4hU=|Z5(H8?VVnbFQZ*8q3ji|?rcu2VwWR8<|4xNXmzP9IP6HE`QpRQO(W0^u zQlo!O$ucI_R#1}Z`bs5v0_;Nh$bCug#f?eXlUqEg_)V&pc3(=8b_(U$w6?GVyv||^ z0Q(q-r?554a2oWPN)n8^80n1&fv>^tCz2FQXP^BFwaddx=3j86*!Td!sJ-p=zx5y5 z`TT!>^=l5#Uodml3%=*2-}3VBd;eSB`j-Fu-y0+88-DlyIl6f97he5i&wJ^A`^*=; z@QQ1%y>RcnAAa|{-}8rmC^v9TsQ`HP$}3;+(w9E&na{Z5+G~ftzw2|K|IpjtaqBzZ zkv#W+2+K={0I)nf^r_R`YlUDf6k4ZDoxqJ(8X|Fvqv%r!OtT3B5&#StGNNG^1R?{b z9alj~^Uiq!c^42!!3YthffejTkNP?(CF^Jz42gswd1wiFi|wE;4j6`h7*rsI#bU;r znLbZV0K&6WOJPnR=)))kB5yWND!~)E-dH8Ir4#f8v{tBAq)IYaT&_K6l_@}@LX*MI zkJ`@|RRmc8L=-?m49a#307yi=5IthwwBq1QbNS^5h$O=pAfO;&4@n>y)2%6w!m;qhdUbzSs;3Z4&ql6d1d1DM=|= z5GeD0iiwp@laVJoW2;DgDN(CUPUT*l*k4($*{a`TJM=U;pk@Sw?k?L38a1NIW5+7b<*KdItIAt9EMcsK@Bit3%5l(D=`|6Tj@3{xv}95%#{UE2r^L-oYexA zw52^Bl!HHM%knX*vziHyw^Uoa`-7Zg7pN5s)kuu92Ac&SZ)WrP3_!M*yb{Y^>gCUh z+Wc+{n_#gr9aLiz-4mQpubcpsBv*GsYJX0Yj)pl+jV_{0cHa&RcN?%pUh#ZjgVV~M znsgjh+l2{sCv=_$6X z8za&dCZo<{E@c@I5oNqmLBlX~T}MKQrfC5n>-EO0WIE?3}aF=6rJEWCnN5%C-A5qsIa<*^S=3EI~~goesc> zfp_O;KKq6r`jIGAsOKqLQ?SsZ`4CyQYz#%=zftKJ=kNK$Kk8OX`Sr_R{Nn95zvo%s z`fXqL^rwCHqj$(O^MixOe*Mz{;P-#|jpy#UPttwI`#<>JN8RwkfBZd9dd_n``oRxI zySH%XXaD{UKm5Z1{fX8IrbuK?j4gcueV8T0;Z}GQ+}uO}z>rbHo3@>aVOXtJLJ$#2 zKUarLG-8q!U!8jp!aYn>mO}ZJK#(B4UoYiF&={y`IpcHA86ts-)&5cT^8-`3fB>BW`Sry?litJ1B zGE&vn#t|4rplOhr=7g?|EL66)QW(-T$U`7YBor(MC51^7%ltOW>}Gj)v*H(vn1Flg zDGkFQI8tI%{IqgTsaRp^UYZrc#;&PLDi*qrYKskRXCB(C#HKJm@XeG7II%kIN1~gg z8&=jmlPu(HCmhpc7?qoyTPwqysmF2HxZmT9O?BxNX~G-KgEvLo%F8fP9?Vz!LI4_} zRtsS$0z<>ypZ}cMjYXg@fANa|aM@K?nM7A!do40{;lBIM-E*%hmjD1h|A|imz}44Z zukfe!@SH?zq%1Amp+Cn-=_!=ab!IyP5bCWpIjB_x4 zAV!}sS4U{Y4rQp;sD^+_C`3ddggvs)P>%$XZQjlpV~vbA1)$?Ccp@_rAqjc$mJz?k zWUxS-k|Qw1Y02huO-Q7LMa5S@QSU^{lfw_b(~>96X{Thbds7;k79WXJj9#X)kkkZ# z$Oxv|%8okLz3UU=k2TVX2*dU?Vlzfn)zvjNMLRD>DyTu@u}CEHMl$9`lh;PmY~hIbwMt8rF7Bfd3{zl(LxFiD zMK}TJueMz#dC+F_Z-t@`zX$QuUrb(I*fyE-C~M>~_c5P79(|~m#u5BubJ5N_&yR$V zg%O|HiGJ8|<=i)E(O_pwkKZ@z<Ycr%%0HVO#=W2XV1R!^*?J95*%E1#(eet zboZ)!?-+;xkr0tFHk-{=bS;Fg@B6-=&1UVa1@Oc!)PfU0EHkA+3#m#VBfW@eaao3m zh;%s>C>Mx?I-WLud-2Wy_035^<&+YJ>QdO9hgB+3q^?QQaVb!li`>(bszHfdOOhnA zutKLcRdc$TeP8MwTY(C~xOf}m@qa#$n`HO!Kw6F_!dIjTx(E*p zf7v9Q(5Ni1e>3XsQFH5F4N%Et%Uzwv8p$m1PTIguWYWc%17lh&`C_iGV9?f4`NvuT zv-*bT9f$}51PIljq-ZdHy)s&w$z^()h=d?{d`%m3O$E}$`WF@i=EsqCcEj{o*8_(x z0DbsMw*%l<3H$8iT^|I|VyE12mw@$DGQqv>+DFL;~cPZ#WkLK8peScw=F$KZH-q+;k>OKnCg zrr^`&sjT$51W&`KM~^O>o9Ztnrs`Q4(8QhgDPe}07BPy44HN< z^=yPm{OHylRWT|K7Xo8k+Fm6V(o!R#K(nud2&A1n0R%~RS_*E33pKC|!%^}v4}Sju zD1p^kgvpqiJ!2_AU`HMu4c6y4bv`giY9#=s;{Mu=A7^91T<4~2x*563d^Z(SL&zA> zO+o|!??zw4G35TrRB)sj4EM*WrmlUOUxF8U;72O=zUSAvO$D?2F$Td5k=+6<78AY6 z%lzq*>+zT0Zy4WwtQ5~Jt48z>@$6;=E0wSrxIp)(}Akk!_kLmTHn%37yGTNw@?ch#2FHF)lB9&}MW3lrehANVHO4Ar*%TiD(eA znd~iPQGFeDDUj$TuMi}dm1MPYCEX$9GXg_2Lah!&7PV6P*fRlvjw9hUR{btmSu=0b^>fZ`M*xh9^&kGbRH@mf2#0xvsWiO>Xh4PcRkU_a}b>0N?q_S3cp{ z&z5hlf5anR@w(SFv)SMO?cd&a_ub$$-zPrwApm&s5B$KD*Ig$QKka$n^tfj}lZZZX z>#d4F&on-=0IiOWK6(3X0PsCO@l)47;t}%Y!yoIpY~Lo$~+f^J1R zrR9a<&v(80M}Pize(UFd=eHjF^ryKZqMO%2vNJ#(xD?H-VeX>3CBr7IoRL8$(5psP1BRd;BwtANpsarEp3mF8!wGRR;tO}X*BER;yimC5ffq- zpcJ0O#9|mDpgFyeJ}`AN3=P`h_oyH08ELZA6P6VA@6^$ z@fmNIByFvR$J4C)^El<&dT7cvWOrFjsDm*$ct+LSJ3jD%oB#NapZDG0{qonnZoOO% zeSdJ-WdLyD-h2P(*M7|+K?I_k-~8q$-gx6fAN8nz{;z-K+&%X!4h|M)&jP^BZ~o(Z z?))zR0KPvLF(S3~s`sl@8hc{x&;IRie$AsF^Uy~<>ZgA3mk!ULXN*Y#K5^@$Yv%Sqn61 z-&|cGul9ELPOa*eX5Bbp3uE-;o=GGCLLkOC@Mg7KtyZgcMza}fnx<_Uz+NMa(VA8x zrvTSDjZUfP)8RC=ZXLy~nA`%?c?b}7VjpXr%#~z6>x6BFhtE~vV2jR>NupIHiQA4S zOHV5N-Z&|K`Kcd;6S7H^dTGdK3g&0|D%o=h>ePoVxV`|Jl{A(j-W*8hN;cRgBKbJh zN%+E99qTSTC_^%TiPo`tBz44zI5L=%QlGc_$3wZce?hZYVUT63M*h!C;wBtMd8ss- zSQ8Kn6p1uW5r6U9zx{WA`?oK6*~`A>(T|=j7WaJVOCP)CmYd)F=1UhYxI0MzaCCV1 zrl0-U7rg9ckAK#)uDb5JzUw~siBEjsZU67>?|Y9ckXf1;5R#Doh3e>%mR~gDd+xsL zSAXWGU+~>8d+gUg#Rcw8st!(5s zHUYrpS6_4O!ygU+ANY&6>1g?Gnkr^P@6qoIBV`1)tp)R>r{9wIzKVtfcgQv{Vwk=A z)=U8mWt3ZTPA8eBGn6xi$eAE6s2O^(UatUIJDU>-9WfW((oqS^p4cio*J76*6n-6) zJ3CrIQu2bdF{^tI5Eyb~ZQrjB4_AwU0ksI&HZ2e#4xqdPWFZEP-snK#UH@Sky=KDI zOEcNupf&@{Wa@dzkyDFcW-yAm-y`nKlNB^c6pp*ugPr!T4eOlDk$9I9@`9BftNmz04y3sG-D0E6 znPQ@;%WA#0s8RfB5+g)gL0P}fl9l9YcVR@*p*GN*eWoOa%_s#kx#?a=6CQPNeF60? zoZcSH&(w}?nP(z@iJ0mMWtTbAKDl)@K>Ksw|NX@T;m&6K$)~dF(%o``9CDLi<vF z=pDLp1P+eCQwL;(qaKqpP7y$5mQQl$od|`{{)=WIApjfzdn446r9mAOd)hZW?|XjY zC%e_^|M>AAUtT)gOsIA19CDF!Xy4AW=%(KcM)XNku_4T=D=oEwC}V_LOO+Y3&QC!EGiwr!gh+g3I?a}s;YloVcT>R?BKZ8BkKMq~&~3EiRvnq9bX;lhOr zoHv{|XU?2CbLI@P4q2!CDUbjKD)w`PS`f~BmkW82-3p545j5$o$_rvwH%0iZ zQ0o^;`Aq}OPry>bcqj_l(min_;)ECixjM_Lp01X}KVDWE-LzBzV)CTLvG5i?rpk2V z2YrHem>|@SuZc-ZRq)2ol+a5cGb<(YPX%v)PgG{iP{~s;!YPg=7j^nzhRR{ni#r9I za0y|?6%@(>Zpfb=y0Nvm{5e_J?u6Q@g;&9-P^Ydlqn z@}m!cQ(5#aNgIo^BiT1Fgqf*d``udMBv@34NP4oa*Xx6W8Rs+US*o*m$GY6%Cy@rE zMG{#-lq9cr0U2XW(+EN9^?E*^ld?8T?y@{8jrXqB8{Vh0juP$6#&KS|keHt)YiAL1IZNOspXfQLXf1%DkYuWl$jAr%Y#0nfyS9CSFU1VlOZ>$;*=W-Jo8gAO+CcP6YY~yp2vmS z1ma!KKX!anU`CxmOB>8A^xCya$`^nPRP0YrBy_f`v}6o`3{d_9Fc9=oRwQJ|xh@EW zl6mEhWIPe0{tq7Wq$dNw2j2EJazEv8H-ET%A5ALIHn3K4hPahYJ};6--8q*u3O@=PNZ+BP18l^F{# z&9wk3y3SeNVk2S_$v))SI#%1JWOsPlxq0%QdPLu*{g{M3H0@{&M_nd&3mA<^bUP%K z9su%EelS~6YFsDnC@J|WB*W2-+=Vit1--(06+yr((aAgs;5n`U>Obpw5%(mgaSiE#+ZOXz(7QT zfMKKKUXc*eEUGmdl!wl=V4+YW0DFtcy8r+n07*naR9^Fthg^Bxb)WgzNALXn=X7~a zy|i0uv6|#Q>5E+hM5%08lS&qj-mhwKG;}kF)vp9gBLaZ{eT#wR1C<9EYZ&7k<`NU) za(U@!xtf7&edMT|ngj_?rbVToq*RL{AQ;U@amXN~skrZG7=#pH2SFsjMzKYRW^*gN zBDm&bvwe?Vqa3@ed+cH1vCBFO#h)Ho|_`TlUh^zS_+%`XIrjg53csqC>Z7SGNp zYk|8fG7(Z4+;`LENz+L&e)}UF*TvPnHkjzvvO!>8QYS5qa_{J6<&0B^F;$XbLQV2fKF-$n`>ySs27>p#Nb1wL%%Z4nx+9U z2m$M^yKw&e{0z|=G)L&(v<>}Z@7vKYHzTW{fW7Fvd3TDo7 zmd)ib)d)-YP88}iIw;9TxVxxYzEZYZax6b)o7k9KrHE@ntGb@JLI@{xC@Mi&Z5rhE z8%8UkpezDSMCRn$i+bf2m_9b7B(>N*Izkcq!5Y1zoy}&m#*k@*TJ$^2HDw3hpQEdR z(RFcq9)pzA!5m%; zMfsd@%n(2cqg;TwEN5grh#lobLn2M(0gDa2^D9Obx`xtt6z5JfV4-D`#<3Fp@t{zD zO9ydWZYo)!3N4)Vw9e(2Dm|&g;)(eonK;>9+iNnrQ$3Up?ype#N90pG4X1svOSx*S z@Np$$Li&wVbG2x1X66eGkMU%doDc0U*ARtvX3i2*DU_i5CP=Um;`;Q3E(*7gYKqxx z?9}h(ZBdfHp8B1p164HE2A4Fd<@j9I+y#xjwKH5M#+sg`r-h+jp5v3EyO zkU;y?1S^nX=*YsYf2B6QeMud{inu*yKWr#BOaPZaXur=^or8)4#izcqxUp`kfH-|= zGB1tx9mzeDdSG(oR_QP3)&lckrqZ+p+%}qi0&UaqDd`iG=#tf3CP;L4I&;bLe^nz( zXBlae1V0vj71KIDJieVw!8TyRywsTGrWU=q*p-LPtDix>%l0e;wA&SI;dNc6O>%;D zKZuvQv^5}!YeZ2<0J=%?dTM0RB1ApE5D_sVu5E{$h#P4g5l9FUf>5AxLC~U%w%D4< z)9eQk0TCn8j+`if4f2^#5cS9yG6n=djN}e7A==PRc2)J{N_~k#qE+fce z-B9RAVs{`o>4uK&hjfRL(T825i&SVWU!l2UnquY3_4#vcRIWKnS}Uondd0?UeS8o| z5D-I#h>U~ut474O<^3Rfu|8V%gW&zZks0SLH&mIetU0z7xUD7yDbHF)ZlxjQlXz5m zBZXp{RveT*YMmrwIGt#IZsI*(QPvgWz-n#J3BWVCheZF>$8U&k&bQmXlASJ)B&LWpK};c+Xi=t>B5H?(x^s?og^M)fs5@cd%c=NWaY3&Ba@u0oIXoEtx zq;rA=?LjawIl{oc;aE1i?K!_{M%_r_J07rB4+)!&c=G;eIH?h}?`7gasDW4|d=Rz) zE7We&m^rPn;2*X*X4k2f5D z8NmysJZ0>H;7H0u07yD2RQgl|Ia7wDGoIz^tl>`blFsTB7Q87z&HU;aXJrafdO_$v z6k<^}QE3DPfKh)W+~P$Mh^xGjZw&zPOeYYR_~gp5s!Hdx_oOqe5xoMO<1t(ZUkY8r%9|H zX}3*W5|h*QE+B=fc#5}f?W-uRESm4e#5UQ>WZXr6W4&_X{6AU@20v1veiB4f6<$3X zmt}(Jh32ai`lhB~Cv}fk3)j!a&l_$MW<1Ga%~&||_|ReBv*mKVTCLV=T(5EHSwFOl z$t`72k_QUL7-PT~Fcg4@8jUp0F=j2bL;^@G4i*QC1I9bXx!%zo5C=V5BSS{YozmSS z_N>2-5Mys?lE&V+rn`fwGere4xzk?=?u~9qGPEcwOCo>)^nB*X5JqZNTb_|gWUZi!ss_Sx8v`>txvRzLCGWFg_ zr15uH-DrWw2U89HfhCK=7n|U*FLR4m_|YIC^sh^Vc%DjOBd6NA5tS$|BVM4vn07!i z$tv`yy}@y8O_arc|9O|xRIE4FGT^ArZr_|1i~UJMv0o?Ap zAukw7&|wFO5ejQqYXKO*OnSZwAxOnrGH1J_1S6#H00TrO z|0ftDxqOmXgXpfldeN{&JLkOV)YdcW7$YGB3BeE;GC_g_x%OD_1Xf?bwTpAbb z$(SB&=nF=LiCoE3{;S}?DCjgIHYQpZ4wKHF?6VOnloP6T0MNP@$#sLA(jZ!(@0`9FG_6lWbfp2FFS<4tQhKw^A=*?{|k{#>t4Fj!JCrP5 zyMw|A+EoG5zBsnG=`DtZpA$GgSMYI2u?3-U+p)hvk&`iFnoE^=D^*Uyr*=z5mja1I zl%{ZN1SXkrQ=BIgXC zMFxnZ;%6cG*o?Ft2PunSBSV4S7@(xGaXe79^L8w5nx_Fyj~n9llmtrPF~g1=(Koc( z?i+UIW}m~KFDAj4+*8u7C$x@=1MrjEvX5Cc%FS57H zQ85IhoZmu{{ZM~#Y`3z!*zL63OwJsx&-p8n6s^AlGDPH@GsdMgT8qDC+CYU1wVaM_ z1Pu2mqf1$eG#d}BNOZDWGWmiJA&luaRt(;Z?+UhF*%`F4yy_UvM zQ@3ze)$(u{xgDG@ru#^-mqk-K(4BcpdJfodZUmYckOT;D`$BUiDHNtJBu!2rSAUF* zQ{{v>bF9#|b)7%TBg3h&Kb%4*zG@o6Y&rf(A|tO+UD(QUFlvEIO(5WOMbg=qygzQ{ zYW}GPca)5$P0oz=G2$%erR14t`O8tHo{jE_(KkPLP0Pd_vuWRt%5X_?OC=Y*W|JsJ zg;uY;xXj|n)8k946J@genCAx?^$^j2yLuvoGedpqN0LXErnqNl98X_6Raul@|T7;D*oK+D9`* zP=#t>#+UKmPS!X*UM3ikDaMASNUS>nWKzGmr72m%M)A|6qw$ocBibMWh%Hg zYt;0bzh()GN-ZY}kGEyzx{aJ-#%AS+6f$h&p{Xc1WrwSvaAKpXStH?`jn3U~rQj@H zk@3q^=V$oGTUU~zN2-{;gZ1)HD(CjGVr@#I*P}ZV&BnZ^{9H=K!R&=;N>CeTspa$C z_J})D!lgdhN_N6UkY_Z(J;DNUbL=-x?KlwKclTXE*2}KCs-4Z$Z$#2}A*@!bqq2-z=x0H#f z?}z!E7-KpXj>#@%k!^LFox*Vtvq7ZBV|Mj9wS-jzCS@nha#89`EfNb(zC4SIyhUfy zjP?L^>N@$|JkPj-{*0amZIr3qicBpZrJOsL1$PJ&G?3{;m5-Dp#$@K@se+nAEW151 zcKX_&2oErFcLGyq_nku2;FNl4(uVVuG8F{clp2f~p>~_a$uUjDSZo9UKmh30>tFgG z{|5r0O#ucX32emK_)MIq*Bzi(PAZNPo8$wNOREOY+D29Ru-EW)5o##|ijLRql& zCQLlZu5!0Hlg0TM5yFckPJ@)1lQT9tgR)hHHulaOP2uvZ)9)iFGBKUP5@Hr0D&;D0 zOic@9(gdSsCnK>6!<1e_cZVark1=^;sKV%7%IzaB*QH*c-{r`zwXbi3YnSp@*`^*6 zI=SQ;x7VOs&9zR+uU?uugq4I&&T>NF&R32D63XAUQ3zm9mRbXY5a68IO6!8C|CQYe zLeogX2$6z=XjV%&JRG{N0U=$1_0_m4)&UX>>d+6_^?+bacnAy_BN8*9neI$f?CiK! z5)rB^#DGX%>i|R`gtXjpAqW7(AV5(mf&t;z%?L7%AMKviqYbfFus5ZCrYrn_87$iX z=2pE@o>ao5gi$YZs9l9zVKrN@cJKRifNzk_QRTjmTWiO4arbF9$qE1^hmhlM`MAVW zJ8H>)-k8qh{xZh>5DghS*EwSAUyld&L<1ScF)N;jpOnEyj^4lw17TtUWTew4|AXS!%ztS9TOM8lfaT#K z0T2?Q4q)p1Cy&JI{{T>E>nTZWfG7le{l9(Vzj@p5HM7gQ6$fz!hBG7%UjAdRc*`As z_|JakH3+Q~Y5@f@eac?Zza~6Heu*_pWCIWbVhH?S{L<^*a>wug)a(B#0taAH5C#&6 z^jq)w^|yTV51#q_rxFb$K>bGuz?X+h09anSq(pE{qw}Awi+Kbb06YDkJ@xNZ-5F8A z`#3=^%_e|mFuT==K4%Rpn9S(*=tg8sf{3fe$g`hon$bbvr?F^9yC9XTM3PQ9TJ=mQ z5!XUqChmCjb*~N4iBIgN(KAPaf8s8VBt+d6-s{Xzn)KgzKa}#j)2TH}cN&!EuFT*G^MqqVzH}JUOB?4-&1OCi zr^+f4d_r&>1si6_j9j0KL2uOSSNXw@AWvA?I7EAa!;2RH;OOw8`!Zr>Wg-oO%bMCC z8-y~5nv248J`YeL62dhJ&u8;1G%OYi!+&r2-M0h43t#e$?W{Gq0pO`OKKYvKuReG0 z`P=@}?as`liafk<0RWCJUNkfw3nT0oD&{@}cXaEqALqiDEB6jtl_i-j_-`9Ly8|oC z$(G;2Tz7KQ_OoxlISO5|p@UKfOj$QX)Ykn)1O|5kb^cwrq-#sX75 z1mKAF^ZESX;7ZjB!?3!f?pe6)KYip&pS$bfk9_EJzwH~|^_KU_;R2uDSk7b}FK-us z=8xlOX=bT(DbZUTk84^@NearyGfkR!l`G;DdRYT(#K>3}j5`_^1%Jv7k5M`k^k!$d zWcFfCX9BWwPWpXai58;usd{P-imdjbs=_T%7QT6iM~t=Zd#Xrz3gOrZEf<*D#;b13 z5utXfFGv7)e(rNW|4;tAWNs(Eh;s@Awf};0KOiC?L94a;K8RL`!8t#nM>|PB1t20p zfbQ^TgskVBF~%4dfP;1$z(4=}x4-hA|G1oWlPefABnel-BO=g@Q0q!vR^J5zY?y$V!7Ay@9xWQ%D{a>SzSI~}%0 zvL%;}>S5x7-5Y|t;UE|$XOq$-_++K|hFrEpT-3?~1E%^;*c>LbODkZv4=!rJ@{w0Al7VLt?z=4R0D`TmZ=b z2$B8eAHVa5U;F(}zv(I0KkS;j@4OojpY^=2zwC;$cYglvkKOinfX&dayY(;#K;*9Z z6Q$&B8NpKG@DMt527%W`C!Er{;wOl8&i!rvWAN84EPXdblr{Awka+U3Zu3YI%c^9< zO()}crmD^vp%~LjlaEmn7u%jC0rdV%&zSm>YtM~MkXZ`0YaHK2(#30E=1l8jsQsT4 z=u9j*p2S@gYb%?C5^+r9Vsi?7MVbv^LkS_9YXn`$p84W8`xKF2Ce@l|i)^5kjg#jA zm(oxsj;&>NrFnRb2`V)BZ#PtHXV?6&+mSIP)=Ey1Nb5qa#cFh4G1S?z@pMzAC;19u z_V=3A`DRoL1dxGl{YX#(*?xU$)1LKE)xJ_lWegd!z69FBPk?|<=vXQKYJ07|_6q<2 z1d$K|5jk&Wv)Oz;=e&`*?)&on?|;WF$naag`$e)@Ui6aZ1He1~#* zc`%yfn5o+-By2sqg$H!&JP3ON8XaOASkpb@mSbozMUWQ(%>YBjM$i66L-Zb1~dF$`~1ps{8 z%U*;4i-X0DFM1XLyz@`r3*>i|Agvo{A7xuXN322HzNU_u+CkV{MX2wT5k$Ly?aL|? zoa3z$!c58x9xRBe4x8HlVhp)7#{gxgu1R=e2s)(P_}d8gQfoE8yb)DVbc_#_L3;}K zOs78R^@^0aR0$SRj8r!jJBVsiZU*%oQ5brYaON}CH2-d@pE%N9m#aQ)xFDqetIuwl z%UOMO8%~~43uV{L#Su-(1fw|7O_1USOY7A3^Y9dx*Nr&gltA3j6WS$*(_Jsd5;)S5 zn%t(B1p&=U+_Px_8DprV#b&DSd3u*Q#4%1cS#vX@LJ%05i9pATb;^-Zv=|hOz>u440K3(@!|K~de;~3e)tU!d(tzW{E&xVH($&@^|ycb zg}?s-ARz$b*tDE+ly+`acNNIiwgUlk2{dhBYe?Fs0?l_ccdy6kcLMtxg|b)vfA-!x z-m;=d9Ixto?+cTM85r`wj0`h_N|20zqJn-wTv1Rlq2QW!S<|lT;u_c0-TnT|y9N|< z7DXj}B?_qIAc_cr%n+QM-n=*O-g{2h?~guxPUq9-+dRB9v1=v|76YXgRB7HHLajR(BAtHz=p1_~ zrt!wCxiVZ`p<8A~4=1H##E%d+VyDJ65QO-7UWda7%Bn5z0YlwgVI1vJ1 zYq$jfNjJ%?I5Daaa%C4p_(6)q8A6M(ZljU11|j1>$O!@9${$|!+PA&(nI|7Rcm8Yu zxb|l^fj9?-&}gt`tH~M+5CBDRP!`1@Yi8L!+6S~rNz9%J4Sd;2{hkjMT)r9i5PEsYGyE5)5aFeK4fRD7HR(i|LS(HB<-Cz(g zZ3_(y`?p{tYN4}{Bz|NVs%c8ya0f2RnKPCbS#Qy)rb(;WS z@v?n|5-IAu|FXpZuwm^+JE{W_CnqKWpxJ6BNzzS{PPf}>ciQcCk|Y@#5di%B;;Yj% zJ?OCI2RwBtar(t&zZCL^2vVLVNy0f74X5tW=9)<_EnwJry^!h)lCk%d5Ffo)Rxit@az$;{Y8%J8J3#379ls?|hQ_eVaF|2Y{?8 zINfo>T>x;-J72xqp1TUBp8dk(k9yYO#Obyh?gTI|?ncDb4?hL~C!cXjnj}fL+wFGS z9Yv{?Y;E4K<(BL2Sh{gi77_peAOJ~3K~!S#-uvxw_szfEv_8L8mpJE1l5irkH4JOp z)vqsn?dw1MwQqm;Yu{e>^h1nR$R1oWy(-kD;Eb%o++gti`PO_Th6-&uF0H}$=dOfZ zqKk+6!xiOP)sHdnWj;*YS8J0(_F#97lcu&s6JG_jh$1Dd`vt~LDWhRhKH`4v-R~5> zGxZc9j%m#CLq#fMKYy;Q1pfuCo2ZXo?Ug^hPt(v{R@vChoEH&vDzj%~30wYUa|Km2 zb3(*SHz}739AmcYbhIfSDaZr7M>n1p=W5Si1tBzTU295z$Jiji&1(62D)Op}uS(OM zUdn?P0iars=1hRmdFUFp2zpGXz!dr{V@w3m<}8YQo_lJ0jqi-g{kz+5z2VZIo^aaf zXP^I$&g5j8B%`xt0l?Vi%|HIq7YZRj)M(+A-@W|ElMdg1`F>xy`g7~oY?wJ~#>_c0 z0pJH;`tcL1|167@qo0rfet6*}2YqhEOV2&)v{#(oo@^rm5q$6S7ytB|muH_5KoX12 z72m(=*ykPz0M}i5BO(AW;jHB;>vo%I(&TB2A#j%M2Qy5OamY^nqo8HfddbRz0ASPF zwGZBVF98z~5vYWbXpzq9WxbU^A4@JGCSzVol9aNOZ(rV_ftPIrU1;4F*Ov%#&=W8 z#E22^6e=CDz_G!M%0(bDq-wq~8)}1i(CvC34wQAA$!V)Ze^B_B+sqE(rQR>zqlqlB}73(MHf*XL$FZApJ?OL#Xg z`VhoL+*AeMEOn(j+PgnYl*K588^rG+LC-f-KAckmZq_>M~3Kc}%UpgQ^b(WwCO-m7Ej7RX_Od!}tB}Suc9= zo{RSz8X4KJ=Fj)vb?1$j{cL<}3^N6l2(Z~??eWh0&b{EYSHJM+laASSk6k;R?tORN zf7y4gy#BJ{V_;ds2d?q2@g@)fa)eZ9r0dtL z2Y^ny`>U&d4FCv?fCB(e8w8CsY4LOj7&5@@l7&VBm}GwBti^}`5woxF%$_%Y;qH3? zz%AEY1Hg1e!8t|y>7U7CPP9Z*#WZ_d5u=7tXj0awSgJ5sI5q1Qq16)P{uMIPMftAi zUefAk6Ac$Fi><=2{X&Qjr|j?)Xb2`>F;;fp3hgV(m(^I3jgqb7P^RT3g&O zLixQFg)5I}^>Uz<=us_-vFd0-R0Wg&ZA7biRtpEF2b}tcK{ZM&drc&=_2|Gosg}qv zdDF}Ep`k7i$f|{VchV$hicoLMNRi;`0b33e2+=?WzEAtW7%^diVc1Bm(yO;QIIu`& zVy+C|PsVNxpE^*>)N#9P&@R!9U)9NtmY~<_SZ@3noVee5U3k{iMkLjBgfe0_bLTS1v|d!dWLo(%xqXL+ ze)rpl?)#lsNrX;nNL)l{Hk-r4!&|m&`O<$}c;SD1g{UE3iJD-p%NC7}M1)8;Uwhka zzqqZ@0G{%cr@)(e-W&+vS*IQk0JmIs`^5MTu|livwN9rqzI{C96Fl7^(ne>n(HV{W zt})7sM+6`u+JE^<0O)o)ciniSte8?E#{r-a*dEgmrtYlEn-g^vN|^xY)zYRAj0ssX zE3m-K(^PF$#k2^<3Dc>7*fv+|Rh4yg<*L!y=<)1kGf*6&%p{*%^yk}!0TZr}OwjL+ zimtP3gJLJo4v5uaqhLB5(e5LtwyWAoSnLT*Cm1k4)2_aM5n%gA?2)DjEQIoos51#; z7RPw7>GVr71nBr}d=I|NkSlmDX`DN?kz7h`puk9840oQ-=##36N?q_P<1K`03Xmza z&1N&J7&79#h>Jy;PxaQ2kZ8nMqt$FAm_P~~kWx`J5*GYD`?TW$;M$-4LT4|d*X?x2 z$HynzTifkzB6wpSA8oc~G@DK30$q@Ci%3Kw_TZjh{c^{|gwc9gNSIBO&T1~h6z4+=L zh@X#sDMtA$4!a?sFnWzdJ6)j+;Gc})N!rU4)@4PO5cIZEz6SY=9fT=aQb(sJBC=(| z>w7`JAJxKQ)wgFQ7Ag?RaA0vel@o}hQX5|5tf$~AtvcTktjiRZQiYhnzK1 zWC=hQfB_*Q6YFE9%}7xpL*+OkZ?&4OR%^zL;TbcACnqN-CnwvJ)ZqjLA_CBg!g|94=OYYOy^^D70jhYsO@TO(Q5@oLDr?7{Svd3SjcA|`BR+f z!X4vahg{Uc&EF3}PZ>wr3< z8LKAfbV6<|$3_!4Htuc4f;`!71K%~=rPp)E)ZK>@&Rb(hc(#(buLt zF?uzpa9*@7Q47o|hFX;;b4x{WhKM*?VOk)Hm6a?FQsNUJMBGzbmCL-j(P-MjlGK1e zn&}9D%7qMRL5LA+a%3rC7pR4R01O#$j+&B#*%e@joUwFhXlQhFXztt@bLY((8)IxN zC7yIUDHVaR2msGM?L+{$;mTiiy9r~gc#8U1kvVANW8EKA= zK%)iCCJhba@K9?Qq1EEM?6%vy1q&bf!~JU?Tb;**DBdXu4K~+$TXUA6v?xl4c3JqX zMuMbO&{uDk&7)#WX)g_vnM}ngN7M3BVR3tTs9hgv1LX`MfN>-!V82U4%tEPraK0Xd z1-h37t$IZlDdN@M$0y|>-^NjKNOdI0>;v|jmd>(5)9$s1DA1bHS@j0Z$Smz|XSpt8#$1}pRJuA~QgIpNj<<&Y6-~5SP*vU3^r&L+ znX}l1Q(!uY`FV_hN)jxr)ylqb2xEWd;w`!}2U6=p5A;yCi{ibl&H%rHPCNrH{9<)b zw`-AsxUnlM4D+>v`Z1#v$DCV zY=a^yI<4qnv-2ChKLMVaj9Do{cBd= z*HGXZL#3dYYq?QTHrOgDwK>9+ZPAuB3c7@iRA#lhSS}8ePE7{=nM>5!AcR~@eT2Z0 z;BS!_Cc?4c&VyN&+=x_atF?)H?JHN`r$(vG3vwv6c5_ypg`Ra^Q)+8$GS(IbnQ*kz zJmr)q-(^r~uu~aAPaG7b_~(dRn>2rOxs##d^MZ(yG~t|EF98Xa+JT696^EZV=Sh-IOmy3Anrye*?KY)D zL_>&KS;FV7dW_^Jg;CNWg(e6bP8@*{pxfb?Y7$-kRx(Ld0Ja+&SwX=bFqe^Rr5Fm zdF)Ks7|1doILcNc03vFn3337~zNU*=@RL|VNgn=IO**X^T=ycOBfYfYtpwfE67t|q z^)!wW#f8@GQWgb}_OBgvmgnl-7p@oRC_{Y}<6h~dck>X{(ri`yunK(xwFV_%u`@m*OqR? z2F8T*9&QJE{t*KCKaxIN1k60OLSI5{JhzuDrM8q^ri8vq!prKZC#>`QG1Tbm0 z8vq2rk?~AdmNpL&7lFLF!x#bOoetV=%KIKW|Piuz9WN5v~Udk1GI7s&Q3b!Vt+uDb0VQ?zN6 zY95^+g`yvY+9yK}ghs2}M;j4uq>cKffo?6J1DYbmfL2NnBUYcH;#w}m{QfL8t{wq_ zWhy;!E*b|B0kdxbi`!}efIx%|WK~pqTDoRk!vaBxPRPaw7YZ*CX7n?6GI1_0!Obb; z(F+8s4NxH_tlrGn8UCd~Ld239zWsEn!Re~~YlD2^RMm<40DoySz=lC9$~%1v@_*s4 z5T;lc91J`ODnV2;FukbTU<5=K>Y2M2(KuKibyl|-X$=c7tN`Uja2Xevrv2`uEqAUc zw|IaE7-P+5ld%TK%}j-~JouFz$r1;&vOB*ZOA_8{0s!%)Taw=$k}4^J;<;6oW&{#Q z#4{qfhMGk_Ac(JA5a}Lq&A=ombX;FE?R>CqTMJ+Y-kHAGAR+YOXtx-mBVFT$Tzai* zh)vOz0zR+{k8>PXIVa-E9ueCbNQ|X#B+7R{6f>{}7Ki8Ehp04E>lEB`g@WKjWrepYq#;z>NN_E%((7WAa?UBIKhKT7 z^NgEfq3jzA)d_{gmQ#hHI^_%y#BQ=J+8i4b@~O)Ft}3*>yAJBbj%Fxr29X!0g}x|O zyKC|jYGP}?*yWUpt58{$iIhirNNrR32sZ%$GR7K+3;+Qbh_8YnfU3tJA#gFl2~wa0 zAVuVW41poE5L!r#Brk;*NhnRkGWmx*yYWD%0a@?{0x(q}RX#a}#2K&#Kog(=)W~1R zn-lU71g%#FxH1U;w(q5#RMykJ*s{o&v+~OlqKBG$nF%yyu$8BUMcsoNGbUd^==ic% zn)rb&J<8{homhn*4f?uZ}flL=J~)TPy1nq@CJ6biY} zI0(n_ksD_H@$^ULcLof^m#wx;z1Rb?o=bcd?qf1KRvkvF0a^znEa6+fSN!J$l`L-i~xZMeU|q$4BV6xZsFMJWMVl* ztjC=g5pzaGvTHn&^~#z)<^twlZ_7O^wgwrllARz6--Q#`*XWw3eFWR_ z6g$>q{X;RG*F()@1-wVjOBpd$5z+~ z3R~ed&5RI|!7;55-3oP>Z8=?LB1wYNv4uEJA3ONZbgU z%*v&RrRw@y(HVt@4@vfG7H=W6He(KBfuj=SoD)wtag#Cmk1-UpGhSKQfWXWKKr94E zj)usP0fwEVVuqI55xrj90aIuo7A1OmTKK)(w_Jfk5IFF`!jA->Ryr*_w8ezoDFMM~ z3BCcY0Xl>V>RZf~on0MjC1ykg%cm^wz&f`dG^6BmpeS@SFu@*1%~bYU)!dJ#;@9cO5yJIiu&qcbU8?ov8n-p!U#?O;fv zX=<&`o7#IWe7z9;Yvb{nE6ThW!qSM;f=U83zr`dPzp}#TJsT@uXaDv|&Q@ivFNNCW zI|&!&eRy=)o-CQ<^c^_kzw?A? z%+jUnYoWOOu(YvdT9sZ1%W4D186R&G2^FW770Y8eDc9>5TgTT`XgyRbJPP_hb=>_h z4Yk;QLGNxjp_}C(l`*jgQ`s}x%swrfiD0plUJOO9?jD=KNRzpSDhba6>pa04R%;(*u$WZe!M-<~81PrAI*Nr@VnEuip& z*)c#~++70%z))&hM2bH*yIYJv36mh;1Swz>82}?-nK&aL0G^9_;wV=+uC|rhHvRPI zphZpZ#gekzFR^$NKg^snTqywcX2_L(UkQ2Mz&!Hkv`XF*rd6!^CVl|&_!SD7IgVVF zhDf#$lcPbEHrLvu_JT)}!!l;{-`-K$o5!y%iITp{2dH~CS!zvwW1@T9c{OW=h{>M| zS)ENK7nlVEx+jA^L4CZbGR;fhV@SJLc6LNoJIpFkLs4>;FH%s-Om8KF?KbGm7ITE5 zHGfn$kMYWadir4H8ir+b#TR{nk};!+Kh*yXK}c+tESY^6Ha-%;FEW-$`gpd&;k*H> zLEKF%6x#d@7G(ZHPje}^NclKyD%uZ2WHJae)4qj*>+V!Sp^PGk_|Y`4L@uL_dd|tG zp8cA~{`AlnKk@-xP!viq0Rv*MKL70p9(*VOT=wm+-*W9$M1;T)8D-aJDHj&VyqN3b zd21nqEQYm(z`C8rI8VFXZjy8XAmdim!;1&5N(&O#)&hXI@<6dSmCQ2qm&CUo2pJ$F zU<3r%U?2Lz*8$*zZ$2kUy2O!)35PBK!Y;Y7u$06d%8`nz4F@ zn@Y}=%S^$5m{(1hHxC6Q)hyd$+ife ztCvk8JJd9it-fQrGOKele>ObXxUl0)6_nZqUEGdWv9k4}(0F1HymM!15 zc@qHaf8dJZYqcb5jcLl;?RJtRpy`!*9WiSm$SwloX__WU*YR=PzJTxmQ^-77L=lOr3Hjo8_Bi={KgM+AX#{KXNAs^Mvx8^s>SP9qT`Dn?coevsUO62 z92=Vjp_~O*wPnOiL8uCFPvkyMV>fLV_hLRsz7PKR&Q<_uZGQ zIB55M_FePXYN-Sf5Hwq@(HYGhlMQ4fuF1-aQZDY0Z6J=_6jvrxb!PZJU#v|qBz0#Rvpz+m zDw&c^sVam*FMI7K^=wVlv0t@fSYjIYccho}N`z6jv)4xe(3tSqh&^qjI!kl~ff%}M z9*{bXTuJpJ1Zu_=)P;U4AO6h*2Nt>C{x9?j!FblcEHJ8AI{$M$-n6}o!Dz&ldI-5o zYUZ9UL|~XjsY;6Z|MPfRR1SVop~x!M9w{+rlRL%%U~*zyT+?J|JvkMj)c)y#KkTyG zq9rR1+JE`VwNE^n#UBs>LaW6-e9>oG!$Yrm_KUY}?BpcQdgDu8b^a@U`i;vj{MbdA z=tV$)ryjBL?6<(W#J3h7u+Igb{->)hzV_4a`=7ijKfL{0!=uBm zJnr?|wrtC3zU+-JebxCd|LHd_zwl#UQTg0|`F>}<;l&3$ZRxJNFHE}06RZFHi_31j z>^oQNn3%`|1MV--wKNH z8&{M91G99s5)^Q)@A_N23SmvRC z+=bSE<=+b{UN{2eN@zbxAZB^lNiL7DzjknW2L^V@4bJ)I^;-^m<{>K%TmFqteW#a-9D3}*@BjRJ8jVJpq#M_5 zZZ_He%l6yBtMteP4TWl5?J>>BRQ&@okxYJaf(*02tr4H7BxtY+HU^g*vq+ zB3kK53^MC>ibvW^bJ9=Ctv*1US-f^$T;vqr4DQ1p`0@Eg>&pT@_w zbvx~CTQ(Q3ijNv(u=&V~F_Tb58%8*PdoFS_RJjyR#aN#`Txp^tlgxX<~c=fbY3@ z(fj`Ag5`%Cc*;wk_mgk@l!($a{q}!fboIsGK*UC~`Tj3_2>|}@KcAl_iF(UzR)570 zm$lN?&6+>2Y9v;r5pUB}VqQyVT6djVd!1-J40(hsztGq0Jb_l5VZ#6f4eHdd`( z)?A;i?BzWBn?dejm~jG{gVhyHsK)tJ;zoa4x-duIsr=-CfM>;5(|*OLmbR5Ywy(nY zDbho%7zI~B2LITL`QBTP;Mxh1?rF!&HM06NXL8|``D`(?V-pQVUBu5yQA0fz?@4uz z2}Lw%&E&zaGF|FfMD@P@<;?Y@6J@m^SVwiykv_iuLX!vpm~u<2+#Nv>U+)3}BIe4g ztj7p46am$Ram}NvKlIk~G-Nb$FIm1403LbZen9FboyS)_yw8#YcHej3Kd)Ma@;=*q zFM@=8tU|LtvZ(5bw6r$w_RrTFpj77F4WNS`#Sx z>zcXl<*xt$AOJ~3K~zUqf9UVdE1I(B;MDTfq?a%NPfseMSF~CWgSBE*YHwOVmDe$K zs@t~lwWzep$pu;*_{m}kW`r)L>KU4JRn3kU8K zMP&@shnTRDN?L6+^fD5iMtc4~N4k}_x-{;++O>A9doFc4K*TzoiL^KgH7)iUra#mi z<0T4%o&jaQW%)_#YQ5Vv5t`3eQwhva37V91X8C>%P+5(Lh>A zg?S|ynvx!tt~dw)9(nNh;%m5%JaGR$OAc7FeC3))S0RXxK~Rp*8q8tqU>1}?NQ?Gf z1OSgd^tcF<&11jryYu%4AN@42S1zxZBDH1LJ+Xe?g1IXWUG~TWkK`De)@|CfZW90? zG>B75)a|70Nn+T9;ie?cZ5GB0?(zs$GRwMbz-0eDt)OXd~7=>8GP%{hF-JO zxl>nn9)$ea=5}cXqEn$5>avBhvF*`stK4gj+7zEAp!*i8<`@W6DnR4e9@*BcL8;Lq zhGe8lwoq9SoqJ81^M$F46A|Z}hL9Mv9>b%fd+oRX_N`ksu3IZoR{imQ zknUT1DNWOah@+(|=Lc_xhKB%Pe5{C16`14OdWu-R{5$^-0N(Pxzy0hbAAi?>{=+NY zeAZDX9XUF4L@5ISA?0bO(^an?E4Fy#j%0ju)*rg^4qf@Bxu~+H&s3i#(R+OZ>UkxY zK7G>zIKSRJ-5`3#^b>k%lj+l*(>h8Uqi^(`HtpGepnk}rDFNd`R_FDs)A`cY=`$;9 z0af|yM|nD>0MVEpZ)(bx{0F5+mWTi;?;)?9rpHD^NVm)tx8%T;h^*NfI`>`g6)##t zEdW@2z;Z;U+}4$4OOup{LH50Ys46d6mc_{NW12eUm)Vk-u#lq z2kg7}fPDo{d$Rq#&;Q_u7ycL|Kb)uCZkndr=N`ltUXU?42`L~rE$40AMU;AZ-dANa zEyky7&~Xfj(i6dT<12bxHLK~$Xgy3Z7>@A5{Z+#=m*Gdost!&fPY+oi_PANto(+`> z z!<5<&&c1%~z!b}z8pSD+IYPEz99sESpbb-DA;_Ja!o|^d!=wqoL0m~iE#R$*@$vET ziP4$O88e%Rh)ig!QrkgZ%uG`bC~>#Ncfe7{$safX0>S>v4+4OZ88h}ciVH<{SMr3@BQ~Y^teL~KKf~|dE2X2|MBr#ufIc@0ZisnE1S0=CjxP! zR|UP!jqDu=fe})^cbZu;Zmyh{{*v}GP9_I&LROk9>;Te0Ex#cODDW!;eG!NH_rx>0 zsK1SuH~B_OjE=5Ya*i`@=3EZabG{UEskHcFl+=*Pf#RK*Wwd>S?Ot+I3ows5K4uk; z+8C|1q=a*ok6y(QP<8?;f}%q*l+-Dv%Gx&Ml;|fu&Sm%xk&0-%^)AxdTvKsMT@5xf z0Sh1w&y$NB>C;Dv?TcTwHi0bkzF91+z|u-k zCuuQ$i2$HUz!3l#LfQg8bI10Hjq7*JUpP8E+-x)$!vyX_CS) z3=Pc!>gKT+BG@45CXza?dwd-L?7eiaIrC<3-@09tOGpPDwj$$4fh0+WVYoHiQk!OY zxCH>+qzfpn+||tObx*8c_r&^JuY(_5^wabH`JB^Ved@8#JNnk^?*wF+DgT^6X$?R? zrg*Y*rN$*cTwslJ8S|{+czq!zDW{chjK_jE!>=O7fTwghKONMztK8>Nl} zPwx9TF_5T?j`32XRbE`&a^UOtApIa}u2d5gb`Kci-=j`B#$HJ&{sa|#3PRvAT{SJR z?)ZF)&)_w>DwaVI7;Lha+=Se+Js%a? zLZXiU0Ar~6zborJRU6fX@6gz4-3HJb7eV}~v306wwG?ZBq4rSWB#F-k4`asAbWw|_ zj8n7sa3=4mRcf!9d4iz)Se1Pc3xd7^CUA+U-EMCi8=IV*OgZm%J3A&PlO#bi6bYS= zU}41c=*&5D7VWk7j`8gq*FK@2sL z`z>1x02|hB%xSKAVD*~E)((#hzwM)cKWolR5vy><>t3|$p1T$WODVl!%|-y&Plgi+ zSiEd80Bl^lG5=`Tthuv}JNf8io_nNDfd2G{M*v{%g1I7%bAs%2U9r!Ln14ezw?eAT zz^T}2QtXsc|DVl|bI;L9Kc17n7(fX-qv-6R;uQxtf znr+HslYI?CRa$qt!}REVssdGsXB(`3f!Xt?r>7gxU)Uhs>A(Q8LE3J&$HvAcCntHD zb~@e39XpaVMJ7*@Av%T+7CNlZewE-`hhA$abW4^W1OTfadQg3dfR8@(M*vuSzyXMC ze0+SvhV`2_ZNBCDTL9oSZ+q>6MGJ(6c;aa%9C6~|#OaP3@60^F07P`*M=na!^zai7 z``V3P{=$|2{hgb?{x|2G{_~5kwkv0P4R_{f z#OduH`@8pi>K|YJ<}-7*?w!nZjhreu(eKh$ zQ3qeT4Kc)BJh;!ms53D-FP1pdtihya^!8{0xusXmn_YNJDXPsFl|ijlMDg+g<iW`E1QS`|!4@_l&OPbIn{cZd_B_fZ zth75SbeU5B$d(<1A>BJoTi}Jopby`8)rYzjC5HYCTz$GkN|6e@L<`kEgC*76wF>ap z3!}yWs8@w1itS^fZinyK&b!?P&~SFyEFlmAa==t7WdO*8hK5+!7DSAQWy1{^W>&ho zp@#qj$cvq7YCL86Qvu-7KRyiUC;|`xPk|@+_(L1Vw~fu5Gkf;DJsy5=4J9*x5B=!N zmmG7_G5a65|CfJ$;f6IEX3U;3bM{OCxcEyy{`2ZJO1sk?H{S8Dum9jH-ukj-Pk+j+ zIWzCM`8Qwt_%{zd?qKm26@%#FFJE%ZbC25pz{Ows`R6Q}e@4u<-p0qaf91cv@y7R_ zd-hvj_R{mt*t}u$@W}AIUFHJ9rgfVy`Rb(vDP#*O5pX~Pq+74Q?vyjnI`a*0IqmG% zaLxhX_xIfSlW%;*XcE0k^Gf8+q-{OzzkDSCY+ASW!QcJHZPpbO;?lkOt;SMNjIn0y z+lJpdanw|0quNH0`KHPV6!tWDHeB417BxA}Ypm@(#?N+PN|hC&B6t`LT#j4Hjbt4S z@@7bs_IZf70<^Fh7jgA{FNYGWq350)x?<%FLk|#-0og>(JibkMDn$wrD(wuvQ56HB z&HfC0(@m5PNhoXsG zazN!M?!=34kqW;yaed-e!6~UCxe(Af@Js0APvv5({s=2E;;eaWE*j+-o1%k>sN3Na z;~anijQ}MGDF7lNApxc`ZjvEm*+mIRh;n~{GVL4zfmm_BEOHR{*&-68;!qk9AvBQK zk`*ffVD*EKKsrN^;9W>MxMRnT2Y>tEA;%uJ_tFD?ea+p(XCO7kw@$wMl^2}(#+M#> z(&4-AzOdWr{{F5%T=Cs2Z@BD6v?_Mr9ryj~>))>?9e2tx0NF9Jtg{FvwvE60?0-4y zO)ow2q$6^gmw)$)UtD%0NUw+>aM^dSc=-N@U;MfkEnT@}*F6??COfMidhE9A@A%PI zeztAPRsar}ElC7fm4AKBRY^K|)U%$u%WjJpYXHEE8MB~R-~s*Wpz@stIlKsF&zrw+ z(H;PB%P+2`GG(!pvJXmCQenCTr5T^1gVgS@c%J$_c1xTUW?IuaW7$AdItJ!R}08@Zeltmng zvs6I0ktWSFO*v1K4klep1au)ykaNyC2Vy`Bis@IO^#$tt{^wtwal&C=`LC~C^0l9t z@64tOt{&M-mS2n@T(bgcWOjFSc6Z*qdGqGYBWM%0L3E_l6j1o0a;4TNx!_9|yof+_ z@KMLT^mT9Qb~^w0&*x80jQb{~vvR&A++R-(>RHC6kPmM40(n!In#*$p1eMx4{6{Ob zXf5icBr6I0-nO?YTkPej8R2+U(CbSKzxB@)E75;~!0Ek+p5T|PNE*>1NR4Qw9Vw&$I3JjS|o@PsT0-R(4MI~JTiRxt51E# z35RjcZ@Kn1rxjmezeZ%yIvtA!<&>r=al`x(GSKm<;Yu312tmI4mS0Xzj6-;wss>%K z#1fxI{-(G6tQf)S%vQTR?U!BOzD8ncl*MF=a(3pt^xHn}8^kDb6{t9WhLJ0m;#n-w zdZ-O0^Uj8toh5?SqT!b4Q+-fv>Zi;%^MW3LiJPcBcl;q%YC4|vRN|z5k z8ogec${tVc=~Z>=^m~06lmV0}BVHS;YPpp?hF(9DOP#IAOa`PXe)=0<1)B^;fdDvB z+U02nh!`-Qr0pFr++xIAgq*M|Eo{m{hch273c3i0ggoVGnvQQvC$^?Z3Te_nh755> z3tB@dGGYvP$~ot0N@>b@N}M;+1k)7Lbcm-7NC645I~=G1zyJt|Nwpa={jqEyKlAy= zo%f#C0{|k-oj+I9{ac^@&YDNpxSA%=o2Wl2mYsYg;6$lt1p-c-hzJP*S$?^MPDy68 z2826Bj2wg|2d)GWdl1r03;Y;Ytr7L?1GU7;V-qv0$QD0#dyDBQy*UJNFRI=7ll|mGEZ+wtok6cC3^l%bi1nSR`jt;N$anPZSb?H~lX5+_> zCBMh3m!=8ljoZvA9!-aMY2Kbyl>QEjs;%Kji4FapUf>)4;TxAJ|DT!YNVfrNnPEYw zJB#CX6ab*|kc~kf#9;CED0o`Qo!DeJgE%M7iKjf_fWVOPgm)$>9c=&~0_^6VCwUT% z0L2Hr7zkyP7!dH3C*5RxYr1KzQ1Y6hP{xQg(nbRt4NMYBQ!e5T5E)|)5RtpUfLbIz zW+u2LCT@FWx#payMxi4sV!#cL49&}K+JcGg6My{OLqGe*Ww-s}4qt#(rnA|OV9f?H ztYMi-93aUYw!|s>JcZD~8${$%&Lj!jOQ+oEDK|=h0Cw4R(Y#$2Jo4cEYaV}8I?vT1 zORARSQls;_86_4-!8uZtNUGHpbz?geI6i#yr<)(I|GCKI1nuMCUi+?BsOB+HSJeS9 zA5Sg>Fh!Y;55 z;8ki}l(o^~N(_TWt)@~Ni|^H3o$aN*EiZp3tyvj7d3+&* zTY<`p_P0`Ci$>2?L8-L~xiO=;vNx9prPL~s=zS)g*)_7D+I0Lv2(_CoYVjWy2en}e z!hviRHlWn@Ys6NK)%Jl-CoCw?zu3fl7+J?K!w*U;J-Qo4^^qfFW?^9BJj z#ls{&S(bb3MKl0IOp;{BjvYxd1UM`uE+G_}EC84C7a2p&^UD*8;DTaF5GAQPF1P{^ zjrJjML~8{aMz?X%_DhwGVa%wYyho2^f~Z1ZrR~BfIp42fRzQ;y(oU%WsKzaNLg)oJ z2>YX5?G$JA>geXS@2zTZRwbn&>{ICnOp$8r^I1;0yCRnf@!DIpCUTN>B@RfB>IG_O zwBeXe%;tBYSVSzIrqLVtqIDl4VxL?P*+G5vo7QKe$3h}f>XLO&K3%mYh^lD4d5rpl zlS1#+?Rz&>lMn>14P=#EP&=v{EALogY7f}v_%`6Yk#eLi10n#*)JcxO5mEq-NR2G4 z0SSO-#qk#KR;S%=ciNPsly-MaU}wj0(q=$hvWch-1;y8y-SkyR&1@4-v7Y2m7L}AY zEqH;vgH@9hWhzicO8(O95Qk1BbZroh6W%~-P}1Vv1~i6{HG~~Qm=Gk{0XUYmVOe#Y zkT*`a0_uoTR~P-PFv^tZV#N<%Y^&Fl_E9zH=q5}2oG^N~LTCHw)T7{relI73)~oW9 zB=R?a)2q=(K2+1vry(hCouae8wiF#xNXq|J7S$h89_NBX@d(u9&)nKkM31F(8aM`# zEK9(CtGXIFAxt5{vD14Ye?d@IQR!xqOXZ-oS9Jyspc9ZR38TAWOlJBhkg9Gy?mUQ) zcJg42TNDTsZ$|C6npHc8Lq#dY=WO#rY_}7khw)I?88Tlh!pe_8&G9i5x7CVkXEArM z5<{Wa5<_apZ!hqI7$1UUw7Y{(Y;Sib)9xgtDW>UgnxsHn>ZC?QM1G7O0mStRC}J`) zCpHlwK^CA2i1~V!E43o7)7PKIa#$6Lc`E(GDjii{QkGH#WGK#u0X2~~DIH3aCZh&4 zDARRel0(vHFk}oVCD}BQdr&ryQRCUFm{A`WVyI9xSBSnv+BP)`e4QEf1YS+h8&O;G zYwTpid8$kXp48xDAI-NmhVo1g z<9#MA3w){BYh5F8T!n;vs3zahfQBWVYdpRHiGk{)HHKy1`6(3wJ_LJw##N{2)ZnR3 zvozbYP+E{K>*J#pK*x`|Hp_bgL>t5PZN*xPUs-x(E*wcty)U2jktOF=Y@mRsuJ=w} zQyi0rvXYMKkdE2aEO0dcmu~22YIig9>=ieuX6}4KXm{FUV`Hr}8KSh&XfzuQV1z6S zC+M`>ogL};_U+@_x2N3}?>0rGED<0Uv9RXQl?R~+DEqQQHa<~04#oXlBCA>rNpJ9L zX+%FOCISI);hn)WO(xq3ZKKKdBx?|BQWj#tI>0)!XV0EJdp5^XmovzP(W+^5)m1%m z(CrnbU#4YDcNkDWCZ4SPFJy`ZtV?{$4XtWQ$|slB|0FOrsJX_1SUx7zFFC@Ys&a4 zsY{E907L-nbUI^WVt79UZ zK{4Ou@pa5JRzk&_hll`7oCA~D2^4p=b^2of5TxuhkvI?$XULFYnkGq_v?tpDfK6fz z5+9FX&4e|RX0thG&K%drOo}y739K?5-4ZiK<+kn#(8Fm>64hfyExsJqRf&t#H>`Ws zFX|Eat5aV42UXSIKHk&WmtO0yMys6*u9DI72JN5u2V4Lw?bcxkJ1DrI@}7jVAT1!o z+pw7HwY`*=f!ldrt}#1HH=|$7SRCa?iHTd!68%8eQv|HeBq(feTocuN}`*aa2q z@1TmTa_Z0bYI<0K6`;=xtBj$x??26+Es~m@rr?S1ECA0qCp2eI&)W^zrCx?X7K$9bsZ@2$83!5y zhit+o7ozHdbE@!v!Jt>XR?eLV(}0D)QgA40Jt-B{a{9!gQ_|RJ4hy|6u1TlK9FebI zIJLpvPbRrVH#Pet0nMPmQGb;6QOvRs!&f9;U%_sRx+Bt)&*cqr;rNO6QLP>5_E)G} zFy)2YS1EC7OwuOgLyd&8DZ*JBK+QA(p7Ktc5i}71F=Y*8jVx!H@H9<;7=sbJU`}@DJ!{Nn{%(7TFkCc5OKBAYb&j7-SQ_{7WhPb4KVhCv=`Yg^i6JTFl3w) z5eIA`G&0UPC*qDF-OW0Xax`0^e)g8fgK@F;eY`P6%T01!`^Vt_0nWmei zGKT~4%t)eHEa_l{;q==63Y8%r^!8{LN*f{wZz?yg5(5ArA}+%e#82WvV*^r-y@|6L z%#Nu=uSqC_Y7vQy1)fZ;wfOKtWH45xu&w-1n!7jrHPGTW@~`?5&*TLH5f%5BMZ;gi zhIqds8dVDY{R-tEz><~j<$mWtjI}ZVvFcT+i>Ro=ZI*@EvP!`uo6t zh&Z||&oR!3CNU7qlhS{6AVh$}7?iGB4T@nDzx@_{?`KENlK-o18c}y@V7J;`U<#~!m(jdM< zUL#i@DfsC4{J5n}U74RK&uh#*#D4NdN}ooHq+{(Kxb_pKQq<)dZS9)&)r(&+Q4%%V zvj_{&F>Z^*O2=olJ)1Hv(f`ZU9rCk-CU{+s?$j#P=_OFHckq9i-kU@9Rc16~F1bZ* z`&=vWWJwrh%xdD+IQ|gkI<9O}Qzt9MC1=dC>qoQP6Z%9ac3|V^@O7R z%tK!YdUKI%#Nz92ZdVOvg%#dv)!xxO5_xePii;qyD7$pa$Lf3QlO|-Lq4QCq1_fx% z1<@A4{vxW-Eb8W?QG;R2;M5wluR4Kj@O;sb|MPe`ilORU={yDG2rZp8deJ{}0| z93ZdJc6O*m)~WJ^crFC4{Kr$8F~>bPPSEeEt}qCtDyF4qG@Ui~=u7rpq$ZmM0Y}|5 zX9RjMtA@Ck_47k<*QDNvs=^^}@X>jMYz&yoNMNdwgDGe0p@QnUb5U3C912WWY&i-i zGf^^O_iM~xBY5BeVZla4y`TG(Q74!z5DL33_8SdXjKpRX-Jk)=a{n(EYY7Y$^8{c z`Q0f6@2K~YYf7sZphlFT=QWoQRjVa8rm22eonfj7c3z1GUXXu~;YFp3mX zsnpe4TP}?ZPEqN&UI)nfQl>Jxyg|rr=cn@C*EdwW^P61cE1}4dOCbwSm7saQK#>VR zSL_REBRp!F4xVQ&{3&L)T7|pV%}XsAvubrhp9?mxTz3`c`03)VwpOdBg*2`*t(Md_ zjR_1dDN@%&m0V3lO;m}I^=Zt3z?}JWKKiYXF4|`i0Bqa5ZFqEe*}=<}9lY$2V-NoL zyFRYYY^{5v%_x`OGmNaSpV!| zt_aNpR1$TYT_5WJ@X|NFbkRPGRz0xlv zV{g0ewi_?Iv7p#Piv}iu#k`$X7$Ay8t6B({`=3ZEw#L{+MAks(fEG$E0c7`o2~W8d zCX@3}jeBpU-OSiHk`XKt?NfyA+^)x1OQ}*{_d3;VZPjrbXb|6IN4Fu%8E^@09YHnN zOVN9Ryr{@XmxLWQ9-N}@EQUiZo?tJ^bL3zU%- zk~wz1GP2%RW&~6$^mUNf4XF1cX3L=ye+mG_>Z7>2GL9Val+Nx#w1=g>`6m8}n#|hB zaJPkPdn0NRXNMJMqz1puCUzoB)=GY0-uY zOHr0{Z)Yf$nZ=bmlcKR_YKNMxb%3(Wgs#!hE0#$i6#1O-3|0b>vDQ0sNQ9c>GG^&B z>+MCfX-`LpY$-!L%2a=D`KpP?th=TPrA)XUf+mrZazN;+Qgohw)W@zHG?x2j<>2rzfSyqCP;jAxwij0L+dNIJ>tKd!#|;;XN{{el;~{P~OaTC{c3)*CLr@q7RC{Z6}+m-Dudz3qfkk5@VW z-W}h`pSNz@`nqSGr&^qIcbWT=H=OZ|6AoXv`+{y(`Zd>HaxEv>nuu?H|KFZ`=JWpf zRTupIhu^Yr_l3W@>R12$f&V`DpU!>u>CayO=XGEF$miFtS~C+H&7oGIYjS?{3C}t5 zgy+m(xZC*lt@qsat7|X+VUnbP&D?$jpqaDhJnQ5a9{AKl=FZg{lR^A-~PPQ&)n}R2M!I7tY7=YP1juUo7->JXL;5alRL)6 z{|Pw=rQA7-l)OqRzhUA+L&pj)9s3?7y$XoXP(M$VoH*k#xGC%*8+2k(90)@yGq*incd zdD4*!_tn`;Tvb?BHV#R!cwf*+=ZL z?;bac(g6VRh!dZ&^q{3Y<#*nA*X;STk2vx0MSCq89~=Me?e`vi(lN^qU3tZKFYBh0 z?e6v@Nndc*OE^!vo%Zuza(1`V27p;}<}F@&;NFXu-gDb8rBp=#n7_-yH~r%Wp0fO) z(HS#$jBjr?Tk{w0y5ebvF4%3+efQiUD?|XWc*(M-EPvV)s~(vZ300Z~ee$G7 zL+$84dpF$2fk4*x%7etsEi?6|Rh{r)Ea@J}Id#_>@0-@IRauTHhxYe6DLZ0;SEXz0FU0d_LfK8^qlF4TvXtFn#vc~t_ z%^aAi_bAsDs})=qP9w^^hS_1VB}G>L2fEVf>vg{sFaU@nA07BHNG5uwBJCR^HI%QZ zA!>^;5Q*_oZSJVZTQ_ZO?`UsYzggu_eg63mu3CQRikH3hWsOGT(r;civ3mFZ+h(|y7=zsX=`6rxu{I9RN`R1!{m5qb|aP!r--ucVBesk+@KJ}wd z?782bpMLMBiPFUfEI#JB$Bxb(-MHy-m}t+QJsSXs(?N$F`QIP8V9jHzSp!xc`iz&p z_V1pu;^`|7KH}cHZqNJUv@>5lXYRaJ4?Xb1uYYm#rVRja&>@GP`IhYc}R=*!@;OcBiv5_||fMc;Vl?q?RdSK2PlhLpu zXf%23{m}VEG*Q?&lb$v-{GjT~NFD;B!@mpUK=vs*@kVR*P0whMx7+I%S6D)qE||U<>YWA>Q4>bB z+mVS$pBW{j{Ha8#=HIG6ta{Z^ul&|0z6t7`PfC?e92dS z0szOJe2iiZ5CCjiw+R8Ztlta(o7Zn94nVkN!xjLTJAXc;L(rMg-rfL!MzeY44=!1C z|Kre|LCNraci(gKFRlWBl}|q$82}OiZ;cEuJLu^E@V&2nZsX?l9DyU;d(Z7RTzxqJ zJoT_6GhQ>56airK#tpx`_A&wvKm>TxHCJreym4rFWS{+)7F~+j-=Cj&^n>qu!~gr~ z_bdw;0hs*L-pK(H-c?qcS#~87AeVon;tFOU{AUc%f&+cPn7MWWXj~R4r2GLu#$I?D zL5?}F>Ntw4m_3GgBz~B3snjvB95|@`6_m9UPhJl-BaM9MQDYn8I@>|QLhz(0nTk@~ zT!l)mH(CrR8TLW^AOQjqmYH20Xj1hRrzQIP%gwW^=^XlycMLedx5MMy4wApKy1O_e z<81_3h*1+GAM%LE5Setv7JtslTWAa+%L|0SQCt^EJp1D*@r3h)^Caa7r-W0&^9S(< zDW`-}N|17;pYo=HyhqXa^R@>0A2Tv}4M;y?5}dFRBZHisV)k<{#{?)S`uxq|VMR|L z2q-HmWS-jmXr%lP0I@6zyBAQ2Uifccyzh?t&V1vUdo9`Pgwswq;j|O(`PJQ@x!|)~ zHg3srcHLtkV{Fs@`LC}(xM|IXhlW#J$0x*yItebL^#=S3^` z_Q~;`$qEq^Ss0cJcVD2CUR?e0z&#HDz@oi&%WP$B9OWvpxDlI)Lu1IAkPbtN?M{Y# z=Z*IwvEg|$3EIFqtN-|?9wljiVB?m_?W}>A|43S8TbsvTy^P>ZoTQc zKR>?8Mz$CS$mFB-Za^`hO1TxFw-f7qg8{b5Upv(6Uv<0%L}#yr_AbW(hel-=l_ui4qE?b4YMNI9NPKuAc0C_Fw+!=N@8 z9<2dGNk>;1w6&ZM0~%??iSwSIS!`xl1EXqOkrN`X1S5ibZ~5)LxBT{!i+=px&%bxi z#e1G{?u)%jX7igg!RWXeV=rP#6vb7H$90w!c2t?92ERh~OQP1KqemE9)?R%b zA(o#wPqrhU8T+XCd!lj`DFPg!*U`L4H=CP|jp<}8s-)`oa@4xABg8-)wH!Z0xe_%W zveClM%YPJax|Rz|WLNA2u#biH4N98G_6mzsx39LexqYr8J9i$JtZW33Oc6m_LZ{XA zTGV)Rln+H$NWGS6?rrs1e(tb*s`g8q_th&>^pT5fRSSG)o8VeRP5DBccSaMb&}g;Y zXE_$D*38q(ss~>4#vAlkKe+nKAHC>ZAAi?T&pG;=pZKQwYVD(I|L)YcI;od2NzQEn z0MO$b^ZGg_@Y+Y$zU9=nXk{wXN*D%`q;^RfBFm?p2ohqz^1J>RjigDMP-9|SLO9Xc zA-7gTl#p24 zu!!uEiy>9Qo-MX9`12nD9OQe?l)ssTe205iQd zYYhM>1`mMV({cS$$Pr@zXrETb{g>}|#7RePT)Xj_i?319{&4pn0ASZWcg<6hZUO+a z=FW<**o;{-yPYi{EybC$X97UCQ`}RF;24gW>GtZxr@VAyuKcPU}fELik@rq||m);_1b45x4D%-&KAM|9T#ApsfZuQ{w>@;%KtIXt2Cf&U<4p?ji;ha@l!H^N?)rGl6UUNb)O(}e^W9qLTYi! z8l7>dmFxJ(j*&48-dJr5QD?7&S}!1pup-7ldiCW9%QUiqeexb=&zp1Ro6dUeJI|Rh zYlfP>&(ggCVEfkXdCJB$8#w1P=geHZY_W*oM|J|6u3_oFc0&| z6xVWLLU7iR@+a}tyf!t(1VGm-8^3=*PKKuvvXdLdpZ(q`b_OSlp6uY?Nk{M7JVYu$ zR(bB@Xz9^p%V(|e=fuoP?C%T;6*^@TD_A98i$nnlm5PWs5$Bw9p5}ikPpd+bq)C!J zq-n}IPgCNY8v(KrY{{DE0u=QjYJPk(lQ4xxRtpZyE0}VnQd~kF>dQ}8x*Gug{v+q_wf|lsamk7$|MvBdeCE>69QC}Tjbf5+@}k$h zXrHHKTHw*oJ>~^3e*pm8cKvOlXvNY+B3k?SS^zlw#AnFLYE_+_n7sR@y8z()kNo{! z`|l;3+Dld}{r7MD`)4ov?9rn1;0mEl4Jr)HZoB*9*S~1r1NH#~&iN519COkOPX>T{ zZ@WEjrcP(_!Tat7fS0`bjk_+|Q>5>?&*Hy*#|3YD-+!z;jsXh2pn z0ifdcmS+(W00`1<^2v99;=P~y*Mp8Y=+i&@%(l(jTCLXTtWf}X{NcyH``PcPv@iPD zmzS(uviQKopZv+Ewr<+mXs}sxX9K{UH{N;8#aA0lum-#Ns+&Ll!;i0Dvwn2OsEAwm z&CS2L*V0KB?qhofQ=j0KJfeBWV_OcFJdbj4pAt_?+^GEHgCG%1wc3pGM|tW(^Vm( z5~WoV;#BP3I$tTIwKxQuvV)!Ko}T#G>)6u`q7~@M`Bn7{K-mnf>=6cVcao(Bn5~Lt zo%BiXoE8B-3=gEdY14P9fEJc2`Ol^!Sp}1_%u5$-CXn-TbNOs7osQy-fBkht#gmBo zXEL-&lqD6YI-XL19>=YSZiQu`gyb9TDx0$1hzrh;5CFv;yC4lg%-Je#w{*-rO+NUn zyNp}^R-x5+ByL)*03`&YaMV_a$Q?Uj;?xC^vne;jUD`UiR-XdXmNsHgpr#C1 z5(Sm{^}t>CzvGOzz36p+bI3CfUAX(gBuO6m!y~s`ee$!DE1f5E(sYd79-`3*n#!uMN4h`fojhKATI#Lm_=+du!I z|2qEvJnw*~9W;0TyvZGts~&vlu3z4E?=5!{A7YFFB>)K^ATT*Ax}vsI8`RYy1`2N?nR;zWHbYQ(nnR;mE?jI&0=0i!dOX-QMl&(GNlfmuM0=r% zfr9DYlvktOd|T9g*|~G}QLy6(^QoDu2PN(8&}bF=&D3kFLu8(O%~N!z2uo9B$q&g# z6_#0A@~FBsZhI35#yAjZvQjo_moP#nrmG~?+I5wx-yWdb<>)R((fRbwH|`i0t3wt@ zAs(}+1Cye1GuHpl-kZnURuuQ*RlU~U=iGtuGHX;4MN#C31K>P>K|~y45>Yf79NzOK zQS(gloMQ5ePkAPJNgR@&$%`Lj^rOZh8Zjy=gJVFz*(eGD0;0kNE_XV^UaPx)fAmy6 ztzn;YE?1wO8#%jI57krEx2mhVae#6OoTKNks4f#i6)x3G62@aoa%ChFoYh$(69bT& z)CcwjG@~yG1QOcZ3jz=k2+yfDpq5Yjtn$K(alE*&b=gftN7@g4>z@JO+=o89navo_99{&5KGjxP z?Km|W$mnuoERc2UMsHCVA7*qZV7iFYO=3D-m`tZ28okLwe(zPw5)qSe*eYTF|00R+H?L~9-D z_2aojM2JF&YH@LK)8gV}T1^*(aa2M8p^G8addK&ADkclnfd?M6xVVYCP?2LFs9mc8 zg%H-GLKg!9^)0#I`0Br{EH68fi8&V7Hb7#U4aOm_!6b}0)3XWI@&`_1BS*x7H)I+N zsbxgfafdODO7ltIw_vXaDi!6yA11RAJAdwj(9h|6L1#B&8(#8!i3>JSa0+zzX_Ra; zI$)W3b&qEDc1rfSSD##`(B0%UOEoK7u(!o7N4e+X__4&03d~=ga){>re;Ewl%j3w%{18}Y%59o*CGIb01!y%^bbTp6ol#* z?{ho=T>j;Y5C}*B7>6UKr4k5bO|kqs-JnZC@6v4N7NB5}uO{gOEEj+6HD)E{7gClS z2IdQ)(XzvDf$aZ~g}KqZ^!FoLQ5$COC-kmHx>?g{KUKjNX)Y9pF+`d3)=URG4c+L9sn{{ z&xlv%>R_BQeIqF_HWE5d35R0ALt6cZ-$?^B#sd2@S9?Gk4RT#)<;2!$Un;uBQ4nu) zl{vMJ@rJV`d-8WcTF7j3iTN<0UD*Ht*7MGaSq);`*)tnS<^C-6M%)s$NExjR~z{W*gF9RaKipdy0 zQ5zua{mB}~+QVKRC2HRS*@6UR;x*nO0pyNZ3IyX*tEz@Xi;aX?vlYa`=1ON!AQ>x0 z)c4~OfG}S2fN=0(M;v^}wj2KA>Yx1RdZfxc3;_Tjtf)i)383^@0|)I<(_l4#Cq_Sj zvp-5HnT;?g(>s>u=3Yrf$xoqq#Fpbw`HI~BAy~e*_A=*6k7@0kwnE2yR#L2VM98nD zHH2WV-ux%&V)TD>eCn+V0FoEXxkoaf;pKs&fkCp2R>P2u3}ObTQB$KMHbCn6u`_0N zuLm+Ds2j?QPWOJ@-^13mt(3xe&!a-}85i}Ngbu@?lVxNa5(F5~A%F@!4)NFgzdPVLC;sXNlv)6bY`8-}sg=b}?imWm#I`azP?64#^5#$g5>Tu8 z4x;S>u8jeBoR5A&`!!|Lo8<&v^R`HqNN7tccukTBfJ8%8Gnq`M)9E2cFC22zf@Ud% zjS>wI5RjmWps97XQtsrR!d9UeN+r|BN19g5a zecFu}OJ4^L^PK!+EQv$NGFcrHEF~GDB6d{}V!U+*wQKO$?aev36X&L&;4JDvZKlJD z8;1MRac;ctX*N+8U>%dD6uLld?x0EcGMgvm9NeE@&R^VPWfqcBPq}rQ7QwC|vK_(K zlux1G6F?h9URn|>htuiBX@sf@3R0H74AqH#S@0wB+$uD0Moic@Im*=q0JA_$ziM+j zeZl=80ktvR`~YN>9rX z#S%2CLut>Vv)fbCX7BZz$>`;&BbZjU(M)#&2;Lhvr@s&hyo3}2Q6MR0thhva zX`wPVaB&%+F*E_TZPT{x))^8_0Z<5yK2d>6{J7EG>=Nh^)^|4M4!p5w&Cy1y&Gj;} z^ueWH{p&sDdg<5hyhF-ozsDaN8cW2!U{eFv*YNAbbov3sMn;#eq-%iVuCg(Bdwl6b zQx0)-+2FveP4fd;&RoZ?o;9i&k$N@2_OZ5r0T&BG$^1r%qyRPrLndhQz1c9EafV~?!y;~aw3T-fBxcw=-JRoX!DRz*2cfP4um}(L6nzWJZ zxu|vU8+Z!1H$>p3%XJ^3LZd2_eQaFG{(o!@Jv195)&|b}Or-^EvoF1S=krUhhuw=f znk8Yx&+J{O2yAHwwT&PhA@PLcig2dD9_=|S-1K6iG-pzG_jrK`BI-A6EsL@vMAwY3q>-f5EQc(bw51S%LIJg2R;$bHo;#No78e&67f~Q$ zWiGRACT%;>2g^iNRW%|C6arBZD!r_b5J^}d4Md=T06^3VCxC#6fQHWQb$=6+LEO?$Q95r4(2JFfP8y9^ENg=r2g!d7=35!F6{5OOXY?WK zn4YGKmqV)WV4A8sVDKmF;w;wij+1^s%}^-^;l04NSAltQGi%9CcM799ApxC3*Zy$f z6~Ud{TC+2zIH^j3Pue^;i#}kHhAy^9P$xnwA#;#Ck5s7q4Z&DSlb&pMl_xd(ferJF zl^&(Oig9+g^w7D6GE-e1qJ0Iy=xs#yB&D{o0)o&!wq%%~0l{buxW==`+F}U=Kt+ml zm+B>>UqEKoUE#p!Y)S6kxr8*?G_4T?pfT7tP1P<}`r()9w63N#R+XqK5CFnqSkibJ zh(P&cw6LHmAyEi{LIEjs&RinsL}vE!vz)Op0szckCtL^=Plf(V`^O1=2lBdYZ*Fs} zF!B*&oF8}$$QjMW+`T+TSAx7#NByyFW|dh1y{q?XP|CQW#UgNGODH;W-B$*2v`E6z)zC{0#u0nEy(A zU6*efUtYx66hgL#WB&zDOLr@Bp})6i47W3)AhlA5P&f3jby$&U2;FsL$#mreBE|U~ z#Qra=|9!8MB$6J^x{DGB5rr$xP6*8Gi&-NzrF_He)~1B>UrFl_u;W6~C}kXx#e@zi z&Ba&J;v7tl>T*4m#9JPl#1qm!c0b4jC$qAvX8gu)FQAD(cS!z`JF5c&DblwMpxerK zpDec_??3<`(ETDZ9`kzLvw7uILIB&T&178Vvru%$b2J?-xSp>GfO zF4|>I)Z6&e9Au@8yNI3U+Jj1&bvY?>bMNi{joT0#b% zgY2~jrnr zl=)Arg&QD)?4vPW5dxC5Ewp-&aaZ7am;FgGV>hHE)edXfn3Nc|Yph4wT^wRio30v) z$I8ZU>}v3uXFQYUtG4LBA3eGf>Vt+7vIPvBP0qBJQ%cC0X0v6Iajvz#{syI5Pzz{s z6WcmMB&QkL=e`2+wFcu9_qJ_UmzEA}8cQuLEiK(~$L+HvFJ~6!JtVONy)Q`2k*Esb|f16wGXvB2tS*1lD`50wFAdWEeF6-Fb>(U? zn9*1BR@03O%pztZI(c=nPc`JLi(mUj8@hex-h_q{_9G1Q8HB>(I*K1$PFBA`--$`- z39Mj=!MTkvPLddQ(`!JlI*G~|g2X^J!jHC3urvTc{eYzb*~QneFHj6#rl)sfykA*!^_X*-C}E?PvC z0;v*EBTRr=qBhlg`RJgf1ptWcw2VNH^M!CcdxBG%`=MJrk$o(0PB?u`WA$9%c}lj| zo|?l-F#I{VjI}Mq&Pr09(N!N%*+X)&2-iT<+?Gyc8voCO518s@>o}J-9KmB|{^#%` zgE%2mvDP$ptXCT#EUJygiIYF2d8oLw@k(;OBN9>EXBWr#mpPFU&1}w}Fc+Pc<-T*8 z66u^p7y9%SFAtNx&*J+e4`MZtC?%W~*l64u0$#-S! z1CA5eYkvyaTR*5RjWlO2#)!z`BT-S>I~x$<`D^Tvg(Zqvk};mlo^lA7gGRIgz_9lc zbdwl@5KnVLy#aH2;*tfmmW!CKLlA&MS4=>Pq`Nf4x1BI_-&fXk)-zNxwde{e0%6Pn zszzD>H3gcg2HF`l%c5BlqOB{rsE3HC0cy1smH?Cn)QA8TU}c9~DYQPd5|I#TB4Db3 zfLd?eEY2Y=EHD$f5n&#g*iTZ?&Khl!Wou6(hZC7@!p*lW=Pf94Odm}nJ9I!XNrQqs z!Om^Gd@~t)Z9=1Q68b;Z%ZGQA7UNUypS}mVIhlbwOd<@isgL?JFl8a0K-(Td4cqbg z%ykEjeD~xDS&&LLfSJ36BP8BF5X5TH>g|*s5BZ1?GiJMT#3VQ6X?hb3+Aj>F-(FmW z^klPJg+TXHgd#b_?RdfZL~gB>UuiV^mLa4CH(X9DF$u6}KBh3EuUV0C7)I2O zCOP93hAlP1ly%9zTl=~Dm66ksIxUPUZ5_j1?^7Fua5-;4nHvzYXX3^L4IDwgu7Gx; zBu-M6D+Y7O*-Xt!=8osiw+G4MS|dL+K2=IJv)OEQ*34#Y+mJc(Wvs~F*~et?%>}!I z7P!m$rREWJ_~B$Y?-MWO)nh~=@%d99Nr(5X1`52FBL7*;5aNw(Nx z5oiE94F?24rQ9btE{MPytCSHWR{WwC*03+RB8`|u`^Mw81cEd12z5X80|*Yg8!d9e za+-Yhx%;Nen`+)N*D-_&o{uzoKcWyqDQ>s0APEc?^oW*nJsGI@9=$@iz?nq^5m8Cm z%x1IM>TGq^wk>&<>@-3ImVwn}c{KWxF|rnre-?Xx7=p239ie33_Fq?xfhY^h>0M9* zDgT*Akau|l?<%!qxR2?;a!O&Jt&x3H+L#GLLsU+KFG2e5PDzN%ln}*tS%1?_42&mAPyj!Z(>L}d#m{g()c918Ktl7<7MtLXFwMEN zHsp#l7F0)uRp)(r0Bv6-zd(RMnNwH_VOFo~YIiidrIfOj?J8DkQBbAnVDA9hnu9G6 z`z!+}0y5$PHAhRcBc7{+4 zV!Eg^GYI%tb4v2nmW%7lkb?%vnUc(p{E-Q(Q4>G}ZQ?b;YD5ssmw+9Kw>#n#tv<3h zR*_+0@jh(YJhWzkV#9beQRKR9+dzTEz{C>olM+@yb8Ag>*C+ynvw?hf`Dxwjju(Y- zu$GCk?n2q}%9d|ChvG30lIE~#uC`IZiHKs(sL#{N{U}mi`ps9p=-O{z^Sa-7l`Smp;VlPjdCG4-?bIhc{P1Irn9XL_fA>E={ZAKOaq;E3 zqBEhSk5*On-miTS0G@Zsvzu9CNQ;}FX3RDk{^^?^27u?Ca_($(=5iNAMnGMTVserK z0raEM)~Fh+!l+aPIP=+Oz2Ma^y!PAIyyiKtj;af%lbBh_=#Bw~#3#7~1G8myo;&g1Tj+$eK%(=>E?4Ht!yTw#V)a9yecL69WH2Fxn)#mtv)`vNUsMJ|3Ah4yRAC>unEOc-1-LEgOkbIw_Kr

jr?g%0j z$P@+yW-z7@4mlz*aIwpo6iT$)uNcL2hjantYT#(4Ye#m#LhFi+aamGwXd26)@`U{+ zKmGO_PvVE2{jU%p{QaGX{(*;}+w#2BV~g%iu?(Wv|Jf#GJTY_J(LNOtpjERhISNil zj1XJ436%KM<{@34!f}knW(v9afrlLU`gi}YqwaAO0PMbV*QU*zA8^V8A8^V8FZhRl zdEcAgGo--%%+U~omE50Z%(rz3dfpV!!;nB8;{mb(twc4MPOGXi1)CF{P8LAGcJ1u9 z8-<`$?!kr7j^sCI9O^}@wmNzMfJoVgg$;q6|7pn10v~ZFnZDGUi-k=mlPhdqx9?x`WuhAiMfruK=Df(R? z>^+XV=Nadm`RKDB>p*S9C9@5l&*oVE1dvS75LdAe!$xqxbk7YY%O$09|Jz?wjxtO> zjP5tLy{{L$LID*a$cC2pHb|36Ef6aKH4uRUL?Y(Is_gUV1Vm67l7vn}Dx>x>-70Aa z1rAfBw5=8^QB`2x;08B)!B~O_KxvT;KmfuRW1>?V(Iq`rhZNRxAan@`@)9bywAqLv zc+Ui3?`~lf0w4%tzP7}-XS`_jP$Lc9_JpyaV{UAe02vs@sAZYFI+QfOFxXog%SCmU zvjO^es0fwTdM_>AlsQy4I`n&c2O;(a=t@kWulY7Pqk>!ng;}iEB|mg-{rs&nm|JRP zAnR*QBXcB2xX}GAm_l2eG8SA6nNyvJj`P1<2_a(j#^^9HOK)A3d2oD;v*X}nU+|bD z7hR;@_Uu|1LLXsKyRua9^c~5HcK{9~KK3&JFhY>XUddt3k|Th=TprlMuucn+YbkTB zMt@1Ix4(o02Dz+}#Wx}ViQ({>k~;>|6`cd10R)XFAe%R}NUg294ZSllIP+tR)|#~a zuy@y90NA^055(dd0N}7=4x21Y_UzpApFg;P$A9N5-#X)*Gw*in-2q&j)xo17{ ztj8R4uVaYlN7vna=|?ZV_`{zumtYV9!0-I8-+km+kLDTQeZ~9T-#c&L`I6IL$apSo zIdJRKUhpfYoPO$IM<3oc?G0C7f6<3N^W{%{F>V+D04Sx-eD+yqob$vZ?snwPJ9d8g zQ(ye>+dt^NY;8Db+d;qbqF;URqaU*EsBLZ2-gNDamwe=+OaJB4sI;d%|EbS?#q-|( z*7sg<(N~`R^5-1?kozxgTDrdd(HoLX+mrS{A}<%1LI{D z^0h$$^|?&z3ycC$Hn6hPOlyM03aeURYn~qygsAi)Q-nlXqZGuoUu;R3^HPFPFb9V~ zDP^r7uq)YsJQJk=g%Cmr{rZ_sivsoOQ2;Qf&sLG z!Gy?W&Ybcnt*zi|X$(6l@{W}rJQvFMc{^eKT7&PN()wm0M@cYA^O$xR@p=LV)5`mM zI~nNZk>NcScp_Pxi&3dIpP!MOrxl1}?8lykNjG|UBf*jrO^mQgPq%GhZwU3L8f;^; zgg6tAK1!r}sttS9xW|Gz)H|H&r+!1A6Y066yk zzj*BZfAOS8J?Jm~`=2?F%)Ptz?!0}c{`;V92LXWl2>`q9*vZR0XxqX6^WEnkarYwu zVE2w)i<>vy@4?64@4?3(chY^|dH&x=R7ok%dd}I;dBtzs_T%j<%PZTC+V<4*o_??U z-s}9|dLti>BaS)z_3wV;A%`Cd06Xv4xwv`pJ|`Y`pA(OJz$p)W+pFJ_cEaWZw*1LI zzG27q9pAqETgM!Gw|m|1*q5IF@&gV!;8XAWWSV&Qox1^GPoY1Dhqb7+Xt&6fQVxI- zQ8SyVy-K!nX=!O;D=i#Ale(_!8j$N|_KFf?!sI3iD_?Sz+STe=97DNgP1;A=fQXb* zWM4ez_xr@YvtycFA}-@%u|8oQO4obmeLYLtN1=!2GDaJg|7R(zg%6k#lHMAy2OWm8 zk0}CDxP7Ak!;BI^RThipKrJwwN=a^ilx+P*e{4w@{Mp}y`*NP{`!%tjv7V0M$inV@ z70dw(h$*yJW1#T`CuGM^z;>_IJ*@hG+!dwYyUe!SX^9-r+v4Kn5EAQbY=K~ocmhMu z{5(lcwFLluPi^=Ns0JMD9yPwiLLHe2f~;v_=N&s&msfY(wj=%2AHwpUbncVyfAR@; z-nQedul%d4zxrJOIN@O@zVuDM`{2hu^a;Oy#%Dfop(gDg-t>-tc+)!oKvdOxzxn|H zcVv_?V|W?!|xnk~7XZ^Q)h`@|*wm z4W5e>J?x2(_#eOaiW{%F5dcm;?Ua}Q=_^ir#7U=|e(Dt$e+8`Z@4Q#P=#aw?z4~k4 z`|FTD&_2{pB_OdH3xx#lMA^<$`oHIZ4_78mGJs;P#JoUV% zpZoIXKI^6De(qzJF7I8AdScg(U8~EhJGS@sXP`rcUo<#N?6oF3_!$Ma9ii=@#&K4d zq)pSTs@0{XB|tcE+w?#&*}Qr4WHND}mdqOt!mcX2fRO7!Q3C+H=ZRaCZhOVI(7NC{ zQtiAqe!Vp2g6PN&;IGOiz;FdHuHb!Y$(J#(PH%z6AOZu|`7Ch*N}mI_jAGHl;oux8 z2c_ryx3jf&=B=w1(q&b}!A6+AI)Y!Zk9aXp=15goS_g4Gy@Z_01o_4RlE~1BtZXM% zjM(#9Z)#!nqE$!xV*RyT@l8i*=Qw|+h#>-_sxxGL>r1zi5nuXoIhmhfnQIF9vkIle z41Bnl?(~pb?b(`wqO2XFyNXfFwWr1~tRrJc!4%_!001BWNkl+Z!SHF4tk8aiNy5i!? zKmM+d0l>r0cm#qq71)Muzxmcry!+!W=Hu_W;Is_oVGD z^&Z4klA8j^JI6)`$+IPaR4^lKP)I}tVE&=1gq)(BVl$cThTYrS)t!Qt7hz=+u5MO) zC(TZw_DpbPLG7K&-Bq&-S9dD4R8^~sRl6{u$wW;iYEn^UT}}m{AT;;h8kYxQg|!Jv z-?>9dDJh8*pnjfG5m4|qAlUqbNQerM5YQx32nvY=kN|~%js~KNpw|D`<+8euT=U6Z zdxJKw=}QX!*?vU@C;=s+g!rEV->YOtge}jGfVqF`VnoQ6+)=*&nhhPZH#hV8(i8ia zEsb0`=1G$1?xOxcIL|*Ybp<^}A;E_1o*s*d35OutY}Qgf`-V@6gq~=GV##4AX!)O~ zhBpBDKf60`7LQ&H1i+RBNd=Nf5-B1@Wd8<5q<|C{L1Z{YKs1|PtXdO+p<{hSaNoe0 z!A<%n>{Nvyh54rhC^Y|c@426rtrS-U#y>rC;8L&{Tni$pnf;f{hweq2Qkz}XX;Bfx z9>pUzE)1!w)Cr~LIJcF7Z3!lo5B?hlvk*hrh5%@JfSzY&O@XrONCGJ!MM^5wD%C1# z6-lL}vMY=98bq=Zl&#s!LbfrvzR0D=JVW5wJ0<{M;x#zjPb>jN%7Vl7VPG-L(>^yQ z%o{TEG0cNeJR$%bea~Y6;Com7J5T)8&t35+=l!9SvWrOacoR@7cNghyQUC zPyXGj{{75zpM2Ckj!G4R?|=P!yo~RE z%SEsPDwLJB-_CZov!!+u2%0Y9gv11zWo%aDWICy)i`2Gl+vC15sK*XTg4R&TZ4h`#tYv(H;(;r^cuGL~X5CU4sjS;8I z(6-JY&l7W15u<7}DMhPKzFsU{vJx+MJH7J+7bs2GrrDM(AS~`v>*;k9UOOI{2M+*s zgnPq;ZM<@3LEK*!{J@upWK5BBnNYxmT^4fW-VsAjErJS9@32BK9x}bUd@I9vd&f5V zF$&#ZV>#YMUG_&1ZMW(G$^ypJMREMFrEZ3@6D{QH&EkrZHM(QG)^`)99D1q=r8A$& zF@@}?G;dXidJ^3GMJ_B(0buX$r6^u|^iHPJ zG|SSSCGMc9k8Mp^%6d`*z?K8IzV`3_m}lH_;1>5a3M)%1QOpPa`u(5%;Aj5x`_~U^ zM;y>jxeZ#Ld~3*p1v5>R_AL;CP!hn>($eC_`eE}WDSd^nH1R)kVP*`fFVX+dI zU3rXIM0#8u&U+757|zdM8dg?YGgO3jrT~s0i^*ts>l#YTbZB-@c~{=)!t{hwAJ|<^ zha9@$>g#W~x*ySYl3*0A-t!Nh(GBTp=jqAjiQf3|o;UjD0TK#uX=!PBc^O0tLMlZ> zN-C5}Afgb0P!W<4h$s#`WO5))Hf`Qi*Oh^u%!$lfBh2(cXWc<_1uY2_C{QY?j|@6L zSa+A7Q8^RWU1W1|Ka*M*KUCvPQa{~c+@xEdD%Yu|;Wx0xH$l!1B#Q>l-jegJ9!!We zTjp$F5DK==G6UE1{`Brhr+@E&XI_7V(1|-CxJHD2U{L58^8M zKFXfX)GN<)0Rs>b!A2fi+E9p$)gYOBrXAL@6pFVldr;;kgM@6JwGJPg@P9J_ije0* z#w+3x;eAYQ?8kFUhAKvo2Xa9C4Gt*DzBw%2U^zQbIjl>Mr zV3V#_&4}FAJfWSWNFV@E5h(?L0%}A=fh2(d^@X%TiCW+DD#1F;AR@?}xHO|?+N?~L ztEs4_l@3^;s8N8vHIImtluGH#x}+jfib#=E&~DnaY15`nPzzB@+c-t22nZ3Bv(X}3 zJ^JJ*?;U>?4WIMGwuXtXuHcaoHn{9yS*Z_$U|!8d0A%hQW)n42Qh`gQ5d@LUA|KCa z!ZcUuYd(w;)+SfW2=*0H78DcbKrC3H>M(3_xdE67>CSGVZ$rsj7=7)UTLs6@e8>Cb!NVxI zCFtTyLMM&nvmTAoPEm@i3WE9g$R~vLCUA|%r$C5jFC~9;$xzDuiKQgL*HZdy6`}8A zj;y!|87^C#`BeUz5F3=%-O`Y-{;z32IAJrubP=rJQW{KCMI0rs$k{HnCP!lN=o1r< zmkP9X$*w>Qt+@!=%hy~$z*eMBgkh9JCpxKjM+zFH>vBlcggSVCH^}M93hl_@LNVWi z3+l6rGmUCiR{>!20b7FZN7S43vz1j=5jLyMWMQ&->*k%SGgm=f*S~baePk=I{q_%% zrNC&6g%$z8OxM13Q#8r99I!=yO(*~6t(%+GJ6)+dWi#{l)V56v09y~-nj-`__wde^ z7^z+ne95z}o-hJ31UxYKkShcY0&^2l0U8jgg#i%&DFmTk2SY+qs1)eCV}UAwij*QE z0D)NP_R2;s?QRhp6mrw1>Eb4wOseUmsuzSvZYx| z%^`5)5uo#qE z55%<96sAv8M(IO}*f@>?@veY!lo?v9HD)IL{N0kRr>4Eh$PhJhMA3BIA zmo{Y0=h9%d&^To@4+k=s?0ChdZtIR0y6N_ZoX@xWub;i7z{ps1@(H<7)QB!5eM28& z9&kjR%ojO$#t`aj0ciGXum*_b3m5FHx_*nE@m(u?P1oFQKfbM*HCqqbdXMAobt8L! z;e=C91OWZUmBqlt?|U5o&8k24oqPt2fNY2lfq%8$3Tlqart@>Am*fGBUlw~V%HA|L!;ymEPu;{3^sL+rgounw6!MZ+`h3 z0Px#yeA(TOy_=3a_V{0X{Xd@n=8ymNDNlGr2?}hvATj-r#x}`e3wU`taFm~ptV22?vMGhJ+1{HqS>rjT3Xt@d-u+rJ8!?^ zj_upG-+Jq2e_U*Uce*0}ZcI?=-Yv-QbdzO}#mRFWnS5{}Mv$k!PmX>zzymMt` z1>!}ik53!Jv26>wCWU=%r!AsVv#N48JhF{j`c3QYIrCZ*t{Y-CM%Cgwm+4rNHbY84^lTD((U7`!`SEm+u*+ zRByT{sic(p#%p_sGji|goseGcbg?+U9P@J^SnG(cR

    EQ_bY(Hx(lZ8}SO>;}AJi;>@VY1pSNnAh1v!+4hd6KqlK?naxrkEn zVw)gXkbMP#^&|Nrq#&}$d+zp+)!y-TvTH&x(qs1{s!Zoxm626n?4pjqs0#J2TT|5> zS{bFM%7jnSae^354^U(;c+8fm*od{2(d$@C{=bN-w1wn1qbV()U0GGE@~5VH z8hq>3;oUXvD4E}T|HEgNTL9uNgHN>TH!5Xvj3eIlMKRZ*3ATE{)})Q_q2ee>FX!t> zjyyh+5k>mVsd~S>(4n9jGm-g$zRl|yToV0+B%#FTeJw148O$D*b&9O}064P6&e7RI zZwr#@s#yK3BZk^`&ot_}9CwUx(**(;;nQl_iUlOyW+G+hus(9Vf^bsOq==LV7c+t( zWJI~HYa&=nC1CxgWK8jH0rF%P?MFzyTxhV18tp9=wbf7Lr>A@C@0AoChUcZ>qK-=C zDgVSf5Z@pgU{oouKO?p19Ut;THMr)bnC*J5x1;9iTVuMJks$4MrZZXE!i zEQ;2`;>o9uK6&3a*Fwrb4`a2rfokVfH2(ROL`=FeA$D8Tj7ZrSX-EoSMX;4Lo zzN&;T@WZ=7QD8>sqVO+nFF@)ZSEou4Y|-9u*aeOtSl*4O;vb7Anu?%4LX?>MA{53C zPccHGq#5xpgi!AonM!>7-F;_%bYEiC9G zNg5xM-#73aR{B%Sr36Mf=^llOh-s=#UA3hEKhga8rcqcjO&In-HCqV*Hf|ikv29i5M5szQUWpeH#a$pZxhtWwtUS}rDJ8mAEOz5{ zbbzFocWRV-o>Md-7{oLNO5bV*$Xd9UnR8HhLHhd-M)xXkQ0cI6LOU=skw(IA;c(OlH?s3q5iw|X*DR}6DJDx z5mYOlV&JC^P1O(t;{ZQ|bu=2nnu86P2W08u*q98f?d#Ks#TtNKCrylBl6Nx z6;>Io=dB~HFSaLwhy-0B)=h6MtQv~cz^_bW_yBi2Ivlt%ATvA0XD0XbkjUdYU|98L zdJGMUzRARiMlR$5kz=B_Fo%T)NrkCtN75ZK@6w;nP=gPSaIAw9v!ZX4V^=$AeFWq> z=pCB7vQ>IW7r_Om07;E~zx#)!@E^$Z_Da<)>OIuMQz?nIe(fJ-bs!$%!-m|u*J~LV zY%NObUbG7Lk}Y9zy7WL2n=lEgsOO|V*W*iy4B;U} z754ful#n3JE*6+6d4-}&NKQht)m524E;6kMk z&6OFKJK%JH?6B?i zJhiChLN5t|@F^fj1VvQz6R_|pVpoJu6a-YH zC<20^C?E+fkU$C~p`;N)I;op%Hrw8N_x%2tIcLtyy>B-`zu)l4-gn>JnRCvZKIO)o z2egXYJtI^C=~gqXKrR#BE@s6!?ZQF_;P|g@Qnzu5(0xXak{U4n0%?tHn*rid)^R$w|t_L1PoNHp4#9$}9D$l2>S_I&wLjg@t)v#(s^Jfe;nv4;Ob^{C* z2+f>Kksvm)AlhJ;Rhpxwm)%3K%G>7vO%adK5VDf@m?B$NQ$~{y)R6dtlCI;E8c6+? zge6%Qt*>zqW;P+3ihSm~RaX%y?G*T*mQ^_5^MMQGkv)D+D;OS+Ax8B|Zvaq6sBN#+ zN5!kEza$fSM2>UyUJzuJ%$k$KXk~9wSXZZ{$YfSk^3mm*9Fvm5&M=$=vP=c{kAug+ zW_ z;nF0VG94Zty7Oa{wNc|lv<9hmY}CV{wFpPz*A za8M)^gqW73EMx(QOa@fkRVtlhA3%Ul@RH%sP)Kw3k7LAxE6%n3&lj1ZP#c(pvk$UU zs}ng0#YjtdTOhP2&52Y|iCPIm9eOOtCdz7Wf+&JW;54(ULF{O#!(px=jzP zG{PtXf|%k65hA3Rcr}i-B4+J-OjIn!aU92Fc4t`|OerIsfR_D+6f9is&Z>jZHxrHG zlT~ z1wc|glxQ;jC)cc57(oaSWeJJ|2r+qr7Yd=}S?Ae_Sb+Ehe*J{#wKZX+Jz&v7wpEqE zLmOR?M{Om~$~!^FlfgL2+NCslihrh2S7}+$&G|zYh=BqEc}^_S5ljTvPki*qdUZB}T-7(*eS2ckj&V}iI?EEbD#9J3ZM zxlcw^Ik%Febrewm@nnom5{Zv4%l{oAlw^?BwZaHMUh825o>Bq{G;6!H&gS_9fz>gH zuZ88Vi~$MMZkV)kMaADKfFbv$Fwt7dV+UAT8daO-B4Wz~YEVeG#i*g~*QGCo zkZuqO*u~_!28tp=5fK410Kli@nDxDvvRsf=d2CH1R`b3Jt_ z1af3CdXvyiYlcAj0i1h|JH_A^=1^_ckQKMvCn;R$GrG-)r}W5_@=%r=qDF&NY+iV- z)4Jxbjj^2#6lO=kT?pfH^Ozh84?uV9RLBrQ5oM=T4N)ap;t;)K9$kM3NDzakUBcMW zC!#ZuK`JgyFAI?XDdsdoq}@@*w3KQ_w*ysaNxo8glN(4Z)$>GIxen$@bCHrhJ^095 zB;tT4(Dbvu7$k-6pbLeUhWEmE$s(p}=aMZZ>4JdfED8jQ5F?7no}t73hyNfa9svTy z<@e?^UuobHMl7&-c9*}aX6N#4ERks2mwZstq9~ARFTuH3;g7z#BtD{C+f()g0nCI0 zSkD-F)$}pE#O6?sv*oeDGvsda;&$XG5Wra2bFU|#B45CR+cNvF)%+v>zM6W4#SI1Yt z(0Y%jNl3`&#t8sDX^rx4ii_8-PSHE}xmPj977xxTYKshc~x)PE^tniT2 zE~W+%L_l#7(HJiTj4|S)BG7M9{`Yu@7vlf`xlCRfYNgG*Cx{Fj8xyHzOryJpvRhYK zFXvhu6f=}4S|)+qR{el7f{9Wky*qb2|LF0*dG<8`LX4tJRF=zDl;_IJvY8C#qfD__ z-qO+%#{~kw2oVtCIKl`cG;bvgH4Fj}Mw}dqnLJWWznIZ5F0%LK43t?;;-$;d4(|$4 z^GmD_f->%-86HkSlg}cKhUn~rGeO#(a>|fz8CqJ-6CSd?5gBJmF%HVl9_G@QLz*o+ zS+U^JrHO<4^{TCYVcF_@kpxa~But}C^9_mBae%$CGk?%C9PztQBV3l2t>MWno%S=04tGFm<8K^)@K;MU{L83mQZ2| ze1=wzY9NRKgZj<*&{^@0C?b2nb`()uM2HEI;<&VFQfAja|Qx$%JY$& zqhf6~vQd;_;6>5ghBlX^dZNUC4#E_Y_*zn#Ozl9iJ%_Oadi~~#b3fd+`-X@9@!Zl? z4w+P4E2dZ*T{nF|-m@yQ^{2Z8`u0_%l{DflABJM&wjZE%pKL?uPL(4eUD`4zO)zI9 zWi1&f;6!1fC#^!s_BFi|xiCc}ZVGCaL6H2G`zhH4`WNYJ?cYr&1dEQp?gs!N0|WS7 zgCY=)IWP$oB2-4v^}Va7b*wnPru_Jt@=dM9x?&QF(qEH6w`qhGPkOghv)JYZx(l@0 z-(NE7Ij#JJ2a#0jRlD-%^=#hTY(L zJt2BOuwEszT*NXmkvrW+TuJ1JyIpTeu^9IlhVX4NyWH2NuAM$jP2VF*fMh@H8H6fO zLk2xM)jWUGRp%ZtZqNRvJD-33#dp?N5sxsF$!4-qCKJU##bTV#7xMW+9LF+nNY2M+ zM3ucDaiqO75wN~ z3r%G4!c;O+0zT$6Ul-U8q%Ym5S`i)m(vmOq>{NZ!h=CVOnE(j$R<28klEoZ&mNZ~9 zJ-eytqc5CB0DHhq#E?ezZRi*wW_W}n0F0tYdelyyF%ZE}I#H2H&Hw>jQy81u0|d3K zT8>tbjWoWs_sDH8?a-5B8c*StmSo1zF%h5cra4(@1kEvAN%iDCp<@YQ(6G%Eoh)ws z!KF{lQ_U2|1hcx^mw=D2%3b)uE-Tpy-_}8SAiB#h*UmiQ7gwGCr{@=Z@wUH+mKR2; zD9hb&;q*^Wn>3(D=WNEl<$UB7H?QATr{E>;LK#B-1=C_2JOH5WPccM*fG&-NkSQX> zcH41D2fd9#KydA+&-}$#F8k9nFJAqVyB$QBs2AQM#~H{W0wS8De33vV8^wDQws&(_ z{56hwp*fp*5CaJSW)Yid4?WK`4eM*qJ@Feqq*nj{AOJ~3K~xu4Uht>IC`FsSb{i{HEQuD|YW zY&JkpOmPwN`Bp$W=SVnWIJ~(U9(=Kp0PecBBLMvDk;aYN<19uo5yY|4l4RcUiU8_; z1t{W4LXi-01V2e7P7D#oW+iNjF$ig)mMxIW$Vm^5!88y`KQT4M5+tYh#5O?^9t3bR zIT8}G1E%(BYOWSAxYI~=_UUP5Q^#apf3NV@m-B%5n`l4%z0tjY$o02!)5Zq4Dqy!jyrc^rX;UEhE5d7-nhIK8L&n8vnF6mm8qDb0l$E9>qC(}!{BVO50 zt~mEw7oRqycelO!o3`)SXFkOuueDR2T)VKe9jY?Gr5;un0h5X;NqsiiDMw)KLgU&a zF~(YAJ zNm;ih-Jt-yU(9imKmIKdl6BwSZHl+Zf?%!^8ipN&agn7!Pf3%h>dPRBng&6hIU#anF$|th#K9#>dJPV)RXm?!j@iN;<3qDioG|SMFd!tEL%?z_<{BJCwxBG<%y9L-#?U#lqw!IZcOdi=eMY z%w#S(eeaR4tzwNdzetGGO~twdU@LI`5&!@?RaJcXjALV>FW>ukp{T4KJH13eg*Yz8 zV3w-5*T_5jX7ROCINIkB(umvc%!f;s>+q37Y|lpl0(<kT@j;@5Il&nHsSV0*V42hw=NkLn6kKRc;W_mHr z{_56DWKIC!ULnA6DCXcnN0ftm(5(XkpSDSb>b4s3kRl1gp~^l5(0QY)yaobAnN;Fx zCNqh<#40*o;O?@$=FPgkW=S-gu4fkR&p)`U(Oh@P;1BzD@}h>eixo!JuPMHO_yk;M37u3WF(6c2293yIU?2!t;2AaZQ)u^)jUG2{uQa+pil0GfB95N6{j zOHmdu!@C#}h{c#8&ci8hmtjh-wcdp3?d}%NM3ScU&<|X zh)Dq^*+XZx!y<#qn9F3aWdL$?c2A%^vLY-Ae}De1v>x56VGH zAEOFmR*OPRk0zF!|K662pKaN9QpbwExd;GG>{xbAZRJyYnm%D$1mlPHz2)=gP8l<_ z7{`lNee~TwJgJt2t9ph94p8dryoqy_8=bb#LPxl>l zd;j|UYd`wqW6iCtx;h|?8#eHkt1q51epIm-FIutYyLUYtQxbRX9MmRbNOxMU`}CPV z`Qm@wbnhdxUtM_1tc#94bX13mij^C--2S&0{`&Gl0n~_ek4_zL_|(a#Pa55?Tc?(M z@%;^3|M;&356pQ(^o>aP&^|rBHuL0Z6Grvx*15G%eD|YGfBM(!56)R&j)X*I?8Xo7 zcgv;cPB~;~u^2B}v;Mme%ub9ZS@Z!UHt>Br;$z(Hjk0X+nlp~O=-9(Y^zBJRD>rZd z)7%BWpR*t~`3CnWjUUwao9CT0X=wj`-D+D4@!F4fJo@_5-~DU;{^k~`^yq(Ie)gm> z*FW&o9shjQ^$37~>+bnpuiB0?e)fmwmabx;hzO>P8Vmq0EL|Cnh#o8iGtbz_UF~n7 z>I!UZ7FFjeXEQkMu(HV`bG^D`h-h0K&3~t5-aC0?WO8L-!+43B0tD_g+YFWH84;o5inzk6ix4l0EAySyJFnn%oDG+zO+;W4~X!?D?4bpes_IQ?l-j%05rB(*4p0!)fLd#is?cE000|y)_w5t&f&efjUU+i?RA?Se1bV@ zeeQnaL?T-tNi6~ZkzSjmOpxMHrP)D}Wf00WAGCrp18??KX^+Euz+{o=U^Juw+is); zK%Ec}3{X&z#0Yy0;s>yYP?Ff~6h$4UOiY91LuFBA5pgwDD{Uyym}R-uCtC%JMj-4cm7gIco6p zKmY3Of1Bf~A`sE-*IYRBn8S1(f_?&P2$N@tzZrH#V z@4UIXsv?eQ!?vAAjv4X%um9)vzdoJbBehRhDV;i0z4V*!Z`oNlckz282lPI4*uX#C zcxBg4)ptJiGFhN$K=&>$|Mc44T{;24j=c>XD$0%=Iq1ldgQkrearv$HITQ(|j2ZUS z558PoSzh1Rymrg>o?SXkIb_(BLx!Dr=;+V=@{g9G5D{SP;C?Uu^y}4?9sisM zVtxQ74;$F4w&U)G# zIJ8eRv`_iSe$oBUH={CNMsZY?^Mi-0Qt7_C306+~D|**-d%2fQwcY#tqIKHaz?CvVs{3)8U|A znNC%>znR|OP|)nt&_ssvh9nJ5R9%5=BbC}D5BAktb`I~=ZBX|vZ?D_phSTDT*1{=F z#a{9)RJ%CSWRv(D9~38(oU+#><_OBmfd-8!WGs}ds13K2cu+@2HasFRV>*~~n0e

    _>@7`sGnfX|5MdjNvF9 zM5ak0wVuczqu%*ZuCZYd)3<)?c~-(%6jW81OA#W!1)WtL9O+^v3=dW!)vpml)N~l56o+I86@1Lf zfd>UL5IFl(NiT`7a*}K7MzVwy1`=Q~ldu5CVq!R!I}-+sHA*1?NoX$*=$a#Cu^2?~ zh(T|3pD#4um$YzZwG}p)g^a%QnFZdF5Dr$zkYkCH+G-TKloBtAA?0=;$JEW|oI=>o z6+l8P5WsHCxXZ%ImQYzsmJ}{5?F{iwtSP$7pVEBLT`T~TO^e1H7fRparP;5p28;or z5?3XK-=F?B-B99Wg8EN1ZMeSl6R>2}duCJY*6lIBOuY!Db>b0RuEZH4yQIm7+y7n9 z_{Day{1co&`sy=457xx)P?IOpN^6yZ@+JsMsE#=Y*h`qyl80YblHv&O7!>8bzp;Sm;eTI{Eg%qPMY_~ zN9Yg?+^X3FaBQ;0sjZ|bXfbf`v;M<{Dkiyot9xEZ-BN0aA|$DG9eFai)Qjp+8*RNK z4rRz}C_H(DdI^%@`1P%E38HvS1~R)-)u70yezXH8KpJnYF(jHhGD?C)xQqy-&=YM` zhd{5csRKp4`A7-{^(RXTd?~9v zQ(H)0Vl`4F*f1EFeO+rrNthj@@HSug!IKuRJo?XZKw|$NE8E;R&H~uGPwYm@0D!oA zApU$Yh75y8fKZ5PG%X-B<;V|B1ccNzmwdE&s(|4L_*8G4HNY~>CI^5iZFE5=w{3~R-$RphpeXWwBP1%an!%1l#s(P;)&qV6vn|rO(WfAjkv7q!-StQF9{60|4AsBrF00 zjk9^$s-}{*awI;kJIIkoAb|jf$s%JYs?7yN5MD)51+$D&CgtyC5SZYQWqI2(tuC|s zWv?hlD74WHQsc@eSlxPHP*R{^fgDFsiuA@)F=)dzflq6)Te+k8p2dD0QK^tO#@Xd0 z3GcYGI=RbHDp4kOB*pyLBP6j&Gp|N5EdXC;c;;lJiK5xk!%bn5?;j>I{)INq^w$`Y zBan&%K*q!cM6I_HJ;GETiEb=Y4k6@rw`7GcA-Nq9YI%f#rOiGs^@}a9MT%prYPf9S ziR4nYuxIb2HmXQBF657V)LUK%G8)m;F0M#%hooSB*u<7a4%7|@Midr^EP|sY2kRl^ zuEP7&xQUFZi2gZ02D^AG6>S<*R&IqrzL_AWGWK@*keeaQEM$-KzwVRw1 zc=Q2D?dYyYI;!XOX?ElpOKu-}l!Q{Wv3k!aM&y?B?ByU;t=Kz0B( zI1df{Js?_P-(D2$1k`nd80>&8wXfe&6Iwn0HWj3|4k17sND)IIF%#A^YY$*Cspfg@ z8Z;h}>%j|ZR0;L0R{msUoQ`v0hIFqRQraiX!+A<;Wl_)pTkLTToBO#n53+uCqt>-v zhAD3Y%p5Y2BK=PZhnLFhF`WWkU_APTh~mtW&gxW%o69F2j)?(7tmJLfHzI<$0u_4f zKHq0wcY6nq5n2};an&2j^e6#|yy8a{H{TXpUbJMYLh^o94@#T6N18&OSOU>cqNhY; zh4^R;&lsSPw#IdnEY8Sqxf>3XxO12xR~8}FC~4pnb$x?6uz56Qw-rzAFm_>|Q4~53 z^qUagRj-OQXnkK}GpSj(QaIJdHGOCo_uC|pw!srn3w1EWKPW*{Q)Hr8P)S$Ps_uhiUo6sgXf%*3sY#IP5iP<#0*P` zLC2gXDfgGsA&zpWg5(L_4CrHh*cjyA@Drs}Sa|GRPn}B=VtGWWJV=9$!bTzhuq@$h zU}9Jiu(*6t9ns?2mEOQ{p|=nek)hpX$~xr`Hi)K%lLa09>Ln|wa4n0OSRD?_4l}dk zI1W4PfGn^@93e!QA{O8f>=*zA7%PrR$Z<1hVaeJ$P^Z4hCyBq$s0!0KZVSQI$gp$u zNM@beXAmiSi;eE{U=hgdd*f3uaiEQbgK5!7z_nc!FU2-!!di*{xuhaMFsB6~hB`Fg zJ%!^Olysolk`#1}WyL?|O6_w1=v`N6R55)tBUU}g#=!i4XFJ48?pjfN%SR#$AarEs}6x4W1^8 z7({Fd*-hlY0kgx7;W3TLKC#%%6pC7e8^WFeqI(DSdTaPCKX2L5;f^P~LL9E30JAvX zP|8_c#vEIYykP{fM4zR#Xt9suV+7{79uX!^{1*9D0O2lROT&TBqe zu;R9HQy@B;$ZsR-)mCOQeb=ULDrTbQ1v-vs4%KQfm7>vTNs`}1#s+Hzn$vC$pAz)~ z(wiqC5-FPXK7iD# z?#?fass_bxGTimW)FaZiH=b@-tx{;ShfbfVdhe)`C;*+zX{K2EP~eD(AggHu3v--x z0IG=6Qx_`&a{36_>)tqOA6hXw_R1i|TWXFGTnX;eZFf0f1 za2E|G0k9qC(23K!KxOx`UsuPtK37+tYQv4-Sxq!SGVU9qA4JaF{v^$YjmWG(_yf!jy7=QVXbzQ?I=SW$IXfa#7;z7jFAXgmL(^$ z#=3|HXx9}BFK*tMcdVq15w$2A7!*RFl8^OF(~5)i^ks!QEFT8bR zS(arHJM4Hx2vKZ0mozba6ekMn6akG)yAB>U8lTaD=*2ZV4jc!Ye?0#1+lKyHnaU+%ECY7TEn$%FXm zx{Esi=sxnrB^$REn;AgB&XLc?d{42M%rAX>q^(F&tB8h-<5;F}36tm%NmOzHRg(-3 zNaQBNp2{yQ1fx_+(x^fG9=@{I`@?QrzU9w9|2~8OeFH@B;uxPB$oO^c2wwKW_-zLc z%SOeIMUeZmNdM;Yi zj-2gFwV)nZMU}9hL?uC!0uRO~tz~1ECXp;*EL)akkxJ$wxq(_(w|hYMba{xuqd{;{@Gi_f02YMBFrHH0BOl7 zSM}&tDkbH=X(DF&--?R=b!+iwipJc+I~{TzTLds#Hazdy`)=ynwZn{s%isF!8(~lh zQztPo;r{FT4(`>pVeM+nymilkkLLdP{FM*kZ6n z4l%424QfAj%XMv=G^|;rQejcij(vZBHh;U{=WM0x9)9eaUPCXv zuttT<1IJEHS-A40&%cXC9pC6}QMblRLkDzjl4aZW&wuQGbmA<>JK$C9fR$CF%808j z>(;7C%}V79i;6bw*gf&vAEwM+DEYytwMAB)$8Nr=ZKL`%D_1OxMtAHx@Y(lE$Itlg zOkP2-qy7CJLqaDdCftAZ<%2Kn(y&%_X5PAI|3|YIz5mVkPM{YuOQ%0Nc))-z?Q2)A zSWpz*u;Z`yzFF|;56hILE@6H6x_+bYx#6)1pUzzR^GkOO>e8ZddTPqny??(peaDFtzG&?^%HD&AG1FwBG_mf2{^(0Y1QonlD5m)!_-lB2MiscHU(M`Md zO2xg%k-@X6lJ1_6n@uBA?4Zp2s#d0&2ueAvABM?ch^_1x%}}N^JlKx z{Nh!Yb!k{PJvn)6_TjPfmwvixy_(bu=MZI8D*sULi@G(cS0l4*VbuP8fA-WBzkITC zJ>afsj2U#r%@?)qJLbbTZs=bvv+NHWH^2DR?ECv&)~ij+!zWLT`(oyI=p1vFF*dWK9*9*&C3Uno1Y*0H4=&R@7m?k_U*n~v1P3OM&P(mb9 zWZMUho=i-LG(WFqi}Pw;(dmLqhQFAfdsg0hXjzxGYdQDLXA&ZjqNsh~$kD`vgy!|n zYti7meiwJ@dDkPk1%+-fq#^?;HrMkvW8z0?e;gGyTt%Om2S7$`u~DabU{^buYj72`R)GAarWkblzLfrKhEyKAXE^Uv}m4nVp+A z?A*Lz&(@7^dievxA1Ld5;ii7qc5SJ;w~7dEFYz z$Bax*O?H^~96H{yQN1OvJTzv;4<^w8fT(lRta;Bpke-@y`fT2g{n?evWpr-QxO0of zJ=?Vy^5hsJCoXN@YVO!4B|VQGPfUn3&#K#^e%*duJM_HosoZ?OUi5XcpxqMMta)vx1T$3?8L%fHl1IqdaJBD)1J7ueA&`(&77wRP^U`8 z6>mOMt$Zec!zWLtrzUr7T)$)E`rTVKx#6XEUECq|@u)V~%h<;1*W35rbk#-eOtg1@ z{D%2w+hI@cJ95;7H6uN3`5R9kICf&;ufLyPt6Hn9+S4Arr+k^xZ_ZkvMQP`z4d=b^ zupAu+4pq)9+qr3j&P^NiyrAjem)~W_VZ*|``I64>&Ru+Mmv%Sy>||MV@WiPxGv+;U z{S{LmzN7J-k88@;sa#>jnEzBOpP_J1>DVZ%W23C@EgB6O{eIl83`#2RmIkl&v;XJ` z0A-93-ul6{u`aA%d(QBi)02}<=N0Tce5`Vr z^b70Pxv+kn?v1i;`REJZeD<0Stv+79w%-L!u4vmb!Lm-B$(jDsiW_=#9e(Y=VPoHB zWs6qK$awC~TQbX(25|c9+2o|8`Za6RuUVr>y?W!noDqsmPHrxMGkJLmJI~kL{QUW= zR`+Pz=BggudR^FI&axHX|GcKKurQ1&-jZyJ$+)RRB0o@-yZpoEdsAqHlqz8>1dgv1 zy|Z;c1`X=ec>10juj}32vgps<`=6ii$*12fvDtBTG^N_R$kYZugQxL99|KN!NDk(DJs&H|^X@c2U31tv`Ea_+=d~7|^}b%tgz!rk(io z@bt9Qr{DYdl__5p6geOo*rW4j&yTpi$AweBU%7DOA0`RQrlq#2U%S~|&z#NAhr{RB ztn$nFC$GAwb>}Aamv7#oAslo2Rq3h8YyaGH)${M~J$#&iN3ZR5SD!ADM|6h}O&mTn zJvC+2q_19{Ik}f8PZs=i&#Uj8KAQ`m ze$8sLUwf)!(}uTQamkxs%n34EjO6m)1K0ek+XYRtkDa*wsn>p5zZpQ!wkG+xRbUHrkwyY3m#>)RD;7p&RfR!;yh zY(TG3lfHOu`W#_TJTj=?%XbWV{?=AX9elzvZtQG4P{PO#fjaxUp`+S4yRc;tP0YJ05H3xQTQ@ujw{-ehw?spHVRz73d z=09&7GeP3ssrAPr?;6~#oMe*I>V^WOJAx%d4~03<}LqFECF)Vb}^{GwCeA?WyXA2XU7XZ8*%%fi`q{4Y4!K+%B}$|#dwxuU($70_l~2!`C;q=5i7)x^uG9| zt9w6pksnefCv?Mdwwma#7Pp<;#>le)=>3W**wNcV?N=+xF~z=gV0~ zPMjn{+a`^MU43Pz7R`R%ym{T0Z2=nK^x3loMMWo0=Y%>rY{#B9Z~mNREBbZ4s9T%X z*InB4@=hJUUAlbH+I2-mMM0{1>vkymU8}%Wq%@ zjCXnyN`IK?Oo5zUbVqEa-Qndr~+X0bwJ&%gV9ceWKtq@10os!hO#rXhker?j;L&w0(jF+a*-+kzq%PB+vr6eW}pYUbx$6tGP+Sdh+1Iq$v z#*&qj=PUxyqg_jr-Rf1Z4B*v|XPiEpE9{OP`?9+ad!p^o5pzua;b%9WH_l`~9&%Y1 z0K?y$^plc<3)gPEXY~63Zt2rQ(?2yS>B_Dh0Nn8WxNUp>2H-GHnYZMfSqlJM-}54~ zPSM0)*@s{IVz#vX38O!sz30%;(y1vO8fOWXES;LtyM0RlgPwnD_rW6q(iuzFj{bZ$ zfUCQ9Frj6W5dan5Vq{?k^N^R`p-YC)r8gw@zDayc{nssY=?(Jdk|ClYGyQe&h}MVz zMt?bX&tU;)ebG%RNr}VX|D@OBqo4ca>%yX_Xm`f)wUfVJ2B2rFCcX;)K6(N`_VJSd zvQL~6qx;~AQvfPuNDW;&HKli(<^Tr0^6u_~M*%SNjOD+K{^~mbS9fWL*hw$fE8mHF zj&q%dH>D&c4*zI+uTif*`}u64y#UNy`OD-*D*^Ou(YS>5c_3%b1BXuK0622`jKk!Bj^~^KP$oTHtd*oBC%0-?AHZAFXB;_k5&$#S{Jv%O(iH$Y zG;QiJ$5h&L@X*j_U;OO*g>h(g^30hjbLTxYcHE-1>(WwEhV;H{>_hkWXxBC&;oLU3 zlgR;GBHahWpeo^7EqNu2M|_01EIf2JU!C*j{fyG-f6Selm=M{zYwrsarhWF^689Qf z>1%b5QE5=SI)EkXHn{=x%-<|schNo1L>-1a21)OZ4{CkCJ2|hgaL(!t2&8R$vjJqL zr0ljKC@9s?pG+LL{_a=DBPTQu49=U-4m_P~*2 z2aX(f9VQ}dfE^Nh@MF5LS(-2I99a2S-Mv0grhw~jU-A2P0gSj;Y2}uk0M4sXl_CjX z2acUrSTtw(T5=p^(MWi<{k0E3MtUkcHi;t=6%~Km^S4Vp=52cq0H~5#M(l|sLX8TU z5sOZo$=$LiTZaZQc4ji{`G`M0SyIIK#5Q7MQo~*$*JIbh_DjlAg^P z{kCJbrc3sbQt$qBY_OCH7ah{Ux`xeh?idtVghg+=l8$%*RE8da%NfaCa@1a+X0|Xr3xiLN%LW8*s26}WD}cfMKN?)-Z1K5*l(D|&4DYyThn4sP7Jck!=V zbHv0^oRmWZ&^up!*RDx}cb>Tao@=kzw0+kfyZ3GUW7py}>vMARBrIZOh#8I`hGUY) zAUj+U5R3F;c@pwKRIMaV<>qSz%&<$5+&rN>MXmV-g#aR!rH`dePK*FJo^#gRg2=$JoHG(sRtORR zR4tz|xLf=4s#Z!)kd-v9Q^Tc%%JS{}<5aXvH^`4yk z<$H4$ZP>X-Z}0(7wOq!K9-XqPRZdP)qocMS9kG+{X!)lU#Yu??05VILTKLkx&Fq=! zr2r%)MnX(kx5^looW&mHAvp^+7zeMj-5O? zY4+UR2eJqEzAQ-*Ei4t+sbT)r5>^y0P^H)n`RJQeX@wZxuuwD+x$nH zCJlf7Z2a7%KR^BUQC`O|Mf5up~@;wj(#M4%^cy|!sq zou*lJWX}A8=O=vf^2EJa|i5N^%I^j?K{mz%iXu*EBt^cGL4}yY!s&#Y>vt;F{@l!VZ;aMLJ7@m6C z43_srxLft&wCGDMvuclj@TRD34}ImsS<8Ppbv93c_29tEUccx1Aof!hET6JqdF?6{ zo7byxeyysPwrSF%RihVg8@Ofn{y8hwS(e4Hz!n3O=PaJ`&G)sdR%%|q&iQq!U)r&C zkM^xzy#JQXyY|ffX|)$21{^r*fP8&RhF>+hw3G&FKpvRI63Rm4;;!G{6L8ACBG@>X+il;Lee>HYYV2pl(c15?eX{D9JTGCVvTm*McMXo(_RzN`&sx3yRBj#tAbOy0&)0`u zt$|Rz6V`JKnDah?2M3BG!~|$rtJ>Q)_K(`mZ6AI0&99qJ=j9WDK=)nR>D6odh|2w> z@=V~F_2H*%k_v~8pSb_EH%)!2$8jtM1mcbk06@gDE^OYc|HWM@mn&yG&X2#YpS9$t zV<%4*Q>=t3HjTrw`tzC5=_P8YWLYc(3{WzT92>R`J6cds03a?J{!Q57k3EZGX@xmk%*u9+GL(%P`d`?ZfN2X?O#XhE)`$qTIKw1~Jj=q{ zbYawwJNtgeNU}F2S!EH0vj-A=AVbXxn_&A>h+h>!&XN<+QtJmyKVh zKy=%L*|PZwh}t%Q^t99vG*oW#GFB*ZzGPXEF0ERQe&F6auk2qjGjsXIO(Vy>{o$-{ z{2Gxcrg`TlLI4DI$69fzWXdlzos;oN#Y8>G$05gY|79k%aFXi!7R=tH z(y1u`vX7lK^bPHlyD4m)N5veGgJ7j?@2AyB0 zh9bPwi{;9sU)8;*C{qA<;jSUMKYnpw&ZM@DvRq07`u3ac`?CRb zY1PC~igZQicFW#*@y&;B(+%xCbhMx-TA^%dvDm58#jTnE*ztF^zhT*yf9#r)Zr|Z! zw&P@$F4bJ`D+d6SPD{zEUZrxm3`GIAR|$CG)@yR-O+N7D__ht}>Lof?jE1TuPc`Zt z2SkYrrG_5>yM5%1pKMgCnnp9ME+vuu2ip)p`;Hv99VatAt$E#AW`Xq7l=G@pu3WBc z2uO?bI8lsx8vd+!*~ zuTo~_>fbj%`qn$|eKqs&@#E&`6F()XIZg&L{*6=I_~oy_oMil0Nk!V1^q99ml(I~Y z<9zzv;>P`M8Ty}BcON*|G^?&r2Giy&0xSt0d!m)PWbZ>E5bQ5U{C_-9Gc#d!M@TiWH?{>sPBZ z;_BW2Hvgr({6qkzK5_TVmqt8&`?aYlDI&D8e(mZbZoCq}??%X9z{t@mOdXdcAIxcv zH+km0ZYqpM|9x$rrgh}P=fKVv4C~tsz&ESbLzwWEwQ<)z0DU{ROG->o3WKlg)~S1& z7A7v9W*wVt+p(igQPj4h?5LTd7_p9%lbg3>!xjK<+|d+$x1nw>8`bi1I*I}hIh;KMl!^%N(suyE#2 zs{u^=&;1Q+Rs&!W-Q4@)d-`7n;Il<5iXT6LBhPa3^5(DE2w>{t!_HR<=7I)wSG@h~ z_GzyVyeMQ_LT2ewj}Pvj5Q$VRm+{E;SGc&qqi+AVY2&WF0Qz=Nqk|d1z|L*E|D)wV zL8hF%{Q2vC12A>u9p~3nxM$T_G4{#rAH6cLQ=4GH%=EO!uj`u-iBv6D_K~am04NsU zQYp!!Z@uR7HqE29^TC3jT#WwO2cU2JmPy7QfPojb?%u*b-gR=A|2lXCz`xoy56!S~ z_dWo9+qN+4ys|^9?#&t+$OoB(;kV}0APk9p@jYti0B_uz4d7ob8zm-0bgurbn_k@L zyl{McmFe>{jg((lxc<)_0PekNK(&f89=LAxs?Xec>+8esYulvJKj5~+goH|&nd`Q0 zdvyG}Z-4RCfg}D6Lca9BP)h%QNrC9ob5PmtCVks>CV&0?Cvz6HYE&QWveX+N&+Of~ z&Bbk7ESos`WX@Rt8Kp}B_2VQbEUpl*< z|M=UtXDtLUeaX)cU)#G`y&AuL^!%Jv8;Gb~qk4^MR~!D$XOkbf%|zhjnY@wjeew4F zgP*y%|6_ytWFJ43mYh^6vkUOP5SIY$fk`Hv8)+O*KC^b z{NBUIN~fljD_sh}!u4BbuJ~2tB*OG1s~*1g@@D7N{_WGZ<}6=J;C4+KHmX~5_}B@P zM~yJLj-{IvAjcs)3O%Ei?-^{vk>m8?@l#iffA-pL9ojUkxAM0?D`b@J+OpA$pUi&# zmVr=rw-NBg(lrkcytG-J>c71^YR=CaEpXcg^%~WxI{d9Elb;x-7=u7KdFJfMHz&P4 z^3G>&AN1HwS7jePk(QENDKmoz2aX;eD^Ei3q^ND%juWvgD1Tjm@#u}|b9#5Y;Nn(I zmc8?wh(XOrF9qQ1Wotf~?b&Pf&|8z*H?H5Re%)=;#vML!s!XXgVHLgm&G$d7-6*xZ zPcsFCp!}|;0QbK+sda<8EzYaGb;@gpPo9ogR{1jN0KWTq!-sPh2ZGYMC~9CNwve-) zfvRQW;2N`_w&D^-jPXd}&(nWg{qWU&n$@lO+k}_qtX@w~5!nvk`Sz3@;^=LFfayQ2d3ZptW_7Cn_V%-L)@~%Cb`9z_s!?_Lho4V= z=+;o(1z`MlOJ2L>n(6<(^PQZt!nHVi&Boi`o+>JxzHIHo{V!`)yZUeAo}ROA6A`tm zU$;?>D#IszIr+YuWfj4NU>8Rv{h(H~$OsPbMhU2Z0|4?OmFYik9MQW=vl>-4Jon(- zjax0Ew)JYBU$x@Dr_cT1ma7p+zImAAch<^=KAipCdDU*MU8VBt4-7kf_N--D>8Ysz zHvF-D$=Y9a2{Im_S<+}re<~;}eB#~r_hcUoBXCGEtMYgo$d~J%*n^~hnM2lCg7Rbw zDd|rfH;d)@SR!@rGhN(?Pf^rf^V>GFroy74%kFx7}?tf|4^7V&Lo~~7?e5sV=ExQlA^7(fy?szKu_$hgl zHHeAEfBR$S`(FHd*)NAroUT>5LaEf`ExY%xN|?I}s#-b{4vN&9~Ob4#Y91 z(sQAyWCi>W01&aPaWm(Sc<_U>rJes?BZxe)ZF@ zx9`u+NH0}b6#Z$#mg}E=ev*M1#)up9(n)MQ)lzG?*03PX|ue;P|O*OAGdr!X2kUz`BFhqQP<(m zjsNzCQYk6-4Y=%@t{rwBIMn{Wr}xCYm$8_{*p+>x)v%}D`t}DG_buCRA2+GrGvf*s z?j|{N^70><_{FK*ysi7PU-+rG8FTAr?xrhU7;i;buKZd(}%{X}c_``3%H*fWt zL&r~~rKB+PpL_Rx`1S19rhOi@qh?K^Ap3D;6c!cj&dxTn8=pChdqe9aKVklR4+(ih zuYBe2urP02ti%Dp2#vdiv@3q;sfR~DYi&=SOhy*`5g9ljmLr(SamcY9$3e6Z(J0hv z0y}PCjxzIzbf>6eyj5g^X$X?r1qq2(B!R35tORx(M;u5Sv0z0Ikt$qAU@(bgQ?~3P z*tX+1R8$1pX7`3Zf(A(rTch91VDn;=yMRv`F$D~n=?)|P!`Lo0L>!w3^3fJFxd z%EYZCn8C1SJo0|u9`hzM>-Gb8r(}p4U|a4)9IO_f?pQU za!_>$k-VUpNx!lPWD!LeM3g{Cfn!-#B5@k*#Dqw4gwi62Scni3#a1dp1Q2_aEp4(( zzk@txO!b zK{JVI1Ibr0i~!GAWyv01Tf%6XNEH`{*N9RCvh=y(>PALUmjy%wW3dv3930Gw>s(s8 z)MB?m`Hfj;@<|#3AkS;HIRXN)xY0hM!eJbc4JT^U>m#W#$XE;%B}60xS`fPk^cExn zlRUe?J>iAru1$Hmous-HDynnDzEW}Fq9eJR9Un02QFn^iV=2bDYtMikFu`^}4p|l~ zFj-`&m3+q*mu(S|LzceyN+Mt-Ff5SG43MQ}qQY{tNL^<|j!PI1Ys4QZ6$#8zICxa26vJTAxy*W#jg}^{x{3|<(o<8dm3-_P#8xJDM=60IcN!2J zb{w|F>L3ekl7XEPx}Fb4MlE(?49b6; zVwMg;nSDy!r>Q8|F>K`1ohV-$dQs!WzVZqX4x5>pDUQ?#%NyfM{BptOVssf9S=1Z% zPt8vuZ755e9fm`27~;-h5|J38z6*A%520K!=$R$h|LVWvEHlL#0$Mv#;C0OWfnn$G zd*yO4nJ-qo2{8t$riH&>m26b%hx|o~=N+E}Gmi3-Q%N^|-3U(!Hwc2NB~(bnA#Vr= zh}oS5i;!TG10u4Snc>)Qv_Z+bCFAyO=?yVCoTb)R{j5j2P(m6SgC~`_taKs>77;~+ zsv!bkA#girSobL%!UnIY*3=Y>;n-{wA~snO=@GJ|+Ll1GL{V5YtXV;5YYXfE7Q+FE z*%1yQp*jMGg1DpDXDs?`yI5Srh8Qq}rk{whDhsfN(u=WL^VX`ns|2zo@P`?XTd`p^~k@O+AvgoP#Ko2uNgI7ywHWW9@Gfun0yv) zNQQu7i<3+(Z<=a>@8)0HF!PLzKtcJ#>@e722e7p3!RLdBDc}BQsaSg?G?k=?$G{J5 zI*?zpoD$8&w-b*jjD!#y+hYZLsjUULdp>Fjnh9x`#YvvRaVqUAb&9UCw=@{;T0@Az z5~tx%epWgn2$ScD#8EPdWHB6@$%0gh5jkr0PDE{kh_x=g%-}H+L_{co&HI3aXBbwG z8v*f`Ivq+YUZG`0DF&7*M%xmVz|p!_X=lwS1QxYf-T*-<$;7~Q$aVncC{ZFu ztOTZrl4TZ@Z-yKe`**aKBLL!FWBEcLNU&I1{_MypXSi|*(%-a|4Kr678LV4Thaqvv zPqa9f6yU8mI=V#3J5t=a(Elgt+%<>p;n=oO1w@n1~Ua-#>o4ROoOoG3YFM- z^g>|FDq@${MHT;Quet6A)2d`2zv~yQBEO|NBzaac-~cwu^WOA|x}~%xdH*#4E(Ymy z%Jbh9_+O^~3!R?;p8*#m1v#W-BRh0@7o0q3{|STGU0pZVPz_bB{FHhc6K5hA{>fe6 z2^z2FUql3uWdRXph9v`Bzznu!oQs^X5g@}rq-&A=Ca;OG_)&U_JfDo0Mw|hG0Eb{% z05}p+rw7QkypXf`2jr@WM;H05DrRQKhGRJvyShm&Dtha8WuCTKSYr)_dsZC*e&Z=# z@-vGoMNEJd40^7%);eDs`l!X61Q$AHt?B|Iwt7X$Nh+j1aW@i5&k^eXOzr+JU z{+2Miz_>Jw1)j-Ih8gF{5+p^S`_5J6tAH&Z44w)#MB!$&mQ>*I1JC~-d+!}*Rgv@$ zf9u>k0|SFFq#=U@L2^_<6bS|pVF3{ZMKO!0tcr>eBPwPEvtmwbAevAV1S2AtSOk$E zIp+zd>-R^8(|y970eyC#_w&5%mAUtv4%OAwmAbl{l@F-2x|H-8D`OFWiIB0nrnV*H3B>$_Eh(@136exl};a&Bukqd^7hQa~{T44%xE0S#DiJfxcY$XWL&^kgw74m@{#~(1TUzU1*WgL}GIWhba3(RRm^z}BsxRyu855-7pjPF#vRvLyhXFGk zjA^FnkTr?L$xE$3C<3r!XdU1PP(c=I-vyLJ)HWhZtC8d>#vW;r8Kn-*Yb^aPQ&%M0MhMWR3xRJ-pr)iKNC(9|KKYD0ny&GghJ z6TmsyRk}9=F2jMpF?0}snqw>_G09yJTHct40GNWE(Gpf>d8)o)`hnLpgr|Tv>ZL__ z|FN8QGVF+C7?vluKuBFct0SswDx8&6&<&K`tQHlea24=HXzXLh%U(cs@(0{UsU9k~ za~4)y#dd>S3S~L`*p40xy^C{agz9m$(MXP1d>DFj^n=8dpm86NObY0uH2p}dAc!h= zie@aPr+%b?@Onwq2F;+X=zlD|&r+})?vMnPl8M%1BO2|TP6>^+nl)fOj8XL$_Q)pcbIf3QaHQIH zK@3j-#3`h_z*v;!IfkA3cBODWSz$wI)BxWK?SBCNj)Y#vq z#g?Wi9Bga<(_sGZ!P(zcdB{T$TdgImrCM#jl=Hsy0Ugk;^2FD+jS!N#DpXB*WJoEX zEVT$`6&ns`pbjnq=6@vp2WL@fQz?A;0FYMeWN{RrEUS>-RZ1m0W3t)5vE7spSKcxx zcOXa(O%$@umCa;oN-{s zTwRsbMM&fvEoIhOUY%(w@x%IEKq3boa1 zw*btF1-rc?3lcU{QP(MRNU02uh~cG(A*3~_T7l^ffyt9c5Tvxg)8VojS+aJ$ZYi}> zq00MU2%;=_DL{rC3$TDM;0t|pKPzkmo6WR-C8LYgY9`r@CL~4EB?phNg{b%#$&l8a zIT;1ZWm_c(M7XUx;Zgy1O+DH-rhEh$?2P0a7&Ad~V99A+0~^%Ec03B8DTEO$g@$I| z!HPE%FP*_nMONMb;J?7#^-w#iw#_CJxT}&lp{m#nSkka25EDC!cQ|xW7h*j!3>A_p zn0>%wq;xbkJMcRUE;Q1m7^sW_%N0m*m6agx;EZEJ9?rN?Dxu+s04g~t7Vg$*Ht)x4 z5hlDTOXUyO`DQfTNC!uHpLA<&>xrNr7llIo+o{j=I{Z6XEX~Cd7ej)tpqKn5x1*gXNK4QW!B{w#FxfDg><@ zXtcU*C|I}hDgCn!IP_x8s`Mx^N`Xy0n}zkOUmi-4I>-|1qi96iOPFPDXEdf z{0AZ$@(?LlTiv}B*2x~Xegmkoh2!o z#GYX})-cDHAnR{92ghQb^^DF0tuual=Tiiw8p+194i#W)xnfDr^l0?2`b9Dl&La}= zilSkgq)8du7ifX*GJpLa^_%U##zAwVXfB;2FWp@O=ge$bYP3PE8DvW}fO| zNdhU=Xbl~J1vsr_76XO=MIc{JHsEFi*wMNjtuU~kf}YbT>1 zD(f~9=NiMrZ*$==Rx93}U?v-w*W|U>YMy=bL zo({qOiVUhoa@(1?AX(O5vTmTcD=CJe1L&o8DI*r-7uR=skTWgDWDHbsqkLo_nuBOD znvAA+pvr8t_L%8FNkngDOb3sQTmly$G#W{Og#y>c9h1js-~KauU?~@te-?Wm{XccB9QL7QVKI$>n&M} zQcCW#oq-5|CpUA-ML%Un27FvLO{AnEF$qB)Knx%7t@Feqoh5@V!NS)l#^TrYL$v%pjxre+6rm8ZdIEklNccoig}!Pw~>=jn|v9`iW1!c4%F;ye>ecMkHJ^%Xa~B+N+FZzBcup*F0q zcL{bhx>QgCR3-Z`W2asck}^6TN|78IaqB;DNgP%qN$V9(mJp`X0f~}6^b(D9f3lx0OI|cQEqF#+-zG85n2QNSS*=e7i zf7c|9Zie(+s(rf9+!>lf2E9gLU+QUKIGS{IN{L1441EQvM<8M%0b(x&0zAQ9F?=7z z#qbLue1IuQU0{HH2!Gd{x679;6N{y~r;J#$af>~H53N;w%$WmwAJwi_)x5p?3%>nz z`9rTwn>l}huF*yv+!2ePQ6{P>Zs?Or2Ro&86_&FBasqo<+3CVruL8*Jea`-Z0wEVu zV<3prhN4qSrylKFUUW(?09{%%eRAroBIml@*#4UCv6^}zT`3SP2?QRHe~es=uqt*M zM;zjHJC$h6jEu$pX-GX04kI(*R(<18!tX{K(DSxpLzL?-Ft$D4c=K zwPa-}s(lL~iqXhGxcIj<>iX|3J9Z(& zI%1@9lmLu$C$qF2VM2fq@H`pMq83nWt5nP_2g|F#MBO^HoHpTx3gvPDtlzr5 za)sREJGDN(Q|s#{y?pO0Q()}Nm>z_>8fGx1m?}nXuuU9YO(1BbbYvoUUP@-n&dw_G zeH0f9`)J=1ot6pEE&T0|UswKlSlycM&i$sy_rv?LgX-ec)|lYC($fJYe6>w^!!_M- z6OA3M`~g6_00}Sw!aZj~7PGjy(z;>{(PZBj0Q9@*VOdSrmWR!K z=(-i_Hn%+QrU=BO<#x0aanGRX&XcznD}^uIW#Pjk7BF{{0?-amYcOIsU1(1gS$Ga) zVeqd~Qi$X^-tywcGzda%{U{cyFq;q{vKwkMbd;=29q`H+GknmUBhOy8X5F@(yS14^ z<;s?M?Y65bl*@U2))%86oxEwst`z8+q5bZ-aOj;E4}JHGZ;ph?CZK0xUUm z*gkvm5!7b7?HljKIGQ=DbJq3i0+^ENltdw$Pe%8?QKk^NnJ7EC*_nt< zd=213pZCVZ!MQf7Wt)AwDp?GM4}5#BqlR^GglKS5&PZ?##Me8iEEZ+m#t)@|^M zi;D{Hocz`&-z`pg-r(+?;VF-91oo)aVi3=I^S`~%GGu$!1QpSCy5`&N{VgCje(nc=DH3YXSIzpPKpElQU-nIICxuNRuIKBu$-Yl3H67 zkHL7_QZHPi=`8HND^zCwTz_isdxj5OwP|aQn;+OyP^d5i0O;1d$(k+OdW?H$%!_X) zuewF`-2^S%gnY-X%UXe{Y(HU0$EiFtOL&mBWjwhn8N70^M51rp4`k_V7nn^pBOoe34OmBdI*0Qh{t zB43C@a?91NQEkPa>&)vW^=n^s_GvwiY*#nGT47P~;@^IM?%fY2Px&Y;6&HQ9Wyj9y z-A)^O{^=w7pI9fq>e@|PUzj%QuIJt=lHyPw*FuD2+Z{gc{K1`?HQZNN_}LFju6ydu zmWS4P_x8)5ojK=%`<}O}&CfgJ`k{SKKC*4y>Ujl4#Xqh1^O^TQfBu6n4&dqrH;GT4 z-Li8}^+8vRJ)_Tvla8rVEpP3X?Js;Z@2*#878UzyDr&vIO~bl(oj0g!%O<`rzFzYC zbx*yi&%9CggW>b}d52s-V#vu|I@GOJxuCfCrxkxb`~KX?AAKPyR!+G7UE01k?y`cS z;x-rE^6x)47?8#e>3!FT0V_9dZFS+zyY}t}v;+e{bXmWix1Bv;)yAy@$3432&yA4c zMX2k(J&@;lfG30pkKkJi(SiA5;Yw+(IJe*NcU*GTnvI)#Typ*D4VzUq28fD_{*jsEAGD4VNK?>FI+Gsiyl>N|738Gqp!$F^ynn^X4Jm4Dv< z#4>)P-#gZR^2zr<^}5nEP3#^G`^U+h+tsaJrJ$(zrxmN8nKAqM4?c@h zXPbug#}4h^scFNy)vFX16)#)6;k8faPn&Nr+w^bK$V#I@{0oz5A5;zG3^$nrB{V!r!;JB7%5fUr$ua02{aM%q?f&Y&QJvr;VCC zb^Z@8fAZy-Jv%=+`t0swCdkofT(jCu!}>CC{{55p?A=ew77@}&O{Y^6E<7zeoo;n# z?SBqB@zO_L)|M7QFp&oWlgE@|Vt8q=4>`qLrGelDdMu&eF-JZzcGUVU+j@+=Va3{w zT2v~P{GHkJ-?&6{*?-lRvn7H5s0XcsxYW2+f=j!CCd zMZUjw^R}#Xs&&J9Z5r0=-=$-(Ywp@BjhomM&z39$k+d(FEM9BjJ*P}IfNi_?ILHOI z?cNKZoC;U5)$LGkV;*ncy?4X*o$`Brr9%Lip8z&)-(|OyU+Iwf_l<2>qZ)usJ9k$o zTjrSNO^#{aA@8;Qp}Z6uYK{Y zT~%DtTrplm+WmLFE2>wacm(~^a3xFf!Ne}IzA-`WO4OF3JO`C+4=OA#Mk$38N1Ahz z^OR#p)`7hg&6Z+2jl-Xvb&rx$3;@wk+o)e69XvLswY@q;)`2XseN>t>x^--m^1NMp z_O08r#ZcvQw~xs!mvhU+7w&oPwSuBz0E2oR``W!X4DHk7g{dEX^raJvSTVPJ#}vJE@1LN__&&_c$MI0KMp@o4evfl?qj>7u@%fEZgfs{h7aV>WEr-fPrNzpY-UC?uH8W?sSA!SD!# zBU>B>;QOV&gW!S4^FYKTSO^6Y!y?fz!99A_1+}VHp1bIm;kP~X$GQzfH1N32FWvml zVJ95>_Utd;o%5ADM&&v-Yt-tjEA|u=0BBaP_JU{cJN3BEU0XN%V)3u?hOAK!J~QgU zX8=ljsiMzb2hd>f#rq43tZKp(f9Ze|$36en18+=|=(~1k|GO_5ddGP~o}W3}SZtpy z{H5lAi{$tIT|2#d$5pyRvQSXxqgRZmRW)z!;w8h!Pg=QQ6F>ux?ex<1mk#T7^gDCD ze)o&-0JYC$-0(r^RO*#a=8b&#xt)9W0ccXY=CnJn?%cfb`F*-S@@~R@k6?*9(kCMh zl~aMVCkBCoH&l?3pLfWVTSkAjc*%9oy&2!4Did}CxxaYSq?blL{t|$6I#o2~SpW@2 zT)n@r7}~*MSN7nAr#GxoZQ<{$hE8~T$(nVZ=MC@C`RP$-kL=TZ>Nh`pxbT;7*PP!@ z2umons$ct!tIyxCeP^$65B;`&V{(r&r;=E|lFQL-0fn3UF(~GJpfgI}D~N znAH=H1G)J3q&P9J4A8j##Fwzl)X?8jifhL-33Rv;dRbaKHRAg8oL};z15cePWmHSM z4n4tIH*NIzO;-ST>R;2%i?U_1ue|s1lPzISVGdF%!VxV><=imOYL;o0!5FV*u%tch{>kq(lUG z$*OfPef%YW6FarkS&*Akwny9M0M424+^UURCBGT}+Dr+FrKEcm%IEa%(gDEGn;-aN z?M7y17H@z4?S$860ywo>C;3F4S-Nfa-isc75x|5CPOV<4!dX3!>ecS>73()&`^>*U z2<|tgV6qLqW73Ro7C$+2&b@Da08;lrk-K`Q*Or1w8iNS^u4(<+WwWzuRLT4N$?;R} zyRm1-*5SNXG7r19Zr--Zp*#2Noi^_~0OWaID&=`8N~I{3(qKc;U1YhULbv2<~($b=Qk;@7cd!67#=T{rS>|p947Qh;}TG|DiB} zD?G&XJb1Wb-NyU1L`^V6*uvb_*2789)NAf(ITjgM^F@cfgGb?S+smdLzG1SwRGLT_@ivj=u=58$l(o>{Vb9RMN3 z5F_KEn29Rw`7=wByA*UYth`2rt9(y;ePYRB&p(8D4$ckawP!Y{J7+{Ctuce z)4qbj=~90uhcy1ZVl{xgLn=f`ZSik^1O!A_^2ZtgHLBz(&>;@3Sq;FifBd<1`%YC@ z0L=3iE$P|5IRvBF2N684Ue(Ge&s)1?`}g6r^t^h z{xl4g!E(CRs9aIAkyPC()lwd9+r9VKmFu);iW!)*cXzCi2QGUUIO&5U!#gZ5pfWjGGqRtmp-0<*705LId4#(BU&+V?gNu|?Jock zkx=V}fs2D@|M1Iai++`M8%YgM&wP0^REmYvsO?U=Jd!{Hqz+i!y>I{WKi8)`uWo+T ze#acq@0cUTJ^k9P&%6fRrYcW56qC7ZR`#P;UI5^pm*3m9XMZY{VtBrn5+pD85Fh~| z;0x{BV5=?=P&dDt!qUbq7J&5C&r1O`s98NSn)q?~$^az7l2v~Ks8OYoBy!99V@(o~ z(J2IczjTHDQwZ_X@2l(QSIy6>6ki}Y)vaD7<#}s2Z(FlzOF;9$SHCO+(4a;&n9c($ zH*C(&tJtMQlf}QUGBvE-vTf~_ZBh9XY)LfBM`5cQ`mIrT-KdNNbw8C#0Z6A(r819# zMlFp;L1ReEEfTy|Kk8MhTqY~MW!IjcSFN==!k_*4@5@i=*|=skojEGRLOeVM;NANQ zmapHO@~Cdr%KbXE?$@dHxHqQX`sR$dA{2QNo5IbhD?bT{GX=ap3Z2L`8G? zx+j=?MzM@k2a4eVND<`K=$>KVnW2uE_Q9_hKd2sA$367lOJtFGrc5T4ByiceC4&P3 zBPS1H<@=$vgWc}TxOw8_hhBbrx7K7;oj}d1d1s#7t8u;BWwNv6C40<+vvlvknrtO?iH*vZQ+4jSCP*s8pdm zfb4Wi_B6P2kuZAF>pj~yKj(xl03Mq<`?JMMVc=HYPzw0IR4_xTKO4GM**qflh~=Ia z5uHc@r~2T_1&s$@2%t<>dh{9n$B#UF+y!TR{{2s%egC83LxH;o@H}tw&7<2kIduMy zOD4SfuIZ!JzPteO`e3b4d=2DyNi02boBcemLauom9;3bc3}0qLOP)Ta+zgfJojpzo z$r*Pd05?7R#uHON{$bf4iDhJReWwHj^m+e{cEfoU%0a({hI7)?kB?~9=pMX|FZ0}pO(T-anj7ZiRTfD3xT2cAd*Fk8WNiYCMjdK?q-hdGGR4xO_9~nHu7pA zo2FxHrO@9D$>tWpGbMo$1HwjE{4WUu<@m1=nv7yPo+k%%Awmz;LWeOFynF5wuIIEcx?zMWW~0H=N# z;<66HWmc!dC_M=|*;zf?H;-wE?Qix_8Cohyqp(1Zt2lr&K~2#!*CPNqWwLvAY!%;t zU_e-kHn#8DGwrKI7oFS4ArHwgl1`+_zSxIJqUB+PC1q8ja2=Y?GV`c^k)~Ce< zSRw0l7-j$kg+=$g@UMFL)kdD$=fVLee)j#3p|N40Oji1(Tdx}2^XO%3)(yOFd{L24 zsg#2~Jw4RbBK86{Q)m=&%4A2qwWUho!DQ32lgO}B!_kw;fEmET-&QRAZG|jbGR0`o zXmaM1$?n;{Wg^H58}!0QbBO4sGY7P6P^V>sIx@rFg2FpqesBD1Q*^Bvc}z&1Ru~Tc z26Stw3?WC>_sdsq*uHbt!k=9U7KYko7l1rpFqQJWln_D)-@3mnCK(wNuc~C|Wz4Gt zdElmkqT+kr{it5G$|FzecH!||!$J{=025amM;|j}gt^>Zq<1Pt>*ipqD(PbrBnGU5 zaplGx>BEydG#E@In1yw~8=Lt`76pel1DhA6luK4YtzMIP^7kb|2*lEqInXZ1hBDMo zX&|MUQL#pz(7ey^MPovFY*RdW`wNREzCLx_C1>4m;js5*q?USxw#^z%y#DfH-yd=F zeeZtq#SU#YjXrbWgV$VA3a}9!GpX-as!-mNJ_3wN<>j$+N+=S`O98Qb?ZzfUuhM6s zh1NtvUt+Mt_N&-wT=I|v)4(P|eRK`v<-N<-Zftz|6%f95aBFBirFf~E5ee|nsaeDG zdmp=f_ufjmkiKei$rBej&xPh=@~Z;vke;&l{zZg5`E@ zdl4D{rp)l>eXv2Mk}W(k83Tbsqc^&7PSVV|9wsPjg+TggtG zn4HVkZfHDobnq%(BV+)RKlps|hjSX#sMfk+y=HZ5ozSsW&vq^DI`6cf|5!71{sL&u zS}FjXKDbA8u=Q`yxJrL)*i>Wa=@=~dEDxH=QQ(L{K8#wU}fezZe|bjuQ>^ z5JCvaQl&&Ay(amGJR?A$&917Q@@sa|#NQ+Ic3-}0NEmv+72x-}a& zO8{7~@P+VwA$;~V7#Y<<1_~vX4yh1+R}yPFnDlq*zKKcos6uY=D7GUGYWR=!o2JhH z{@ypH_Zl<);ded+Fz^@^GIpR6QC80OsRBkJvl`u3PzWF|w|roO008pJmje*p4WfjX zGGtgsfLJ_*t&9mhHhfC9u1{YJQl;|c%-amT3qJq=w60%!bl)B)wQCVu=s>V|AcPVD zCNy4}IhDLgfmOtfGgM}g#FXa$5FxAdKP9{V8_Dy?BTtJ)l@!u##0E#11TlMRx6_vG zyIz?3F@PH`7z!e&6HiDUeYtLv6&XPQ;qZp_bPa}U8+ge1H=;QIxNPO`e{LvOw#+?lRCVx2hl80X?^8Fizp4_%!U8o>cBV%MVs&{Pb zrql1ZV$$Vj9a26=q6mW3(K$ju`0V?__l55>gFK>Cic)EK9!ML71OU}5S9;)|7d(B# zWo6xyl>2n)2;kQh_Rel@)u{eg&rN9AsQ%3P-*q2(!{!}3t*Vq@WZ!4sXW@f|b$W|2 zQ*3V#R&UUw8JMI*kXWi&qjE`cE{W`c0T!&zR3Hyw?iE#}{sv}4V5~Od-l(3A)K#;l zaqSwqM+~5Hh1^q*J#s+Tj>d?W2E(G|e?af^b8C<5WfXqHRBdqx-CxZBR&Ly~zp$us zh4QTrt!r1=vt4rlzsmTRgr;(;Wz;kZ^!0W4b=zmLM`zp?so^@Ch6uuWQzady+ij zTFkpdqU<`$wmkrXiCqvQnA2KFeg}i}F=H%mx-rIL=yaQ)9~PK_?E)9_Bv92W9iVDe z9o9=TXt=gKNe*_6DUtz!9QP?Pk^R*K->W1~5leYqij2vq&@RtXlN2UJov|JiI1IHE z^uWvS3c<&BZr`y*Q`6Z+OIH9mrCaChbe1VKsMj$)j%epV=J*&4qP(!qMg%~xxNO2x z#lGL?==SU1e|FhB6Ssf*(pAIyKl9$lI-hh5ie0<+eDKu|0A9TDl4f;l%EPhRH?BYL zk(+*d>7GHybZ|tk{BUS|9sAYYVxTz_JAu%K9(M2BKl_Iz03IHBMpjy_q8-<^*@+$X z0+Oz3=e~juzWEWrC*I)Lp;5`RJhIj#M&C2>5=N=8Z-V?!CXT z=)wt4Gy6ZSSasi9?`Ne_ldnEED@E=+Ag~AW-oELQlaFY1$tm5gIjuJWwMLS)k&DH` zFBU>Dh&+!{De_V}+*OgprwbPSxcrYg)vLaF*R{2(RRNHdPG5G~DWgv73*h-_!My<; znl+mH)IGJURhjg!nf+G{`+3Y}w;1kiVh<5GW|G_tl0K9np zrA_PAk}ujH)?nUaxBm9>gM*IkWa<<`yf}8`JGWkW^H~GSW@pLPn$)gw)!>r>{Pf3~ z*k&eOb`F2^5`Xkk?@oFZHYyrJLc{p2t+ceT7BueEB_qm#;d% zY3&+dctq#)>@u>?aR6SM`>m$r*iRrF?at5s@!vnLT3e?|-kW1Cs8zWlfUH#NvOe8M z^*#>3^PkQSGPCpNAd@9rry=b%wK_@=fkadvAHh9v`W!gxw#AISFn*-S z$%2U>TJPfbP?eNo)UgaXGY2tm!q9a;1JN(dkSKjx;fWCS*1G7 zoVTFo$Xjl`@bn{EG|8(_e%3dOu6yjo6OU@=RKN`2^826b(6nKj#`S-F<-U#EcBWEZ zl|ym?%=~)MGc)Gc^-sP1vW7LQ0Vr2C8^ED8tN!%N?egV)Z+`f~hvpowQVu)=xcbRA z=RG`j$Z?%IHf=Ef=VetZR_NCHusdI!e&>jRYJl`n$(KL+QisDDv}siL=NInYxP52J z({O&d@R_Nz%y8tCE%W>hmwF!EKKbq6)~rX$W6*6cO&NS_r#21i-ZZS=%`d!XV~`0c z&pSk|wj!@WIq4u(OO`?~$Z~MOM=^2A^OO$YP&tthV&FA*%zyU&Q;s>JZ`UI>Y~5C+ z;vrJrKlrp^2If_tARp;%m+`{=kPb!y7*WwO!$j%n3w{d?*dvpZgV$K0)W`NJ=CIPB0i zjq3gSLWn+pcxJ|I1NZhld&fNS%43(0xb>V<#}4hkZtM1PWwNX1RU}~TmTeEbH8TW& z#9fbe%>gW1yWxXx7ptev6*N}vl8|%N)2|=ZtWleWb$@wk{H7hdD&&-vVV~pQoIdZD z-=g{5a~v1|gkWYL2%_9|nmGNF`_Di9jq5I+wCk*5-v==5>qQql`hv;u&!^uw@~}hO zHLSbjiQ6~s*ma0*{qgrd|H$6CpCOq(GC=T!7tKLI=5(C z|L0{Z0TdJ!bvyT}+b=!mA3eHUcE*5>Tep4k^}=&*ytht%HMc^tDhoAgR5lLg8uOg* zf9ih8jXI|QFt}$I0Q(CI4L}6^{^$C3XOFr5?13jA-M&t>Dm(Y?oA=|=$sf#}{NY?* zK*oK_qgoEDli##%u)`!foo>-U9qL%MqP6N%A~vj_KP+E$^cCaBpEsy$%O?Lgy4`}M zD^D8xpyYZ=o0e3~_X%II;y{{0s{`1~gmt{Z#C$?wfu`2Dh#09dQ)#lE=q*>}gC*>}z6 zZI8VB2@%0dfjuI@L=XZbROk&@axNi{4`&tZ4KP^V+UPA?y{_q?i*7pqjDg*|)T&x} z&%XT&mMoj}_RM!?e;K8e?5uR`_Cf7RWizJIWlDj8<_bvt{r9!&+ns&o^=F@Ya+i*E zs#n>$XYahlOD50!bn=W(i-jL;D3Zb;+VbI{x26{r7mpm!yK$Ww=~N1GvqumYVQKrp z_lS650H{{!5P4{vjSBN5*Sd)G_q7|^oj3OSv;J}NQSItftGsjXzIi__l>s%y`ixe| z&?de2(Zb(WUOnXG4u>6DuX>ez1%gT)Oqx0? zph!h;F$zZnRkn`=o3`)lbj7V>PwPA2=nnO(SJ_usH2>G%9+~p-l<>I$29QXNtlJIL zb&?G~^xnrs#bRXN?u~2ar&Au}rW6b78@BE2IQow32KSa{pYAU#`g-Y#CqDT6^|{}M zTL~I-;E4c;W$QLJz4YdrPCI$vQSE9~uDEA^!Gh(hCw=hwJF-WX$Z1rgTIlA*D!JvW z=%f3xlDBNy7(76Uq;wZ{uG3HuF+*PcBtRZW5PWztZcQ+Jbpl*KwaWVAAnes9YBDWS zxcw4ROoo_V+K;G&r{;mgew2ighc!8sCTpZErgVq?YUH?xxmftxokjMs=z3SX3H>#( z8$pClk}z{QogMk4g0EF^bHurIY&==SMf$Hf`Xp#;#zQyv>C$1$Ba`ocWr~$qsciBz zH7OEUT{_`0h~%XZ86w*PFb(X{eC{A8jYGiVLyI@i-Vv)LGc$Xl81m8vxh85_AVSLH zlt<*jBUbxQJiybQXBD(+F1Aqz22)VG73u0j2)6ECAh{$VbRG-v04bSLu$MxWGj7;G zv(f6TjD7V8vPl#15nr)`(BRg+3=qY>q7VU@j)f+qCOO1-hpcTI(KpUe#sOq9m|?ZI zw+F8*-m06kF-vB(J9x;1GkbM?>Dr6;78KS#{j%-5_gH;(a+c`w3I~IP{)Q{0Xx1?P z4dNq+GgoW{-H!5RO8yc>sU?A3j**oU_?$O`nY~_3u%&8 zd!%FqdcB!I^0Z_)FQ`BKIHi^2Cs8az2LB=MXa} zQGbm%3=^8-q)B7}6Oj{^qJw}esb|~f0A8N;#rECK@e$#IQL8ZumGivR<5Md1CKm{h z86iSu=H(@M4gjT32i;0qu+aD2tB^3eHfwNHGjYv@bm?Rwu`7U4vPjzs_LC$GGk}~jW%6|t z{*K*y7c5!+&}&nt&0P@Reu$o!SqONZ60q`K!7x8M&?E(Y@H3Xe;u}x~tHmIKCj<~Y zkC?$8OY2a}3}&M`>K;l7EYHwVo?!iNnDkj5NOqt89VyNc7D(#kQZhs4niKNG=>DNXnG#37WG>sNW`6zrs&f`Eu@6d> z<%6}3h_EYdayfP;K!Q20Ens8G0+y|x}U$|D008dw0Dv}O4T%MowOx^w4th;d4ODcF#R)})u3!Z* z1|&x%vZyGeoN@5nZpYAhm?bG4&R#ckyXw|&=#SzTz~HJSF>*O(-PFw)ZZ zUsQyqm2_PJX?hJ79zB9wQ%pmoh*Cs3%rs>c;O%|2`u*sUGU6IP3W-iu^dwP$G zIS|@NM_a`U)y)AatyynDY{LP<5Ap&aEGmrrt@#F>PiL%)aJVvqF=p+^F5*A2HNQ6MoRb4kE!$BCil{=&p3Uo(miG?R_1uIg{c%n>nI$20ZtY~$la*}&l3kFMHj!g+e zq5ufwVp8!y@#ml)@=#0Rkw=i1W~73X!AXFK;8CzzZ|+5nEa3n~icuo0fs&ue`Qa)v znNx!B(e|58d&JCX#v75HQ926o;9=G-Xj%p(|m zG`S}-GtA~Z>u9vZLT>Y=;njg65y&#rTu_r%Fs1HC#!QT9LfNuJdeKqVs(S&uB9yG7 zB@Q>q(;QTQE+{7IGN>alQZ!D%v;wY7pGpAo|5S=d7or135eF0Je_gV}`Ti>aD#c5G zxA*_BJyj2)=D*M#+(*H)H`7fn(fG^|skJFh- zk=XiX$w7j2=$OrDZla)U2$E2>j@G8l96;N(q>U=GSRJR>JEpE7GJR5yy~b`shd7BI z?Y{$|{Q{1pmJnJn+7=Ay<$*x^RNXT;Wf#@1k-|EvmKh@GiC&=4N=6iTbrT1{V{j@^ z?uB&W>Oh#xmH|b7xHDZYvt+Cz3BqVYM(57}NqFN#lGagD3Q3u>L0Lr(f3d9L}3*|}1H<|bX^CY?Dl0hn6Ue!ce!)9^e$n>zmiDL@U zTrLk$We72HF(UIK@+4e2!w`-PEYX*Uk%<}s^Z*)ggD<3XF1yPxC(Fmub`$}Tlo|b6 zSqlRE*^0kc|JY_(oF?bQDOivjq*&%MgwReI03KU2DBKI(s4!yJgFe-dLB850XfgB(0E{Xwt;W z!~8lflQl;|oGiwJ$`RgWdAXATwsLZ8W_wU z7m}o1RX9v7rj$$eaAuN}S=x{4NLS}eWI-{~8*6k7M8=~o!3_e2NHa3?McuF{^pS6* znWJV6nKlR|?%5A+3rZe}IM(G%a1P-ek$joS%`o>+QBER~ShY)&U$Rm~=FsN@Oa~#i z&Ej!P(Lgx4@VPl6r5vxR8hX|t9NNRm{~3QxEIva0Qf>_)ggLjnl+ZaIUR$8VG|i?V zR_(yjy26Yh3^xJf$qn@$$rEusFE|Ia6e+?QBc<%)V*meSlA@NtEghZ&8NJytiQ*Lw z$BD0={3nKkf)JX741b?TJ*GSH!hrR>&@qObA#+>{dX77rubgIMVF^Dh(R&-_kxs0( z=6e=LwC5PB_kYRL`+p~;E%$^`g;-nbfs&-R*ny1(8lJH+Kin8Iqe2lJOCd&`jQ?pu zD4n-L>Qby1VOZH?`d?Vw+^8Bxt<<4ic4I+UV~NQUE@4-Xnq7ewYX2`WY#qKU?I|V$ zu-sTEX<2To7tH3m4_N}iq;`<4w<(ewMo%#5nl)MirB4N*DJ_X5C@MyWK?F}gc*561Rnwti%SvJ_A4DVd0NcF$sB=$o|@^Q*tc>toAB z&GGDZja6!@hz)&W6A8mXJnv*j#VBv!x@>3v`3`vr{ z2#JE{?sSd|hdZD#v)pxN&pumkZD?6Q3P2+E?65xzU;V!C zg3vm;y01|W1dIT7I;(d_co}E-{SoIJ7=qIlR}QY18n2qtSG7D#5-pWu9Fnwfa3^waTD3Kqyhl! zNHHseQ}%C4ESZjmHlbdv80up-l7(n&C1yd&<~BgEBq=q|gh*f|vowbfY6(+%Ai`Nm zM=1RnEEvq{%J9Gv2qymD<{4loek3_lOftZfDkW|+im-*h-Z%Fev)~icSnQM1rI6$c zY&8lzLdgUgX8Rlis>P*sIF|N61+FMIDx9IE*kBFgr;a4DGuaAt2>P&rYQB@HUfmw7 zt~Qh(!7LPnmSH31qKNN~u_IX*wARy&zZS}0D~uyWV@>xpMz%^PYRXHg52e!NrN~Rg zd)GM|!?;Scd28;00E+9-A$PHv|FgW=MpXk#H` zDo(Q`H$$u-3lo0kMp+|(RTrXf%_p{Z?!?KMB6yB(ErHlnYsPi#x_GtFOlX=M8!Cnp zqGOxX9fJ*(=ZGeU_UqI-%d-eRfl`9f!FM}q!D`oi73G`o~PJPoF zcm&1}D6vVauFS{~mJ?S6S)US9B1s!38flH519+^WB~>5h{w|9`&`T?&1Jr0)p?ii> z9G32OFZzQ*Pr|>|L+SP8untO5*5PQNPMvlXr%iE6I}<{=2|Y+z%qm1nM`p$<)Y16W zaAFH6wwSc7ph3vUFJk!eXm6p;+9vV@h=@Foy)--~@&r=SRwKbAgb*^by32ytT9T7> zN|Gfe5+n}?CqS(n2?-zx5D1DP%h1Z^0^kXuU(!b$;gv~v-ogP~kv z6vUhyEbXvWi~8*tPZ6dpZOYd5YdwAGStI7C_jc(O8$lgPmmY;b8} zW+IRhA%+u5RBIG51k@!8a-9Rd-jrOV7m|dE$Pey3@^p_`b%Ih6bP{yy4!vYbAqsG% zNThNbhD?Vzl#*6UmuwO)DPs!N57oRY3SOYg$7t?hbs$bRh*9>f%8e4BQkaL4rr6*U zUm;mdIm?xH75Z2bNxAaO7b#cd(KbZtE!}Gsq)j3DTitjDWBF+{ zPhQUiDSSWxc@U&bJuQTkS!w!hje%M+v;>BccFG}X6*CuTgvV4%8g0$1bA!l|3Tk1@ z*rr-d)qEy&kWhZ*O0y^3HSoC3+ji}F?5!D}e7nfSl|^F+eG-!up;uC7jS`1W&6`kf zLwW2et9lDZ001BWNklD4hCGUjBz(32jd?4H~1o>>CM>aOwiDg*-h+xfxH~f zBg!TjA*WVNKrmkvP(&W9yLDJk6n99;v=vLd_GAqYe;~mF-;eH%^Kn%|r|w|v;*!>w z!h$54&zgxPau=jCzmE5MFAnZ>6@oWy+dgN(j}s=p`R&h3-Hb`6NGCK&NPDTGh3^B% z>2&h`g2HI&IP_?1nst0kY+|ka7=CA8R0e74uri~R_^?(KY}H=n4!WW&O}#3gU%Aq{ z*B=PAUv2P}TXyUu_SjZYLITy;7$)5S(xVDEioHFO@ zvu}H7=kC35T2U#TN)>(aHh`SthU_maiXTA>3JU`v^CAE{ok|tW`4@nk9z*sQ76w(s z8aAQ01M6Fj%6aRiJR1U}TEFx3#gGS;tnTOMRea^9Q9awY1Tf}_SMPswdKd%%phIg^ z8#CmT-bb{lRW)z#{=#qn{rf|2zd!TqADlkK$O-3?}=0wRTpaHRb2P# zL!sQ&PQQHf&RwCLvSBu}u7srLU?_CJE@(OzxQ>!cmjs5yu`~eyzpP$6=$P2w^?S5}B2*Em&^AU}gxA zkk_NixBB>fXNO~kdJiyV&{bkmU2Ek!mGw73 zmaks7dc&q_d6fpAaO{^aKXUFrPWs!SjyMtApU#uym}4~ogS9tnR_YZ#RtJqbt57OK zv_>sXwCh{yT};G8z7QL>?=&B$6cLf!?cnLK7s#+u_KV>c!7qkiM52g9kz5D_8B5*M zx{-umEljF^g%9Bq3lc(kRRX7c?^#|Qad!v z$LuaAy|8cTV>g|9di$o0zF73jsn_4LV~>`I2CISd%^p)*Tg{}}kv&ZAvkb|pt^~D_ z0r|}D z_zo>++%@Lf(@%-(Tr6<~jX1FEJTsiT%+EpKLK$iFBuMJhUZXo?$IO zgn9?NgXTAV@yoJ4w>?@=RD91_0~*(;rmBgEzo0L{lK>vGP8z#;!(Lg8gz0I8HA9bJ zrmFfW?;O_WgD08`rL&!^+y{{|t;YxGN*=a&E6}oUSjn`~b|Z751wr%VM8u#~NEImAkE{eeJ4`euM5 zZWuQ0*j;nTmC(w^{^^gG$&$CY=mkyk;CV85#-d`uFh|djT&y$AkVn#@v}{%zS}F5{ z0LTNFJb3Q(4padKAS4+HkjI|38oZKlO*TKxIHCjql`7%l}l`w0&odej~K*O8Y)}U5=(qQMEgqlo=M2E*p5_L!-_nqWj;Rky9pnWdGx1 zvz04b=CzwHtB_OnwNJmi;;|PtZQqqndDotC${pvPcISDgy)*aQ-~L>GFdftOdcckY zEu+-4PG{V-V^@tct}ws%PkqY9lGAK#=zQYTD={4$k4UJ=q0OLXBKrRKRgca5?5h5~ zt{HH`g^$0Iu_B6mF+QgVv})xseMYJc|=qyqqk=srA(Hft30yx zCfqECKM;ChEL3?MG$lZ2TBPU_I{+qWV0lQTkxC(z2BnnA%M9Ve_u&_jUr5qwWC3}L zMQ{?S71^&MT zsS!v-0E4=BE?2h9C*Ljl<@Z%FqaFMrmyeJ>Psh_szxFx=I7&Ybs2K*u$;WO@QAIyP zA|T?Zuo}ql(@NdiHea)8OOGq>81wim8KnQoN4Be3xzf@#>xPe?v}yY;5Q>Gk^OY%| zEc`j;d4rETG6p(!KS?RnYS8@zXcVICx1~_dBm98F;}J`Eq2Wjz#nO*jOn01;mYs@F z;3xxlZ02kRPVd?&o$`Xmw(%05H$RYNxcE$q$c^;4ke582y?3c@zEmQ4;vo~+w4u-tPw_47B6uA5)=?N7cq|MmwTyz1h!`}SJ7e&dL74}AN}ascp{ z0rAzpw(Q)U-}i#+hyUZ8KF8ImUS;j(tuM@+eb)?HO%Kkz)z66lbZyfDz=vObk4TcE`SPt-4m+`% zGw!or3&wrhjvA+2pvH(9M0vU8uRH4>1G*hmzecr!qM{#uTk+((AHMR@TmuS#mv8y! zuoI4T>wLqlbA-xEU~rQQ=8>SX8ul`O4>Jd@}j{&(y-3n_^~4X>?bX zD9O&%Ni#oqP5Mr}f4qUx+tme>L~VCB?q5EBJQF@}BKl)URH(q~?*J-cfcs zeffYBhV|&uv~DeC{&m&bXFvGt$r-bSQj&sFdAa4T8`5{c(H-kouToG{{KN89Pt2J8 z>g+EqR%v%O_z~%}O1s~AvV7U>YNubmdB;wJ#2e4(fBW!(4^R1c^pmej0G_yP_(i?D zb-wb>=l^+b-D*|dp7-7P4^MvZ!qd<0dGyLnTSh$a%(uV&p_lZCr#-u6*PiObMvoob zXTr}~GyLI~upUl7Otr{Tx_bRhF8Qt8xOwT?4NYt1w`)-M+hr@EBh5@-)NhG*LE#>9ocr+_4k@=+js5Wuw}ahIloFCfDK!=nYSCaZg=Z!`ToQ^-8x%# zZP&8bk?n_#y{BYA)f6(3G7M05I{p6r*LH8$9Ken}`v7z}tbT{X&gy+c>jAes=KBGU z$j>`u{-f75tXU1frX9N~QeNwZ zb=own)4xmGUf15gx1hjQD>TdukCcIp#JSU;W_18dqV9B^w(r`rK@BeDSFQ+P!`2-J zR~xtO3 zeK+Oil-;>!@3J-P@+(*B+WPRWtq@G`{q)mr8I6l{RI<>^aAGeSGF;LyqkKAQi% z#KEZX6Gx4o2(#!+t2bP9O6N8g_dRanluu2$2S*NR zShL!~WvhqY`P7nC>pagJenRJ`uRMEXzwT4N{NcmzezstRr4`yf0s-8J>epWI>^-M;?{ZAr!{;vg6>7SRaU%w$Q>j;G%^&&b%RBcL zfY79N{M&0-1sQaD* zD4k9feeo{<4F+9OP*lt&V&3!gNb!SLjA&RZf8o*$t_J<^@=b%T?{#&7v2}KhMW=;VS%UO10vqk{EU;0P5d2^srY|_nM zG2q1RZ4O_zb^952O`NlM2?M>_w|s5v$WxALck#(RCQhBDj1l0$i-$F=S$*O1l|#or zzGU@!&!geJj(&Rdh>?AJPW|$S4;TFCQhcN_a}$7r1ItfCPImKHyTtJByagYA|I_S6 zzb>A1+hMix&zkTwz^xk89&~ia+Ewz_SPFE-aycCvH)u8LmOc9m0W_;qW5Gi=oqBYK zV_F|8e)-0a6uNzrS<4Cy|3BC1;Q<5(E^CpeVtJY0=eHF|J|P zw642G%=#&YbypBpMa6&wK?RhcsED8h1(l4%Aq`CGd)^Q&pcX9`nMaeFuvHv^lc=2Y27lw_U3%P8;yd2cJZD9ZT(@cC{*wiEJbjQmNGb zL&bHgR|T-A=%AqyW~+ZhJLR>tj`bHip=?`Rs`8HfQ^q1x2s?msCXb1L6vzWS29xa{ zlaeyy!hPioMn@8a-Z2zmxHW~(pHq-xu}p)$D#_|=R_)Ly+K|I7)KBIhR6QV}l%Jb( z^P?{gzUHpKzxeMG6=y%?5mZxo-sQ@KXS% z_31&z^h3)d>jQY?jcNOe4vO8AYc_8?@wUf~z3#qgUo5kF$ye(a_JF`47t>Y-%LD9e z_iC(&Vfzad^-2;1c?J1-BTwiJ;F7;TvwFj30L(mo#+-3eW&#*>>VRm#fm+0mYEgb} z?#<7XKUG@9)L%te7LXZkicopmTf2A{phi`JTUF6&@UcG)Z zfQEHy>%F)PTL0^g2DNJ*cXXTOzid{B)0SO@TXq#1s?hPdTBxK+9L-Q1%uKfUWW8xDw5zms@MaH}`{3ZP-_ns%P` z+jljnRpYo0t(LFbsHg0f-Fvp|-m7-2i)j{#D-=5=W&b&8?)N{=UGbx(*ui8orf`t1 z)NKjU&X=08p>*lLg>j#RUBWtYA(l$vBZjB1dk~a41yo&1XRF zU1Z%q!q9Y7SEB$OIJlp<9PpSE02P;&0Z1egObLzAxOZpu>d^Z6KVEk2@Kcumyy1sU zzb^Y})0}0i4;(5cshcvvCmp!PK73)nS_dpD+Le8p?!bCWZ!p=+q*k1U08(etb3tAn zfISC_;CUo(#6qy=E0r46t$p!nC$w(dFfT^}>DZzPB4~*nG%Jt-Wg_||t>5qta)_uG`o1*8PgIAy_yaJ6wMbE*<7u(tbD=uKiK6Y%@-YX!J+U#xaUKv zsPjCwMHQ2y!Qw&S2M(3kU&UDv2`^zk95-W5ueQH`{+f%gJ$=yfb(?nPjGh$y_?KniC=jMHvZ}#F4&5ft|%6+{=!ElrX;tKD?AXm5~x6 z!ktK5ra|`Pb9pU`MUgn%UA6zPr%I4RIT`#tg()d3fQj_mM|ig#b25HRT*8S}A>(nkvsoJq^mCH?`Wfu0GYc)m zEGTYNyxy)5WuLKfllY+>A`0+?nV%AQfBD_nomw>R)S|I?ez2tU{z)G^{KhnCO8Y)5 zw+qzK;&6}%eGJC#hq7jM(~DBKWp60Un8-vC!}(jGbj|S79=mRIEG;?c2J6UNp*w@f zrGPYr5Uo-ZfV`aK#5>2FdqVHEo41Yp>yu@nE&s6$B5s*8T{D8S(b5azN3P-nk&eL{ zWhowRCXB*q!kk4!-e1li+Ns%5othmb9v&i8;#`(-`qdtZY;cQtQh@=J@wdmexHlZAVgfpycxBc8nNs`QoEyj49Q z2D-JkV9r^%??91;`NXYPs||kv709qw1KVY_(T%YkDR7A(Oi5Ag3EsiYk=#z%O5`zl z{<;;>*%uDV?e@c5Z?Cw%y6vqts1v})GA>5-=%+x4U# z9UuJt*(=v?n!4~CW+vYk*L3*4T9goC(hW)vq=UsJ0IK9!BFA)Tj6}4x86yY94i@=U z4RI!AJQH1aYt!PnTdpckr7nB$*>^wtVy`lWZaVMGC$GOO2q9fVAnM{( z^Kt|760{kMcNJoXaoC4Dc+iDW^3K7i8llnRE@`yX`J3lx{LXS}XlB%k1u-rBEGCXXorN@&r` z;B{NKPhIf!Bd<+8`Q`_no-zx-$o|I=``{G&9=-T1S)j##W;cuI^?=~4j zDH|*$%~#2{ALb^L{X4bo)4}XE7F1ocN`c!lu2r>)errsG=&H>u*0Zs!JO$}}HH1)* zn**SCkN8Xur@?V~K`h!mZjO=?%0B6m7z-U^p z4uEZY_Qk0p1kH`Y0#ES-eKSo!xz({YVoashs>1UEI+`0{!}`W3_1$NrKq;|>AL2Ks zm{Y_)LH?*1a*Y(Aj(kvfR3P@o3Fe8O2At_9SkP7e^@^`GHWi3gGYG=!RA+<%z)KG$ z`!sw|KLFpXGK+B4s}um(x^q_`XNML|xm^r z+oIqSIYpFQ>GXRfWpP;*8`|utA>fJF+aYJeoJ5PS1W%6(7$WPD4f`uKJbNc40!UA0aoH(9NwdWLl*_WmSp+ zpmU2RUp#kTrxs0SEdF-T&G+xzyZ^T<^5Sr~6Wq}`t8b6_PyFSXYcJ7HHf-M|dcLD_ zGXel;VAu8l)^6DzMj60?;t~J_xxrr2&EB+gH-OIeXab#EGy$+VG$L6g-63&Zt1{H7 zR`u+D#|-Zqh*Zb2Up4}0P^)@e4K=FdcWcpvfh9j}h^>I=_>OI+-8p95A1XUTLf(Jm-&~?TLBC`p?4%b zX_z@ly&6g*PZ}U$M&W21CPea_Y-Kyj7n43*0N{!1F6!U8ouKW3-P%8QxnF9O%x}i34O;+QedZu@_8`L|OrG|| zG5`<${_G|V>VgQKcj2l1haT6%_j%?Q%aKU3JnBq!mbMgGT_zQ1wxdJ}wbT+p@`_&q zkPu!26$l31H-) zzO|}Xb#=ku5c$6U%a&gO4DHub;pr1horg-x-d(T+z@)pbZP)Zj5IoNtefpp=BL@R` z{p0yzpuW$)Y~2Q6Xuo3vSc;!zYu5odv;VO8Lja!VjXrh2 zm@`iT@cO(jBAKhC`7;K_^b$||av6Y!E<3kLy}IJjMT7bd?cL31p7GW4Osx`)$+p$b z8%E0aU;X11@7yuwFBhDt4`^-EsQxX(PX+M(`Yo2y==jPm8Q3Q`nOv}P?e6_W(sAQB zqGXzK+m&bZ=yc7g1O7DplrSn0#t!fbN$V=s-r?-pYTn_jeCi+~ig zMB24U1fr+joH69MZUeh_oc}*}i{R2))v5q^Z{gCHXE+S^kK^9x-JwPI)=gJWcwqaU zeKo2Shyc9jKbSXL?A!;~zDNuh`^Ja;?{9PGsMBv4eo|4f42`@0wdv2kKUZWQ`{suu z`}gSDvhmN8#%|oPyJnRFQTxMhOkcBgC%hzBoKr)pQEd4_gXdSd!=?SMB81gwAL97$ zJw=CZd;Ya&ZyNo#%g(vuqG4Ni?WvNVTfbIKB5c`N_~hhi@O_f-NOl_s>#)S5Gly2K z+cXc{S`OvC5N=FHSTK3PeRSV>T>k&0;0J#0aVOO7ZvUqaBjepy`vk<_s?OWBX zTBWqS{Pf=4&gj!U0A%^k8_v4>@lf9?RP@zhu2&tvQ}28@q*vF0T|3Ty;x8`EFL`;! zT)Qj(`23{aqUZnhh(q(!=FDF5ozqNJ!`L@x^#9w9cU~~`hGC}^m1vs(;5oT3p2og8 zb7a3`y0&cc%Y;WAntyZpn$6oRh%U2_Y$MXVw6Ie-_8d5P+rK71d-cVCyKvYY=bXN^ zaBr2o-1@a@5U^$Uo+sY_NP9+EjwOT8uvX1`E;tjwGt<=8ex>}`zY+d-bTqDxCv`??IDkOD}ZjA|AXiK3J;8<=RB zF~d3d#2yKt^r=}v2WYT~TL&Ji3-1Vb|DVUEtFe&uO={Zfo=4okJ`Dr&le8YJ|Evws`d~FMKfXjk${*_*RTGx_fSdc%5|HjEn4!}8z1c2YhQ*(5bOV* zRw3Q_q!$t_1OJA{|MAVMPyS)}X`6TK`ujg$M?{h!o_b?ySt>Q=>>;fiHxlDst6Ejo zfjrFH3itK8?r(oSZ^-ceJ)709TU=VUc;%WG-ktTv$Dc)k1%Rg}e^6FlK4#>Q){PrV zTB@#h$D*{X{Df=oy6?&hhacbj`m@j2zGv?zUoRj1;IobE*NuTk0H!TkGVG4AcU^jR z$L5V2sNHYX3hb4+NS!h~dAZe54XV0}=)~tJZ=De4t&+%QJv3<|pp4Z-U`vqr?=-0DZgSy3~ zWs6t;^uqKxZ+sfD3t2R6+Tw4A{q32%E*RRe=}`@8MbP}-qJw?^_`uzx&K%aady{%~ zN=nNXu3R&2+ML(seqKRFSDEzOv^h(E-gxVX!N;_2*0f&TL#3rFH*A^q)$+&Qo4sq_ zfpFAA!&)_`|KODD!bJnGF1vzU{iS}R z$0Zao20_TAEmLNWsdKZPc^-Sn0kYr%b(+C0& zHPCL27zImZXQxOAh*Q+z)E35RCV2=>C|ELLuYGtxZHEf$P745c8ZP>&L9OanoHF2+ z5vSI!TIJhcHV(S`i9JOJCFC^cxI2Li|;ig33LQyaXi@BoBd80kp(w?kLAQ zTR)~L7Go2&vwhVJOV%J~ly&SF>${7squnBVnXEuxL{Q(1gd$L7ZaJ{`Di+fP8@)heKH)TLNSepA-Q#FX%rYKTfI|wo_TE7 z`!60|t7?_;pDgNs`y)~!s{HBN;Eaeh?t!ij%H%sPD41jdPg z8}Uc(F}CNwO<|^cDxO?juaZErP5&9%(S#Y{KFx~BM<#8>JHROTiQM;5l}FCph+-T> z&e7e(Tca&lPfbXOuoS^kDi}>I3cWaF-29HTj8!sJF>*^;xDp5+2!sT|PXS<$#MXZ0 z#0)hUF08;o%wjUh!6#LT*cC60a~$K@p5 z4{G_9L!~&>WS4S`6jV>m+LA70eGOPFtdt8@*-W+U)@ALS3*ZpZM3%HF&j<_Y{iX-9 z@5Ai#gnBG8Zx~_N+{9QKK@5zXa;hjiQ1p-4^PitNZ|Tn)70qx&A4OEH&`yVPhK_Q2 zJorY8Fd52)It&N$R$*V9b3ro7hFFH)km(RZ9Z|@q!8pjyv*VQMTyMd=E^iBR$1q!s zf*jB>(pWsMxzzb28*&ISr#g1N1@H~g8U=D_CTxLr|3p=uDXChB%;DxigIdp1&x7ZI zJa`FsNf1G7*Av)z)^Tf*(ppC6ZwEuds6UIe#%Fx zjLOS>-zUFZc!cD+Yf3eg0&-2LhAk1aJ7YeYSqEs1tp(Z1OXvn5Q zGTBUTYh})G%pm33n5!{1J~~a2Ss+5yN^Aq_jt#?Ni)Luzrg{`h47HcwHjg;iX+fbFXr{^&$y?3X8n$4T zY3&8uz^aY?#b}wf`_x5)WYDYKf9&bP@*mmVE}v*`mn^RqgeXCt=OIBT0Oux{iTTRGaty#zzmrC>$0yd zGTEk+u@otuHiMPe20>)4F{q@GfQL1)&EO&u!S)&2MCnRI7_k*M=IlsK$yu~Y9#ul- zvo(V(T($~|=2E1Tehze~XhdXqmFj<%GSuK^w_3PuMfjQpT(>lWXvyLzR(A!Bn?RAY zi7f?;8SKkVD9T~V(c~0E#UW)lBx&?hiwQ_I!REty*t7;>51vLhDrIP~?di4IWdK+t z=T#7Nqga^@8Zrg4GFjX#AP&+`P$MX_<~Yt!aj>8CfSTMvMw=!MBz(SbBz{qX(B#$H zqyyOnrou!4bwi=bM%F^B<5SJPgLFOmU{kYHroLI|IjAW@)ZwXMmSC7!Y|n?>+V8VZ zM8d5qq7fL{?6>_9&_qJAgJK#JejHCeF~TAZO{aq=mwqE&8*`*mvL>0P(rB!#Rp{WP z4JmO^;Sc0*6SObru7dSUF2s3q@0@VR-HYh;Nq7{mHiik%B{=dCsso z2*+xYR3PT& zRZL=^RVyJ(?cgG@$Zz+Yg$F~JOqQ^PvK=i3$2N{pOXWeVwI5OUsRfWC5DB(AI_a2pd9L!+V#U_LCt+85kvt@&3UX~cP;#15Szsl>v@|g;X z@d&=B77kpZWFX2+4CVmzTp{z2#eX7#CvK!7DUb~EP+~)iUYo51W@n@l7d69eb{kY_ zAQu;jkRphfTC#9+mN|{SrT_{&jml!PtDs6r4#x`Xg3*a|;V3b0s>-vy8~%*pN|8;vMz^`{7K<8VpyGOQSwx=a^4;37m<4EK#mCg?N>-=b*i zL3W8E+U_98M(eWlC#!ojYLRt^dq$6<{GiOYSk&1zt;B%1>{Ggr)fx>md>}j#iWtemBU>w+4yTN* zT!liy9M0xTi6}m6hlE{a+Uiu~n>E*TIRfe3yVj2cYGk$il&*Kf%$3Q~PsKU~n<_$l zO7U&waPy5xxnPrzpp?5d1%3#PUiMIer1mjOG#R^9YUK$!bx zYbP*#I9;9X+=|k{E#pjob`;%U<#taR72T4nZiV`j{ZE2tic`x7h>RC=`_g&jP6~Hg zhK)Pb;)pYfLQ^kb2L?d0-3M`_kR6K<1DYLsaE-HwWTZiy@fU#<$G)|1Ep&&~QdQM7 z3`16`OGGEJ9xaX*Z6VdeT_tw0QN-XYtxKF@lVSi!G1*7k5FlbvV{VqS6z5=7dhpq5 zoBESZEwrG){gRz@%qDxdgJXlfvBkmEiL6{MKYk_lRJu`Sc+ z%ZL=s?bL<@U)-r;F+_uoqZr3ms+ptfHzSxc*qAgyE8*;hw1nEg3V+fE)eDIznvh6< zz&@*b^o5~pOHnf^17b;Aevp(RXRzaW7A>;vQO_cNjhVeDPYSw;oe0D@yRAf4Qzwvw z@OD;C)LJH~M#m_2mMR>%vY0 z(!UJCI=6YOPyf=!V%px0PtN?bP zLPx&~NJKM`LG8rSLd1SqQm2tHe50Nk1{tl9L_J~2wj|vFzo zrVmbmAg{|H5AZ?0IDg-_R7;AgHHLJonQt=z(=!OQ(pC+k6_QNMJ}OIaTpc>KmZh>! zNefy~=DYIT9bKmyErJ5*Wln4hXy;R0e+D18?bR~HprV|MB)O-Oi|qR%gjsKcM_>gp zSgYN<(CBD$)KRWN$eFcz>#bSLWGl1f#uKwotrGa;6S3IRz#KaJR7Jx%;H(8IU4y-* z6`*UetO)ktftkq{x3j6dqODOBO4^$nTu;wT6TyIs0DE;TD~jgxar&T}g{;p}c$hz7 z=44<7gdbT?(|V)aE)P76${oj2IWTA;SY)xy82FY_t97vG_NMJDM?70^((<{=i0KL> zuHc32VE_P>I%Bx3dPM->d6e)xFF_tLz&@vZYj0FGY(BDDiufY*dm$I~L8(#Y7?Ali zLt>#nvIskc&q_;BoF@xmlo8oDa*Wn>9QL5WSE|DzfJ1Xs>wBOsRbelN>q z67YyTkM)LNJHmuSMgn{AeeyhJaZ?AZslg6vPR&NW4fdicL}3DOnTGtP9!9PsllmV* zB94a1e9)9H#zKYTk0*X9q@jIB@wAZVM0x^(I%_2D3m3Jd8o{m zTB1}aRx7^_01Jt*aETN*WPga7`%&{Y9aD*Y7XqG+W7@MaDs&{Wx3b|eb`}dVsqKkY z9Gor?KwEpWVNDLvoUEc;%wk2%4h>5yu@^tVki3W0I-<|)Gx@#=U}qbK(fb1RWGk$) z%$Lri`I`fO%&=Bm1?7t0lHpEw!&t0potYMi4qF_>N)-B#1uE$tR3u3rE#^5ZEiOVj zhR8h*o_69&!6}%l4-wnRFy^D#xS_c!1J)7emgr^4!$}_g$)E(Y&k}!YQ4h*9EEhb) zd7&~$hnVD7b-=LICfQPuVBVew2Kiu*i2?GNH4BJrzR_QUK2(k?5|Ly}O?%+t$r0m| zWzuk!6-b_kga^+fmYbZxHp5UtPmY@{gF|OKSf)T6eidBfP)dYEJ#+5pY=MQ|a7I_4 zlABQhQGWvaMA9K+XS9{d^jxBX%63$vLk{^siAr${TjG-3ArIddM=WV)CE%(rteO+X z#Zh{65O^$d8iutDBRnYb=u|eU=+{MIW)XUT*=g{y;A2*i|EnTCz)F z<;!|!8v!w8E$X50!(jHXN*#}}yQZkr^7Ij45xrN@6kup%eNy}++Y~`QAx*>O&9Vfk zEqd&O37*cUf>vxEVlQ-QqGi2lot!F!HO5LgV-+DP;wrQQ6JkZvgF2o`Fr=Wa#>{sA zNF~G*7a~fLCKmieOeWauoRc{{P?CwPOF|$|#gmR)T^X23K-Que#2^nOL`6zDh2#M< zR_|M#rC=KV7nonhO%xjHbh?o>0m(uzOL7cMWVM#;CA>sVPAWgw&q)A4X&Fk(P*!G+ zkn)*X+*BaLDS}a>4$)@BCN4ujHDMQ|Xtl)>(*a|vjKR&2R#1w&SSXQ2s@GMgloRTwj;)%mc<1G7AAEM) z9qK9K#FRB8kJn-H#F0ySOd{rcAQ5?IREjmtiqqdr-{Z23ZwK| zPb)&~N7Sso&%D#G-du*=luQY$ks-nL;zF6IyJYx`CQ;l zy|b^{xo^KLr<9Kdb!u&$9K0R6-Z|Iq+81|;W31T_5=@+zle}@n;0p)!ZQHn^@B1s( zZ+>ycyjNz=Pe&Q)`>nDzOUB9)39szEmjD!;eNAy`xu}d8>cDzHv-s?oJlmfnLE5j? zF6T*4=x09jj{QZSt^WDZ8S}ngw@Jm4NcCPE$d>TDgD>3&pw5`Tmz0<58dw^6VqHKO zg=}nEDM9ra4BBHB>WHjTKoiR{GXO`8$*O3EY!Uk#(k#sB+T)ISi!m?5nnc9s;J2e& zH3zWr=k?-ilZN$cRI9S$r}ZIwE(+81$zhNbL_3c6NE^;$NV3k)%l-J7zx3VwZU9@ei*yN%m-jr!{|i@sX}FEOM~*Vq4g?e9)K?t?{3-1yELC2=r?o)DuLFEjCuz55%UdyOtt zJab}Rj*2a?{O$mD?A_n+ylW+XM8(tonU|APucHN*RZ+V1=ktd4JG#xr9lJ+8G;ZOF zwE%`3+xd+<$NcW(ep5gH=ADIK>q^~9(!{lf^+h|S;bs|d4l{p;&9hBYapV^)8s^^t zXQ??k4>TOHLmM;QA+CS(z%o-v9t007*naRJi;{ z@%F>T%kKKeTL3N}G9Z5Jj19qZO+g;TnU(pk^*2^AGHi!<*dQfb&7dtHk|&Z3pR_!p zmK2ZTxzgei=vu04FzIP*ZmH4A2U(me0NlaTio&&P&mamSb$d%Kx2IhO`XOaBE5Hhq zqC>^Y)~>(!5de^N$bAn^-kJuilU=cJ4a>$T@cR=#lqbaqiP^&-&xD6Ge>7 z3pbCxYUrT8*WdrjpMKw@Ufn74zrNy$@lRee>UXCcw|@Js%g4U_)vC3Cu-u3jOy0Hc zK>ahXxZ{!$qfZ~yxL%ztyY@_&z3{=;W|XH=0GQo5td=ptov#N(1YokfKtl-(5x=Ib zugocpZ4odo-It=UE$i84HF4BPmUvT{Eekb2H|L$t7TDCcQda)$+FxFHfA(u1&6l>jQuX~$C-2&Kp#HEc@3?6A zWv35pT(9nyorM!VocG|Q_sUW!(*fjua$6mq8Tq+6@67+|_EBf`?b!D7m1}}sqY50D z`p>HQdG*d2vvco$-Riq98h+pCbDn;8)=lFksxc1sGC37nyRAGAVl$6#iUc5-z0(2fBW->7pBjB zZSLX#*aPppP&Gfd-UT9TI_Rn4Wi|Su=(;erYe%UGg z8`rJ9W%r&5pDcRt&FONCKmbp=<;sf&_O`1yG-aIrylv0EhQGVjdTGVTWts@#{xN6n z#BoKElk~kM-=ER7eYa*uiWdaD`iBcf_3373FMR%9{dxQTqPDj^!hjEY@rv`$?9p-J zg0JtN{DC_74L-pm@723*ty8_)-(Q*Z?T>2(7H>Ro?}0;yuDE~fX?=U2+Phc%I<@y6 zC|bDeyD4+#mZ}9yooZICHf-R49_`xJsac~umD;pz``oX;`E2P@Cxknu{f>PXej9KX zIVM2_!*J`XjAoQpD4Ka24?LdyZ@PHoleb+XK6hvVUN*~q>wi0Q*^j?;J8w+5%JiTq z@X>5&4&~P_2tA4IS*y0==I17fkn;Wg2a41h9st_DyYSvurT_qW>dv+agTarfQd^7y;?SPXUn8UNV~xKSku}FwW7Z z_J4lr-17(ay7ZLeJfdF<_dWjhtUE6}W5OL*9zFUFfw>0$z?B!Ae^S4XmwaEXN|m#Y z>wfR0!#Xu@eBOO8xXOXOzZg*t5?d~kTumfTNOWtXPD5SH_1*0KoT=Qnw`&*RNA+(YOa&9@zlE zjy?OTS1B0KrNe+O9r|@@ckL7Zbk3gx06cKT`RAY5@8c!kRV&CptKTvAUUqJ$mQBw6 z>r*C&)8ZihPNW|ZfZSyAtxp%thh z1SLEMF;c-wR1>7qnSLS7dYPY_LqN*+4~VW-Y5Sgi_fC2*fOmshH5NVbmzE8!8FzHs z0Y|s(*RjpD&rOP}E!51=OW=V^N1Q*P*T>(ktX7bJR_|{2UU*igW=Ea-@C!QMo}z=> z_UzMW0MK6nY~QP+jRc9QN&^IGNlEQ_a5YGFG*oL>Mnqz4+Pw!rjr@E)0DBG|+Aj2I zpni>N0JiTd(zWl{SHv>P1``%6IkQK{;XOM){LY7|R2dj4z-M%6)x1viYWs=~E?xU` zpySTyf7~TQPTjd@Z*gg9-I_JdI=)}?MhzdHFwsV;UhUfVUU_-#8r1>pD=Ny*&28PJ zaqA|Hk8aiC`M0LHz3!wq2Ua>t;^4Q#?zagDMO|UWiZWyJ#qw2udtqYJM)fZncG{GW z7ks~V9e`vaao3fj7Js+;!-Y$J-B}naRB@x7(qf&N+uC{u!v}lX3?gGcskN3TueqRQ zqk2o%Zn*G)mwwpztLJ%_p4{i9TSku=e$vzhOJ;q!9LiAfbXK)H>ut*IA$NVq zx9`sXde+z9&t1A|`OEjUZQSsZu`d%*rxuOR?%$(v{kj{s@6x`HnpF#Wwr|yW^lb-A z%Q=zPzGamU-Sp)6gT=+=<>ip0;p-Zo zy#BJ5M>bfx=9dfq_T=gfn>^3E^t6Hh_|r9GMhu?1;OkjmEweFIJ%4LaaS4F-&5m61 z(nIH*&}TrG_Vbso&d|)5L`2`L`DMkr&F2s7bJKGZ50;c>C=k<~aXz;Ys{x4MB@#Kw zL?Xc;V;XQMuN;I7bFHFtTWAJPUUgy1hV_>IwBf?B&#&IN)$_bdPwMxN8%K{Bdg9bC zzMZw?``{hL>FPJ*Ub9L;&(_U5Uw6;J;!*(Z8aG_>)II0)J7&PqZRRVF?sYG`cHIlF z0Z1miviDvD(ERte7fbKDs4M8MP@19Yz_2D~=9+5&a8Mad-(4a&M_5WXPJHjCN$&$l zCK5&ecmP1VKR;ShRt_0#PM*YwK3nzEx}Am1kEnf0=XSHc`JM^vftgS2+8MxS%f2g5 zr4p9@l9!WnT$fI_Ju`08wrv28?bzXl3(oD*rq!_>JAAcrmCp9Np+jodsQ$zH4bQ** z?vBDe9-(K)4r9(8d0dyyU#?iWWaVnzNQ7D*YFHMHcT*^DI(;w}h-SU?o7WW6q%Xc( zb?*xkKmB?+fU*C2i$9y1wn24bQL9LYri3X>@ zK5>fta*{XAtA$2CCB|*@&fNswx_d8xt-JRE#K5n+_X0Sgc1>2B&;cY9i3caWcd(>X z^vvpwzfS!43jl+U?SydkY#)Ud9b?G=gII0wV364LC{Of=40dL>bavX7`U&J^4aCU` z#eKp*rU(mygGAkjj9D_59)0iLWZIWa&t!>-v_`Ye}C%7bsIgOQSQGw zeeUz`dx7N+g1xJ

    =0*Qnms_dXtHifV)$jupfTu%U(Jo@75javcu zK9B!s!MJI20E}{dn-#(>neZNbbGnd-09J4Mb>iGF01WQYsd8u&BRHo3u;8(2sXng5 zBIcmpB_+zS`_8^tM=lsbg*eC?hJ8$0umr$4eS4%J&Ie~Nk?h~81Aw{TekTk9Uq$QX zB$MxbwqV1y?E>&uD_4EEXfc3eJ9g0Z=I7>hYug6Evu{q>Sy(9a`L9;2nl^tSfZm;s zPS^JTXrhXdzfP49ihA5bOe&lO=+d^O@ALORtrJhWv~3As`Hw%#*I^!7iFU*=gqW1E z0u$i^$4cX-^=s$lBzNsATCsk!V5s8vyl+WNRTe)WmfuRb35 z8PdC(g`t5w@#6(4-@k0|3GQQZzpCa}TwOMuVvU|1>E)ydA)pH#mc&i#)y>OE?%ID~ z#rjP)*m=u;0MPo#2GE4+pr;yQ2X;BW0|5AL{bqZjuHLj2K*QQKgY%+d>;>W66bL@5 zY!FM7S2ffsgdSLulEJSnT3Vj+k89VmLCqRMQub=sx_UwW*4>4x*KbtWO`BJ(+hBpA zA2)0OP`^%X4gQE)H9exjeftadnteV1)^6McpkA$7s(5^>O=rilqjV`kAttDMODd7% zRsk0kZGNT)n$}8HZ@RQ;v3BF;L&YV6%XMkn0#YdIvRcHF8Ii2o!)`W?couxCJKf3` zVcb}}8_=hU7v$yu*mK|@*f%@w7=`;)Him96HNr-l zEm0Wk+w+a2#Uh^^C@ux*L%<>S9Va}qBT^T$dV>ul`Hn-qYMnZ!COnCwG3-&*6V_^| zD>iI*(c2&itWdIV1g#EB-gCp8CX%yMQ8dVD-pZ~gR&#bSO59!^lMZJ)aI(niMle z77<4tDZ`;v!;BcPP1xaiW&Z}WZ@{e~a;cvKdE>g5#o_q`VEeuUA1?o4X!i~y`gDJO z_Iw{WxkncOpDbPOE16|nN)KW$wUG`wJHU7T>d+|)~fmWfP9-x z63o#AcG}}0f5m7MhPIsd6k;HmNQ1?YCkc{cM5z{J#wnWPQ1oXDR+qLdKU=a~zv$AY z<)&>r3it09Tr>#HnnY361z^LOKzgb>g2*YSMJ^z_l3+Jo@9!qLC6J-_2!a6?e1Sa? zq$;5Jtm00|EVi2}wczpORlVYkICe0AuC4G&8Nwt_&5(C8d49_C%Zba?+j5X65FmL+ zB$=Hyi5yNLXp&mcL(c=r+B7Npk9@HeSWg?DMCc8}6Q>if+PMhQ^$1CAh}!8TXC*aA zhn5XQsuU}LWDCxa7zh%ywYe~gcTAW$_w>F!MxQb8^Y4FExU5kHN;C2=25ZOqf0Y^xoY@pLVd5?LMnw~$M}EpL^?mWeM4xg6 zBu@wtavKzZCuB=Qmn?@1spAHnSAG;-EZbK`(m{(bb zZZlY2WTVk1*-1no@-2e&N$hYIQxzVuC(o}+0QBmDB}2P+IJ-~xXJ^k(|W44k^t}WbE@2eu{RLkZ?k~D@ z@Ci~V#-^xt#cAl3U+0cZ?=M_Zc%bOgQ~DdB7^^^5AVqZxvp5P-GVjU=!fYa_l(I^} zX_}@***4aZAVEZ8M~Cfqp;GDUb2kjgGfr3s6Gt^FigCMIV^m4|z?zsQsA8c?=dS!| z!>&Eej;MW1i>A%$RL{@NS+#lV`fWRM3DJ5;79_TPci}CMtK$Z>{^~Fca*dJz#DKnP zBIBG>un;x~k@j(AQqtI~_GA4e{4P6k+_GcW1OIrfeT$}NpWOf7Gv=(@{3{66s}$UD z;fT3kEnBo~1;jzRaVaoE;_?LX4j`A+bSy3{Wk$mDsu$$%KUA#7pX=AIHRkLgh5HXY z{nkt|Mu&<^0Mx8nz*>MYz+9_Z6#$2vfWYA1Ew!#74N!aPl$DnQdD0i8T2PRe3!t>D zOx0x_PVM__Zv6G34NzvaGeDCTscSLfJ0(ITBlE%yKy`BwL?AwSEDx5`Mz(CFgl%oY zio_($D57hO;3@9hu`nftAzQ*J4MCKYl~4X;;nl-WJ-S7cz^g;Wr2uMH3%WFGRjZ2N zxZAke3ReV~W;cg}xk}2)CeQui>N8I|x_RSZMnYM63L(E@L2fPpYj0U}{V}Q<>mjr< zRzMDiMNe^Q83PH=tDc{~zxa@TUcXk2F=w7!c;LX(@6HymMc>v8Ig@Ku4bM1;Ery}C z=Kv@z3+}7a*r^s(G^uVeKq7PL!@om0)!IS4V>vi)1+Q*WrzU{CuJ2cIh_I%qr=$EW zp1ro+Q+3{bm{1L$2&%Sc^bK~!R zcKo|@76N$w&8c@kJO1ux$NOn?NY zegFFVb5HHn6_BA^8-CqUQdWLM&FUSS9i>BY01WKj0l?Z#+YHX0!CWj|6y)Wa(_mc0 zHf`StpmXbH_QTGtn*-RqeWx8oCR)uR9u)wrdyW7RBJ0FN5Xqg_Y;E}mNv9yr#sWcP>#VRJ=GF0e&$>N-P^Vd zyxOpBXGvN45jAUcZ0^X*f!&V=uy*s-2voWk|4Z#={ZPU)( z06J^AP5_~E%ccM}@7%4Q*z_RjGdDMSmPxd&oOw|zd7%`DzOqv)<^Q~OJAi>*+uP62 zJ-*jpFCKnskIs4=H*DWkQdWLMjp`kn9%<(s*rh#ywOh8^4`th%H#UtV*%h02g?E2d zAo+?_d0sRzr%RDsuEJ(FsbW0rm`(t`S-06nLI&w6JoPpemhXhBN(}ND%=q`BrRBcg zvsKehO^@=KXDV9w?M(5_ii2Gq?v)UJ6m0NZyL>gCK`d-nRwRrB+kG-}9} zM9k02Yf!gt&Fa-F+vLbjIQ*^`l?-}b)WgG;y0vSyXa9k9Tej)10KWab?%ep0}8l!<8Cg0BHQbls&*8`cxgE*d;=X#ZnRj zFRck8v^ji8-4PCF+)!T@cO4;*f6IpUIyTy z%g&W;CtNhB&(L07edZZoEyr(2KJzcX?f@|K*wCh$aHzhIU!7wEMxp_PzT*TK?nFM>T9-zwY86f8McozwZl$ zT4|dM0OhIFu;cqRX;5E)>2-96)B5xR@bxOQ-L|;2Wcix40Ioh~#F6zR2WxR;qrd*) z_mACly}fzke|IuHo>Wf27=9HyzyakxI(2K;YMI`B0d#BMy68~xPaC&pg``{_3p`1i zLVm(5og-t%zkO<-9>;a<@cAo`7VbZg@VpvTs{oiVW8ORSz5qdcCI9%$gx(!ncW={d z^~6WF7w)T3wLrLQo`3(7kG}q1ibL1N9{c+A{$1MLdC9OF&N;29xI|!c|0{1l`_>Eq z#2EYPJ0l16?b@crFYmv+ar@4iRjbshUKPN@6Q-=$xH;&&GJ7_(8Ih)aL0O@D#>o?o z0#%tz#g0TLB44^kO_UhPD9tubON zH?;4F0m6jY^B=n6d2zGjHlIIrPvL=s36E-2DF86xqXq9Q_*&cdMEK*2|L)zc zW%pLiR{vw{_C5P*R8cc-`kdL{d@le?m~YP*+3%RHEt>rD$|D zE!#}>8QgM_iJzM>_wmcmoBXG%#$9uU{M;`dIq&p;Up?x7iiVY^d;rszt-5x?yP6Y< z5K|v`b-|J$-P!|~y5zfZAjOmtB9qM>8J_2T{@uzaZWyy;&)$N(+-d~{0KWU_=dV_- zvVD`UPMg`{4~?2OZ1Bj9*X}DS@;p!ET=wIdc}u=Y+eMX1S+aG&ZJWKC5H%qx3aB)e7=;&+k1@)c5i~-F^9a!%pbcq(Qxs(z1oi zR*idW#%mwWv%=T3@Kf7z#b-w-N_U~#RdJ`++Nf$K1m{C+-^oeqMst#?OD|;l3i-gI zUd&K3KrsTrE-lVf6Yd-n+^gEkQX&fcI8YWDsBGeg^B(xag|3$j0JazI?RmwY^x3Dy zrDcm(u6g18*>4ClF`Uwiy{zP7(B)viocPiF2Y!E^7X-q44ixph;oiG18b0i}W17^j zTT)uKaK(?~rhfd|oP|mv5^GsS1menqUEnED<&o9iF`-Up>rq_lkD z%C+OB&v|X0V^G@2MKiIep?PZR?6UImF{ck|-Kaq_;Q^>!y{cO(SR}YrD(DAyN7qa` zHd71$(6WAA06z21{Y9Uy{`ryVbC>+G$pBPCDl$L)(ZaIw)YXIfv}#Z{>3INZRjHz? zHY&0YY}&mSKuKBotZ!HP4B@{6-^ET&xN zfp8Q$8$hsHsgwt6j=?T!CqSr%Xye6tr89(bm>qR--D4FAsBGbih~Rmerwc~T8V6Dw zUtFsq7SEte6iv?hIz1S)6VvHs-5^Ky`bqz1cs?#3j4O2p*}(QV(82e-Mk7 ztXrfvDaKm%!O3dWqj0AhJ(u;RyX2>Yw}niLQtbO|TeOyBHXRikzaulp60Xfm$ojUdeg@+hU#y4A}dW&XMxDQpEA zlU>YweU?qsULeC;)H}^vG`9hpPLTYER2LcqSBH>jbKi@+l;pG!@2_9kE!}kKX;I9vqmzN2!o+b!=DXZyNXFFO*9|(MO zdd@B$nx8>F5E)G5f(nvExInyC4gg6t<%pnz|3ma(K4+MV|7%icc4f}&4g|R!VXPA6 zRV3xW^mMoiDVLolR+$&dS8uwP1gB!TEiAx~5W>irn+zuSAQ92SaysZ}Pxrv700E@o z#j1T4CyGg$J21#&_5pdXHvks*9FGL9dG$my8b;ga^9mWmY4Q;vQLJ9uZ+P+~yIR9~@3h6*t;SZC;>=mE$eL)67v z(n{8v0i++tG{?8jJ&4;I9Ft=8P-jF`N0Ho>sHUxrKUudsaV*8gW8f@^DSbr2pkVI9 zs`ZM+KQci@+2CwR%?SMf7NJ@5DE&-NKauU{+Iugv2v(g=_Bk+Z$fQqT212Et-QesUJ?7KHb*i2f9TpMLe2* zM3Y{Ct=nG%B3ihyjfBV~$wCjw-Z2u_s#oLeUES5H{RjUBBSY0o!g$9avn#Ni8&OqQAmyT0fGLO3OM`F-|8TJ|Et^kaP7*E~soG{jNfaix zf8wactmqr25hOn||Hukcu=2~vtIyxpR;{(#Y)>5hk2Hg@?&**WiV})f<+7h7c%GL} zexAoU$wUDm*JF<;mykp3dGdft&x3V}NctVJJ@^CD6#i<%=3D{=S?A9W`m_rn`Cg=>N_8baHDRw~+K%O|e(9Alk zj041OR(h5kcrB6AoSNhivyl)&S5>FLu`K3!@R>ck@1i9x01iIL1~H}2i8lnO4H~SM za4Kl6R;d2}Pm0t!Y*m;tv*n6|$>Q{JItPf)NQ;3fR z1N17k0&ZwboPFw;#4$`GK=(?#K@SRB52dn0+OlDDGk1kBby0}x%Yd*%#VJph)Pgof zB{5W~l?al;Kpep#ZKddi7*=E+8;seqL`e_44|pIJH<`kRCJam8h~Ti5p^yk&1*}}TtofJz zn?6OHym+`%24^Bd=8+j0HW^$(Awu+!RYLJWu809sxW)n>l6;d5USP!h~d09j)$V=* z0X|E&m2|w461I;1o-T24c4dJ|#vEA|BB(z!Nfaon;^>$o8%)($>_kOeR?i z+u0Q8uy$?q3g?OSPJ}s|o;#~-k0^6D;+BIrgCvOA^Purl*ZVOblo+v^h zVv^A04Ou=24ASS7#|hl*#xlT0!eD~rMg%Z(s4dZn^>R+yTpD;_xiJmC6`txsS<+n9 zt+%4ULZw4^g___p^2n+y(x#xy4L3nmC)*mNyKE{5s0sQbbA+S3l1az3*qX8R+WMfL zQ*0+k$5pT`5iM>n*-m&juZ}d4e8vXpXwy=+ftq(MNc8F4sf=sD>=WoxaGeGl-Z|59v6 z*VWm|zNzCkCzn46sYpV|`;g14j>q`$ArMpA?NR26k$E<$LNmQWiK17z{ws;}uWYEV zG8O!XIxTHFoMV;lkO?glAWK2X4E9NcvuhpJ zXebaY^Gz!6^L?SmQhdi&mJXKy^?x#}htNml- zNnJeyiKt|To_?>{TNhboyaebILJ6VoLnSr7WfG#HeJ?2@|^%G`iBsY7P{MByvH(LI|o4 zIyBWxYZ;Y5!LlTdobf^BfCrR;5?}_Biaq&&x&%v#Xx6iqZN)x>oTwtr#K=Uy21;bX z$g)|An4sUlEDt2b&6SZ}D7(DT{!LyoGCl%S5=if-`LD|Oq0tkpSDfgb8?;qP{_u1#1b1!J}{(c+7ea`dj&d$!x&dkov z?h1tJiB{30E#Ve}XsS=^^gHJ?*%&oB2oy)M6iP`BdmKW=cNht*6 zL!6lracD9`Y?sT6r5cO`s&iRYeH>F%J-&5U5v4|MdR?Tesgn%dAa8RT5yA>A5;ha; zWd)vc6wRR&xL?B3wm%b=VV*Cl7hnpN|FxknvxwV@~ zD<7djVv#cpRnxsvx_$I+@kU zb`g8KK#N$9C>#v{Yu&MUu~h@XzZyu<2>VXj(MvV?nO#tO0UZuTlFcj;^$Igsvmix& zyAVhl60(VE;t=&gWb6iJZBCM~&a6p=OZ?CBgv?Cp zqO|7b@uBQvE<+t$zMMec2Aa5YsW2+)!|n9!#T~#A>p(xk!~85?I`0T)gb8;9)C^Jr zLlZPm0~Db~XlJmEM>Q)SFe_#%ftG z2->BVO3tj3{m>aU^&IGd#0Q~?5NNqUj_fqZYDLG@?Bum(um+i{2Z=yX3K~%uFiI&E zR%DXtWn>ZxSE|j#40ofGSp=-eaT1Y9j-VvkC^cB&tyrli#n5%jr%ovnSh>5IP5C9{ zh_oMVIJ(e_wvvc9{o8f6M}R}m1be-NJ`#dVxkvyJTGfy$o{|9!XdBuhfTrx?3^lvZ z#{|^8$DW-)&FwQvK&Fb6l3%XrCYOevq>&;8i)9*LUL=_$OwhFQZH%M+>zZT?1O=+t zQ!$vqwX|&sBo1)A0xqU(fRNt{Rga&jATro5G=-{jqdzZs%fzf$LPkDI2n}dp3T45E zZuard_KP=7oT-+rzsWI|;LufTCZ!LUlVgi7Pe7l8 zi=vFu%+b3beg)D=rh;T5xG_tCr(!p<1;$zJG%bKY@K3&iLCLg?AcS^T4xg- zV5%fp(jxC^TFX z1s7T#WT(kkX3und9hoT13MocdS-8GG1Er;lAb}jVeggHWQx~Nui5{rW)iS>vJ+56* z3yb51qv(fJlGL9-Q|yvX%VvL+k%vmYvqL;?MU+*BQ5Q|BoLoShc5^2Qah%E_!l6g72Vq&6;FKys8(BnJDHCzi z4z2(dLN`GBE>a}@s2=H5A*ZwvALL1@Ldz$VEV^n_?nr?63>;a54O3CvRde5|@Wz*G zJR#Lux3@1QB4*S~z>Oliie>y}B>`_JRd;C6x-LnZy7G(JE{ZnN0r7X|yR#s`?EhuN z4JSWx%ok#%9DRVMd<;1TG_NQppj~#me^l#`#||o$*Dn(1I*3I13UJ((MJNI*Qi`-< zOCSr6E%(U(`>T&@BnF1fC^evjd0$G8+8!A7HuYJ z8aVwMI}q{+u_Ln+T4Y2QlC$N!gmS;ixxefHJkdjmViP%wWX{@FQX{+C@;nlOsGF*d zvqYfFrf9*`V&;yH4%ZFjXH*U~FA*Xv8|r{18db%VK0drahpuu+%3SQ5Re&h^rkrEDD2ls^ ze=0pYw?>-NzD)rrc0k%Mb%|6cUAHdg=<=6j6#8v+fO86RidX&W>X<>{MFUjJg`>;B zK;iz16h`qoL5|44drmJJZ&w_6m!K357Lh}XV;RTsf8yQ@d)^znJ8#JOuEZ>iGDIQZ<_V6%~7y!byq;hdG?uAKW600Z%-Nen*fxDHbxOSCb%$<2Bh(k(uj6 zrE?GkPqO20&8)!Aj{y=+KxbsQI8|2UMsp%?3bqk4OqhG`i?cbiHym@%8U(wiUMaBg zqp}a!1pMhciL^@^Po;z^Do`@p`Av;g=9=IFXGmC%loK+sk)w3lQ9=#bjb&B@Lv&nR zG&bS99T4$;3h~6?6tmVR#@b)5=q+9amPafLX&~%bb~&46unr zWq?sLdQqcB(10TNYf-hcow(pu$t2$iagEV8CqDh(a$1zv(j}v^SXbv}icQz!*FvnG z6z^4eu@uUefLS^4bo54E2*Z+*q1w3)Fjke-i&`^#&uXGfm7kj!@uf)kC(oYD z(3+KDa2wv!1@02=fV$MN!B{rglOxFSNw{}I;?UHL1g>Q|JU@?hbT@~25X}8jY*w_1 zwB>nH%53wudO46Zkw($`5}}(S;@E^h6{xB`pTxp58>KkR&%%A4*|}bN5?7z)PNcQMhBsTsA8o%Kwz@#Vk}qG5(kAace9BREmz9^$@cD-#+hjnGsV1! z$&Q>tO1L+LQMd>&8uSbTV19jvgaLC;~WmH#H6kta~hJfOPvuI{HQ_B91&!!^h47|U&`4Ai0i^uWIj7KB%3g~8M!rYihHM)JNy#0juNn4Y zH85$Avb2tlo+>ohTcBxuY30%m0!TqYF-+u*W@Zg&)Pe>I7D$6u)cfA-_+fb>OmrDe zW^$R)i*@Sm6duhcF~>@9D~$evp%%Wo_BOKhn#L!6=R^TTZvq0*!d6mrsZcD(KuZB| zzE5LW5qCgVuf_RFYVnaVvXE<8@S{4h=ErNItmLoIGj>T(V$MuV;kIFB)(ov#D|hvQ zTky|a-BDn>GPAHi!p7qy8}?R&*~#Psn*|BFx~4d4#ITCWt_~7_x%0pHV9KWzrADo? zvV0#u^UTlZOr7yrkM1q23>{KZ4*{4medf&Bb1lA0Q@#W`Ty^?!W5|I%^bg1b`DRylUL|7yQesetyi@(IcIliqJmsvcHad@te#dD}8lVP}6Cjv|gAXaSEzt(p4V0Q~^SBD(Rh@O{*+`Q^1u8$J@fDs?L);i{957`tX6Cjr0-m;Ytlvo8luKJoiw*IX^J<1Ng~ zZyfjROa4nPr>p&sH;jAsWm^T~s*?^MyXLBCvu(~B?|b%@(4rF$8@uLe`4;{0#&OSu zoL3%yXlc$r-7xO?SG>f(>i9#)jw;Fd=bIy##~m_u)T;TMSN?U}^AiJ}#~w0vjgp*K z-C}cgMJzQ{=Bgw28#^)#seR@y4 z_0M(czT~fWA9K#dV@9s>)OCNTlkNEPFT3zBcQkHFG37)!rxSPvXxMVgjvT&17RE9? zTU{;y7`EKNk;C&Ue3_nYq62Bz;DIBDmE>$|wE>^ZU^Q&Hfg^`5pU>H=P5!KlXPdM8 zK)|rU1MB2ucBY;;l8ouDwY_>qnT@V}UTSM2Z=Vr{4H`Id#d4TpYEmy}o2Z>IY}o;IbA}!nHfX@e6_+c`={zpXjdFT4 z+0@=Br>T9}0V7u^$=RCZ>_2ja!6i9+gdfd%1mwiIahYKQ`;A*YT` zA#P}d+JjF`xc;7pMhsoE8`G=2+a-2q**xVgEOw_Kdf zQry*4?0Ccf;FMW%+MWF zYuBuyHFOPH%U;VUI&yALRWZJ4X6=HO;%OxndMz|VKqGrlx(gC^bTUU3qK<>#u^q)2 zN`|B~a|w*XTPpdS?Q|;SpeTd);paCuWcn+SWsRghr+|XxLPjx6+g=$5sG2rg_Od`RJkFj7_`4-phWDfh3kOj}V!;sS8u1z=RH z5e)Kz!~UPh-Cbbg>xe3(D+E%ig>;p;qErt;4~0sFdJwu36rn<>Dh8+mu7UyM`LS?= zwVf43jt5<~lwgs7j-+nX&3>av!gN_#Qzn3lWCK7Lv$dgMtO?3s2#Hg=@JKmOLcd03 z;FN8l!6b;9v?+n=Rk(MuCxgVhzw2p7-!#8(#DzH%F;r$TGH8neR5R2q?l(fuY;M9RQ&HS$Y9&Be^*n))-Bm*tJfSb+F`1_9IqRpvdYQrAR4K z6(~m&cO^H+YBeKM>MXp4dsi&ki8XNtYt6M9YKyIEG(KLq69rg+R0>)%k*ap9RI5Z( ztC@SP{ZRm9O@UISm{QH#2Ov_)t<#u=73O?%qz+6tM4Azz68T5uETdJ4UTkOy*~M%C z;`B@ZCV-G$lo&!r!)5D^HD{@Q@;DL%HukyJH0N~?2;7=TCn_Ev2d|!*PRTvk&eS&0eFd% zD8)EDnY`AN)%xGU)QwJ=0Ib?c#=qMro0n%xE!k6etP4}y+K7Ghm*3lw5i~_9*L<== zQ-L+OVkV%Z{btU1Fc~qXl+a}6V=`~(+KPmcfr+qQQep>fRG3lLDb&@VUBnn6 z-j8D7k%_i(QE;GejRv%Hd6~oDT=97Pv+J&}mi$YemY!0KR)7H1G0E-cxOnthp1#mX zd!5c$`ZMM<_Ypx5BOCOt_$Zoy-l} z6WtPmJGo2@b933S9p@(W#$?fEE0F?favn*@86P2ZD6%xYU zT!Go^Keywah!kme`3bq;oCuyETGA0D^8he@U}cR~A}FR>2br;{Bf(@Rj%02UA!zOH z7ttJu?0YSj(qOBCeI|B+63mU+r5nHMGIP+bDWiqmI|6}vX0`n0dM5ypBD2t}z@fy! zl5?L5?V=E`pZ%I^WFzbmOQdFOC0B|`Vp}gIvVcmvxSm3Fxyf0IOE)zjQk*j>z+&I9 z_Fb>-XbN{jP}uHo@b`!R+kZ@en>`-G?zM=i!LZj36Qf4d0cb{xQHlT=dEi17nB;lH z6xM3wILi}~JW@WFBR(TXt>)<$7c1#UAx%B~s`U!|pG#!;!S9>vOuHJ5=;CLqHr<69 zfVVM)QZxd|;bUZtE#Nh&{l8oCX9lAdKG&V1l%wsx2nE#ahEoTE0kGNBZ`bMFsst$} z%}R+O)(OCMQjpmdrBHFJA$Dmmhzg^>4TfCHTKrv4EdFmg#fpxcUaSLz;vbGpix`~ncNJH%i?<3|hf6ZZQ z1!&1bGz+jS9IeJU|7cYg1OgGJJ+9t;|=!=p2btRjrC-(Re+tGz|Pwg z{6X>X(?@gkk((WQ>0>a_0Ux`%ZS$D1VD$}af-?D)J^O~DvJN1SsJM*z9o#4`PeZ8| z>lZ5R0f<~^64~1tB~KKOFUhHSCy^NhQvON}X3bPXjaX|&4O&O5 zh9blu$E*=MIrF;q)Fg|t;OeM6#z0f=|B-_CUdSv4d}4Z zI;a3d&=fH8TGGW~*y=cGQ8ajSlz?qYGyEP6tfgeJHE^GXDw_~8GH>uV3sj zTE|{G$RKSMGPB@y`H)am;$PPY5v?kviPXOe#u@+t3ee_!I0fb1$igDb~PX z(hSW|?r0m>VJp;M#OcM@A&+DR!#d_|{Jzi`S)--%sew{V7hfU_x{gA|kcwZCKTN!? zn22Sc(?f>Ar6McVQpdV)glUlCQ4o!N1=zC$?P?-mLo|F0hzXju_Ba3qr5v*Cr7wsG zij-o%nLVEz*hH5jn0#q7DHxy9PK|*j^kG42J7nxVk?<$EDuj6ur^aFEi;yM8E|p52 z&ZHEfqCK|8yr{WTZ|s~#oKs4YGWBn7qs+4)1qWJ%PCZhAREsyQFR93dTaoY}PAHX+3h1?>W0zC>8Qw@s_djOilLoN3(f~Dx_*ut1)Y?)x_RS4s-~eE-BEA9Lg#=_oApFN*WSs6tr1l<P~zVF5NSM!mv%}mo+V4MohAd%{7X))5tpaj-fl#Xrm5ykrvRJ0 zDm1E$h|K-v=BtcG3jttmhERkZJdRdnm@(|ffl+8o46-*YGCBxMsF00E)x_FNFxifN zDXJ2wRBT@v6?_Z*8wazv61wzLRw<^~b}{!M2;*7=b^PmLzXcavBN_s7#|AjRS^?3v(h$9)C7^5g$9z9`yoy#)a*~OvgN`E z6)98zZT3s)S~!Q?Ic|i*9LVrZSt6Iaz_P)TZDJ6(h9>q)Xp{USL1v?Kb19?rn;2aw zCT7K*1cjtw0eMnH6RC?@zdrP(q4R{X+8|?4hm^dJ2R7{X^eiv<31$7ekegUkE{G_K zzLC4JCq#b5{7FJqIO$ces-v;#g1N;I2vfXxrpT<6u}Im!q`>v?(?{VowOc8Xx7^Ao zRZ1tREbCIci>c~_NEsJ$-Jhat9zYl|UeyP&B~6 zRm>{ua%v;!BX&Qex(ek8%swoo&<@8RfYXll1Qv#kaR$taW8CH-lFr;08<<% z32;X_$;S4B+luPTfnyRBA4*aeWm3R~1qq{6Pu)hu3Hc*9h2bg3GK!hG@TMqv{K8qm zYryGa26q+`NQ%U$VmW?g9l}s^yb-o}C3$2sg}XIqFE3zXc^j<@3ij9TU%N?zSu+!p zhFeqg`-7b9lCj#d%4o#ctTGZUZgD{xqnqi%MilC6MAU=8}s@RcM zc9c+|;gXGHotS;UWaM(uHjuPV#H$<+7Ucr#y4)#Dk21UAM}oYDp%egj?T`YP49h69 zi$^gj*IIi8nJ-L^iHJ38Cel#M_MlM>WvgRfuUBp%{LjUs1X&!o(znQcbETq2N5aGF zx>#h801#8tEJpcb)fC%9ql_q41Vv6CQnI$d#2I}dY3@-Yn89zC{ZT=Mp%|4GXbslr z=x|NYOz!B^s2@dilKe}YdPI{pvhOf=l!4DcBrFmS)N{NbTB2OY!b`O=V z2oQF}$DLnKFS;KBcTT>t8%g$D5f;T#PV#nR5(8w0KZmx75gj!uW!msf#zc8X6-5LI z(Sc#)d3gc?5u1BJZOwK_hd4UVBdkG2taOm-AZP|LRTvCZjJ#v=do<)Jiv`Kbo*2R9 zl;#p759bp`ecRZ78Vj}*diu%|N4a1BsWrutRA&UqRBDOE@0*0yWRjBF>JNL$HXDs- zLo)0+FJzS&7~;q`$AKPAE4IzKZYFX?xl@&F@H1@jE_$&o?m#)kLLw55)AIUqlnoA5 zhTBh75?|K2bO@ zvz(R2adn0sY>hUGeI4#ePModrYDa}P!h$l%Y65mfH2^WOk1XVVbV}h6bxs#eM0*^Fdlo3AbTr5Oz%>|JPoplKBjoOUW1Uh z?pKLk&Vcj=eS`g^{-dBsU=I;7N}_=lMR}r^T>lL07uMyIiW)X)i7dAaJTYkzZHREl zF;FKAF{crO*r8BkRs`kx%|R$Qxr6(RLv4rUBG z3}g03A8WGvr8T3*#*YdOGW(QGTRAp2C9fpaM>S@A=%t*L4%DO}xn4_QMFZ6ITtK@? zrC5+?3Gh0;uu|0(K4jRTNv`%%AXg?sR43;|40Z|Wt^R~K*CXM0^TQqiNapxla$W)B zF!kF3$hiy2kv}-A{0Tg6i8{ECZQzPU*uQ4dYDYgkZAF2q$+UDoUdu z&@Rv=XsU=N!uKZ1mQQ*lw*~{9DE<_UCbCm<@A^^pEEYpHrKmgkuj`4qiMh5|cfpGu?H;xP+`eFB64I zTeuPV5)z5k{vw@2l>!u^=l`_(w4TY*G=#F^4Tq=|>IKmx7|-aF4A1)!Y`V*6MB_Eo zn$5*7977E@Kr-C?9y?EtCY*$O-vfog_w|BckG zKmQVwW^c-n(2Fu-QBb%A6I)RyjDi?}*p}*Safzsp!70^wv%+`xFQ=xr=fnnd0rKu-QHNeYKI z`AI;w|D=td905rQN@gE|Bk^~#oZ(UVd+Qm%D9iL_@|r|X4&&UApa_YA`1qJb1axl``o_kfgui170AJE}t{W`Q!pI-K2ljNeFX z2&G|cW#y6sW=krVd6sp~4_S#i64dBA(pd zMHwCIPq>AIC+-wtun#;>fEZjI&2gM_% z2(Z2lljs%!K`z-bdlNIB@y3bFfBy7yw-bZNY??@FC;?I40QuxZ82LC6lfiZYZ2Tl^ zcbuO8oI}43VpPO{3OO=A8(NS7s22zIGDQ{`)#>nN>I)MH56;VC&&Dx+Rxi4jO&DY3 z`l<6MHf})%hvteV9aKn$sq8q9Z6@(h?APY!g^8Q8iTn`)na{azTtwAP7Ci%4Gd~i2 zMp-$hsvAtv{K10MZn-F0Q)GZq0kqvYX;oGl0#USg%_mO$B6X;0vE{-tM@j>yH8c4V zTT|*|_rBU_6gTe7!U|9cx-v(m*W*`VMwD7?IRqs^!zic18c}o$a2$UpBFBUis%W$n zjX&$AaAh??X=rnXw{o#HP6`r2?4N~RE=!p~n%#6WYBNcC6tOHxMQ%mGbP#QcK2ZD= z{Up2AZl;Ec%t3c<^N84F*Mw*&XvElN^uF0(qd0vSf@|!tK`wTQQ(8qWFPcupH-7FV zk!#eL(kx=+W-|m+w>g`q+|bHtGEau)j_9dxzeba!tgPaahbFZ|nNF^sC8|Qm{v>%3 zZJLuR?6__M3PeXn-9 zn5;B#MT~}|q_}j@GMolLQ0z{dgIRlyTr@(*rz6U*j(O*oJAj^H;V?%<8zo_4h!-p? zAt4jYSF+5X>j@i1D_;?r8#7=pRy03-dB5tC9p`oXsbNlI^)ka8WTb0hrf7}=;+pfO z!uya|7MA~VBYZp!mU1d%u;gcxxRqp}20q}J#dnoC z=z$oTs7A(piVhGnDoj;^cDDoA&~GCRDQRIb*bT+%$`xkg)R?Er21op{+LS3;_SF!4 zsY?l45lb5`pWy|czc zV>u>_668Q%O7BsN^ybkt878?T+eYF4X;?K` z?A(Dg@!mwUl;|{K(9r?BY(6J|osP)aXGue{R8PYn3JnbX?uA=9v6PU?jtNq>H6jUvAsn~&P8S^e-7D{XdNAXdVq3QN?rw3205zcD?nZn=JarrdII@^aa|emGxBn{wtHT!At4s@rnj(QOn!5#nM&q zaZ%{<-~Irg^?;KWws*v6iMDgFSqwY%=vMvR0pB5Dv(;C+8I2> zu>4(w;oz`f@eFR+ly9~ef9!Tgh>sx_iipAHY;SYVnZ12Cm|k#nGYBdQ2(pi|WOxI? zF-b9|K7*xz<(p%%wSk(hY5-7f%ch&Ekf3L*yWPOBd)_UYAQA^h$tt5r4U{`an3wI_ z`^o=3Wz`{r0L+*(uXk&YZO4qfk_rLXwTb*UVd8KA4FE7Z{-|U|QkNw-`#qi^P>8r#*uMC#39o)x&cF`?SthDRExftb+&YS)T2DufPm^Ke*LV&ju_5>O#(@{s)PieC5p)xX2~&~%t#^&4<{5P3 z7gjMk4V{yHY4QBXwyH-8Rv*P9b_MuT4s+>u-`{K1A%iBq|MCC)=8D%poT?NZy8Y&t z{$Srz_T2uSXD2@K>f08qgr78rz)Crs+@J)5{aK%~iAJnxup+{`2cJl0M=4-pR!`b* zmvfFh;O&p5%$hsjSJB$N<;F8k=-t+O)5DJ+d*PMSKc7>rRDOKGZfAafzq5|m|Mq`9 z^VUaGy25FxRR1!Qq=B^2*ndj7faMdVPvuE!S7}>W>v8(*xy$YSL-&pr{Qb)A-SSds z`s}&O?Q@JTzwq8Gaygs03d3ljW`~YYcg1kOrIoyAEbz9hrxVp>8YKvCqsYUdHa0AQ zoMUs33$O7(-9cf5Xyw9egzfP*{tiVWyIHJGGB>25yQgAI>f<%S? z0H8%;M zl0W~6B&-NGa!XlU18YFT9BLY^ctuna)knquR>M0gjjLJi_6DB&njoKs{Po_T2ny01o`^)vryS3P5ZA^Zk$i@xI3Z9JtL!QRVTB zG~jMyd@4{Cs47$ym8yAQRbf^2pSaSEE8W=SF`ug4xY`ZX7F1hMsh)Q5p64EY;N)r3 zw>{?c`3o2M0HPf?+hF+t{oefWlY@T!hv}cs0nkyaoptT4k4$)_qSRj7j!n9N-5p_p zY6oS<3!y9)%ymyt5SwIv2QK#Z3C2G#4;ocT83Eh))k|eA4dMfY$ zyGt$@9)goojuKuF2zww1p}FC4wkE~8c+F7eNtGWlhstW^~{ zz%Y9;Q+UHK+&6Rf+(FyzbK3XzK4j-_t~hw$C(~zMd(T5>Uv+bPM~AbzH8JUD@18k( z?x1fUdfLIe9kSy#D-Ig)$&6Xo-S_C(*WI?bT_?_|)rJi@asS=6-Ehp%6dlUuRTJ z*PeOp?NcxPi`H3AwEo#+_Wbs*58rq4v>Chq^nc&}u+zj z{yM`44-5m2V)T4xB#4{rkN<7voOy$GKJ>H$c01(T+pM_kfKO(8cJ2L-o_+o8?Y5#| zyZ7tW^VI!!+ii=Dh7TUNsJ-K*x8J|~?uTxA_=&WG{(1AvIr9eXe)wto?Q+NtTd%n6 zfKO)5y7qy8oqfZd?X{W{fO1hG(be#RGl<%UZ6$keJWag}E zAAIcW8}DlGhzK(8o-2Fy=)UY8M~MYO{^|a^{QA3l{Qiyyj=S_Pg&yo;YHHfY#V3k7 ziTx&E^N(?xcrF!Uft-IOzyaK0gUw=Wiw3_+0Oem0qOVN-dbORp+c$UHc-`U4_FL3Z zd+EK8E`RXxo1S>y7m#$&nvdCG%cH-!`O1R_d^&sHjZaKC<8SvZFpG9ZBPu#E=pJ&gTf8;s8&BUOzrFlkoI5k7jJ(!WpMw#o3Fdp=IgGt-Nx(f z|FiQFfZzSj*Dt&E@B3`O6@;#`adr| z{rns6mX*rUT2+vxzmcw5-&r$+rmjHRjGjJJDZHT?1V$6e)jox z$Nl>KDbsy5rlLFk_4FP8da77qzuvt7%v-R~P{8Woth6q)-KVn-+jpPs#y&h@Vz1U7 zJ8!nZ>4)sS_R7Qd`sM%1JcIl7dGg{jM+_MZVEXJiy<1zi7`?_8qu1DM?U6sY@X8F# zL-*Nd8wYdj`llbf=h`a|-Rq1CMYCdTr14Rb&idZo`)s|*!!P{1S8I=*H~re_2ko); zN-OU5D;WrrQT-(#zbdD3qh!Z{cY^p;#zJ(M)lqN)dnr2ri|052jKTeSKY8}aBL)uy zFn!Lv-mTrY7`4h4qgL5$jS)Y%;%_dj&FaODnm%^Nt$%yKE+5R8HE-eKp#%EmzBQoAsH)24M;y4(YAXSlzi<(N)mB)3wH0>SXyj^VUw;!^=-vDU3un)> zs}g;B^#tI50+=&@J{qQSmRgF*D8>BTs6_Ncf0|5#2lTt^!e2l7{L82Qz8GI4Q&Oii zvYV(e%~EKA7tBZf+M#HT;VVqI;+#FV*<|xEqx^a*fv)<+vAx=Q{POY}&b{Vu zi`v@(?6K|Go6b3Pzi(}Q?Y$2_`1AyukpbY2e~f?NsTcnF{L8Q0eCg`Lh8*~d^NBEe zmEn7AyV(kZ27dhM3}Xacbn;O{mhJ!eORpaE%ip~}Wg3BZ-)6Jxe|6ISJ8XU1KgQqj z=+jnV5S@R_LA_dgJoozBd;R=>Cr_OL;M4Dju$>MM`_{;5Xftub`Sgv-v{ zbIXml7(MdwiEm_!IFmdxmg?P#l>(92HlMjT3HCoJ`ps6xxB_hTlSRHj4Yx8H*Xv6A zu@X-;^GFJi>1$WT1>fCk#NdH1zW3pN7hFB*lc|c-L0fP9=Ogz&`kPzc{oKR{U!G(d zYYbA&y!WQ-t#i_ECQhCLVAl=Tx%v2mzd2@&-8LG1`?Ifr&5bF11@-*=fO-g^JgD{h%Q^K(+P+t=2*;?TYK-e{eBUVQbw7bg)=18LAf zTW_+_YAel{Gw&yV`P;{5U#lU?^oabcL0@& zjXpi*{0kPhcc4M{#=R*5%wsy1j@9s5_MLYGPzo>H^xG&={9otN*fDEuJbKh&yMH?m zy3`dSeZOqqAo?32*i_FBU8?4Vm=8$A5X?aR57PvaYY7NB3?g{O*b!e)x-D{rRRv?ZyF%+y62CntL7s z@b!(?6*83pd^~+7z*DAw24KpJS%ycZ&YT5cP`^HgVS2Z|yAJA{_+kacrLm(%Y&>$M!*bR*FfjK6JSrE!~#u-{;W_etPFwCvLaF zXeb4x%!z#o=Q}>2&Bu&dceR!0%>Uw^@z1+=jaab2deuth?CbBCzi^R(Flq9~*FX3e zfE_ko*XL<%Y1w_tjR72Z)BO%jd5awt>h*nwX`T$;g=K zzqE*03}okQELNIfzqsC5xw&4cr`w}tPPTRg0j(|7-8Wqqz=6NNX41z~0ch6O{PU?x zA9xJFzMF4g?{{~yv87r$_s)m^J$Z@&d*^enTr}=60K0Cujzf&YLlGAj4Pk!u?$LdR zbw&a>=#MvjVB`#N=Zmji_`qWTcKO=c=Eyg*>bmQO>i{_Kj{BZ_`vbFi@wvC&{r#Qy z0{F%TUn^=N|H6Mt2$~}^H>G`+NKM()$u-5UR#QV3l_KE`^0k)%WbCU zr1w99bI{4JX`Fyqq*lsi8ajB{ic+6U|LmhrXGpZ4o;V4>O3M$nZ3Pcqc0fg`S##&V z_TFTuU?DyB@@reJyJpm8YfdqMM_-uu&lg^GbQ2NRE@UnI3$c4p04i)r| z#PMa5X@0mu)hTfQ-5+}3X)C^Y;V^H(qIagws1OZZw*StXuDA21>z#h>?PpwbJD8xg zQ{fQ?JzBb5blhP8&b{G|IrCHZZ{s9dF!9~V@{Qw=zP`R;g9dc(R-HL#-mC9_Byo83 z#aDl{`?pqIVYwo|PJHh}iSDGyp8!~{e;+Z6!Br<8K6b6uea##I(ws289fQpJvhj%#_mNTzi_ePrHXHf>R?nDHD+d7RI5#V|3gJk@>tY_ zLSK2ZLas1FmGr3EPnK47OsXYHFTDQNw3)LWe&&U;43WVWDU93}R$2nG`U!%lTYmEx zG);mGDwKR>uSopcfX7jLeCzyUzt>iBv`Uv#YxkDz8hW=v(;34L z*aUV~v^i-kqYrP9AAT#bZpT@6xE(=3ZO-`+PSyh zKWy3lNAI-F;X7^f*ejFlGNjgUbMo%h>h-_)(O%nZ`u0atcmK(G?QuM6s6{|0KNKZq z4N~5kb%;lQa!t(@_m`P40DS%AbD)Sw*)s^4tpi;8t-5I0H)tM<|2J7A13#X_m1x~EnIrK~gxf?ShpPS2S-Z{VZ|zpy zX4EQq6x~cwh!AECO{|%T%|SNiu48`@m0trB=4of$gbsk+fLX`5iu|^I${4lN|6##O zRZ-a6NNFX~M#CIS z?P4PVxK&aDW8KwOzT}jnI%>5;e)ao1{`u7GdGihP9Jk-D7o70@*t;7el|H2DosXuj zy8Gd=yH(^*n8`UgsFbqd-0(^4dHx3PW7#_!_KTIBbq%~)>VlZsJ)0wkp& z3B{&UB5i%dg;`85G|jznLrVdC*E6piz0)@9j2H@41!*XAzc>?fpPoJLJoALD)*bc6 z>1N$%@Ly}Mwk4-A&6+6ZCl1(CBgFrMm2zw1(`&}lO^EQ9`yajL-hYHH2wm(>42XKz|8%0)pM}o= zu(-V)K>t3y1geg(F{dnAycj@R_wF8wsja8q4nbbH7_K#^j3!b5PA3@XN>GLX1}i`l zDa&joE)=xTa7eE;s^tX11=c{smb9PJLFksvPP zj!smqXKwf$v52slZAr6jQFwG2Kx<1k0E;_1imfb9h8>8DO@kaI=9d$o@te>hGt@|2 z{Sm$iRLFyt0OQ3=j@vEau$0SX0gP$wG1^g<1&i7N^s%mNc0-f<_B3*7v3nWX)Tgcc zr?cDrYI)zbRsajz+r!>VkO@PzJR9a{E|$XGskpeK13BCs1F78ebW2Gxib zwRd#yR_)QFZPpj_2&kY^0lHNyqlOOA;5R3KRDm{Uxhc!Qq177Eap(k8oRTC*p+u3T zh7d(hnbF|d=f^&K@IH^17v`8h`&d4QZC(+|^ud&A3l}Z!->3IFtB;WHx7+w@0A7FZ zgF=ahTCQt|G)VInEST~6Y$9wtdZessvvt=7@ZQJMI*kkq8neIqJ;Zjg9h?ln9H%*D z#;m0EqgEc~9?Qv6ask1IQ)kq)?$^85I;*ZE-}i27U3KV?(CUS%u8J<+^L$`@cWC^rRz}>Dg-AW18($NGZM&WyS}e&Rn>-y?^hXqgP(h zUz7;KcI%D;@Vbkm3x&&R&UNd}B*LJ+y)QUyk3S!?e-E>c>q>ungV6w9|7fa<%v4IL zbygYr^dEk*_DU;^d*+pGPCR$U+%I6xhbweW)23Rp+&+2Qj79Ao1N-z|bNEpCdFyr8 z0`T_7Q_ITMJ18Vb(hw26uYE)N9u-g@oT0lYnRda=l6YecTjEk=z1@ZPkU z#hk^#;^dSi<%gerUSsap);fCV^48V|GtjGh%ZNb(1~1cF>&`fSjg?k3FTb|ND&wy_|E)Xzw8wUvdC2n?Ed1w$R{;F}#KT)ERR%-z z*6XeH%}v%Tg7xU!cFvD?9J~HeyYFzy{=120Lg+>D(knA|`!uwMW@cWvsQuQ*Cjhwa z1%T@wdBztEPGFX&NBMy%&1FHh7zvx%*?<3h<;{s7e6r%e zez%-@_>lg60d%XVV|Lp5hdXTz;Od8-@-Wt4ZTP>=KY4`#eJ{QD(Ou5C_=}DXR4b@f zV77Uf)8HWgOFKuR*%UL0919jNzWuSM0sQ4>KN>l72mnR&-5s_$de`j%-1Nwk4S~gw zy>S)?=ywiC^4s#~y-&Xg;GDzu88*m7Jo5hAjooRJ^)&OiXJ5)fdVTUI0FK;gyCPf5 z%PWY;<=j>ZpJa6^px0EJazm-0Eb=EHW|LfwZ7$VO;0qSF-~QB#0RD2^_f{V=7yuC+ zyv?RZ@318Raj1<=3)|aI+2!kN4PD+KvHQkjez3z90PcEzV#p}xT#*G4{u+*$yI|1+ zue<@^s>Ajkx%?pWdfnkG{NpD_PCWaBUB0#!gBYZlm~qQ9F9Z0+9y_c*Vt9>FW2`@7 zK-Eqz?Zh*1VVsk? zwv>3{|6abyI-|y{zRGKNTs?i(?A~pyJ-W95IOob6$G`My%-r%%0gEp={rr-vx8G!g zHAf78?Y1kX&zjx4XRC1m{r0+BUy9GDtBY9ub%I1X+oR>BT@l5RNXS32)2Gj#*Sod539CEjmIt1E z?HyB6j8}8CO<~2rp}?^NB@WVJZ(o>?TJs)f|9SjxPyEhCqj%cqH`8X#8L&*xZj}mv zi|&1N-1GnTb+5nr@IGxl7I$=fd&AK?Uh|tow7l}p2Rom3UW`wp{;J2=nX<=Ue9gwA zR$Fhil_y>Q`%h=hUZ!W8q0(h{J@nvnuQaHuUgF?akC5x4SULCRdv@P^gE1q9y?4Wf zAAUNsPtUf#z1jf$=CAj@B|R>}S9R`R@7;Xu6MnMq&Oh39`}qqOo7ZRFc<04;JtXmD zrgLu*ITyK{H{5mcJr6g994BooCUPT`;8biq>%SyqER2GDQ8ywo$fRUH{>r~@y!y)P ztvqzn#blc&$>-P*l>uQmV=zw*ZI z&$zQ4Sa@5l2VG7MQ!J0W;hwLpw8A<=mw)A~6Q<9ZSE;D}J=*}>Kk?10AAjDKCNSu- zhoAb!TB~ig`bxK*aLAkm3jr+C+5^C2|9<`MXJ4qqMzTo{JpJrJ-~Q%t`|fqvf}Ltw z19<-RNtfSwH)5uAmt19u$QkFerD)_VmCvP|P2sC@&g5L?uyeVK>C?|%*ZMhtCx^4*W8uD9QhF8b>|?|wYBZ||PWJpSd^zkk+6yPWuIb7+oFFTMHh zW`~|~|5FnN_wT#w)|<4pwCr%~8L#<`ZmwN!nTu*#|M=4DX3ziP)%QO9{Vji&HOmLT zJ;}XcX1j@r-F%Umr_GwZ;W1~O_qPY$`sC9-J$o$b==jIWZ|wT(%YJ%odLL6$$({M^ zt4xTM^vm0yOdomp=@;Df$mCBy8?a2z`3o04^70#doc*U`|9DHWMJ?6pN`nUsAJl*N zpaJ&3!2^a59ynxR|7N;eAcD>^@U&ToPOc6Z@dd&aNlLjf7zT(q`F!^Gu6n=il}4iPzk|sJ*>skCu;S zetzCvkL+^Z711`QXfn+Jh7IToU{<`>)(DaJrqA5ymls{~@Kf(i|Ey12D>Fa!_6J8_ zd*@yk{bf-{hrh9anHP6-?DhNWes$Y}uYEkNrCM#NR$u*a%2~JGd)jq3*R&SPN8Uw? zaZfyb_1)t>o<5_sd-py)d-mzsvsY_oBT(AJpxO!q?4lu;Nkn6|^2S5q9=O6nw;Rty zR5UI+nK&}!84)|AOz1Nz_gUBibq>U70*z2#I2|fleh#>a%LyfbxcaoiVxv()_N!># zmLmyhLBt1M9`N*8-g6D5*#$LGjS&$k9Y`zT!MPD|{k^IEF%S7vUDbkk6Bw&&xSV z@N*Wj)k`@^*qjUs8(oYJX(aYhjbNw=n&mTJy0gv%OHA8(3)MA^GQ@CJ-c1-$$BYCCDC zZ4TUg{f?Tx^dYx09r=XW-r@>(TCH1@w`1GdfCPZa?sGQV`H4|uyJ1m-w7sE5SfI@g z#CQ{6QlzjOf(^Ucek$+T+-v{N9SBZ>r!u{fhu>wrSg%Zxlk!@cV>=7TSO&$46I~RU z3Aw==8>)GLT}>P;c(;`*86Om7DC%Gmq|5vBV~BPL z*;C&v2XQ>XMNGrQAxts01#_i5F+g&F`*R}Gf4e z%SAcLbk=0)Ldp!^VAv(1+?ybcRAVXd=89!0kq22c(i%`K;V41&RG2uSUY4?7nik(p zrE)rR{VvEaVK&4pGQRrvYJ2k!KL?(pwJy4ZxJ)N*Sn zHob8<9S~Ao$KUM0OqY3FmLN3O=qk`>f$zPY06t28wa|E`9Pef$a9oaE6=FX?Rj&(9WEG}AOPKx)W;*zi4Jdqu&*a{i;!sctHiZmTkaA|S2dQ12 z0yjAKV^`FnP(KCnKvA~ByCSS6Inhq9nl#%pwM3|}vlX0G6i=HVB~L`W6TO!TZowXA9KhZL#80~`jcK~k9mTdZUv z+iljLS{wse9*_>+2%DS?4k92Y(AjP|_8UMbqEpzYVlvxSko)Fskxp%9ip}$`rb0<7 ze3CL#5;o5pl$0q?O(_0mz_>h#qdin3ErC>*G*Ll=@19E0tSAi(6pA7byjdw#sMni% z#gBxz^E_wEJ_`Tl284hZIYc9+MAjN&7h4lr%=SRz9MTMSvqsI(ATZ3%MX=fY&VGLA z&u5CS`hZszG5r$aNbikrW};Oh0>-ksj#YvxR5i#U%Y(JB$J~PAIIcm~>o~C)HEGtC zG96XUK3%ZFnt&*x3dN3pvW}M`EJT7&`c_sze4rXP{4h8S3%|{so zATes9(Y`qRzKcj!vet#gMQL{Z=gV}}1bht>b7@$P3y&E#!5 zBapM2yGWKot#<8$8hEV4h;VKhw$2VwHY_#xd14TOcDd09=rEv}G+46+lm;|wZA@OL z?dlBZ&NsbyvDXsuR+TChWp-72VWAlc(CqoZoFcNMLp+HjM8QBy?QHlNhDe>m!WtCZ zCHgl-+Hy_dx~l1j3!BJK+1+G=?d64$J_#iA>awUwJ;;1jg_O*$!q3=53N~WH`AVX& zIezWTPy5=Q@?(R$m5v)5vyj8E$Vzb@6CD(8Lkx?LejXL(Oyoj-*iXf*#Twe-^tmfb zwjL&ib7#9g7jufHk`F+vh|!h}VVXoWa^to1{sd3Dij-G#(Oy zOjQDb6jfZ$+Vk-I9a1Ea&yBw&(Uo;3$z}PQNoAv@%LNmW-f2l!T1zqDz=UZKDJS{} zWIXZl26L26<>NP=fpRj-@nS4tOZvH>kwZ{y$lgh22*WdJNl;wo*5ZQiR3hvxpJ>@t zWH1NMg27VENITsS**W%=a_$`8G|@_Of9&>0kXvdXH*^qtNJ?VtfBEVD6J*0(CH|E;j>O+^6I1 zl%VKbBN0d{DN$f2jvi6y-R4tOvnHyT5JsvjeKe~d&5@BAa zupa>o%cB&3E4B0h&j^0$#vda=3ldhLkMU z$x>2R<5c3-i|aLv=#*3`x{35)`PCT{AtXt(##iSw84*EikRp2qjtiPiSKxdvAS^oC z8oaxeW3n`2qdIh0f)tsp|D~?f^2C{^bHpPPY0Xr&7+M$2IvIir z^g}!HZ#0{H{wjC0LuvK@*n96dtBR~`^jURIchdyPISGQGfTADM8twX zf=IWEH8)B_LIconiG?sQb)bV)r5K<{30U)5rf%vjl z*_0FPWnt&9YyCz$Af`K1PSatr;iNp%?wq>$@2A}>a(1QmnxHaY9vM9lI4he z#!mZpabiwQ3aaqFv&AA@8^QZ9z|4A6vkqKeHmoA6mi?8dD0fN=rVNn)m`O0I+7=Ykq2Oy^zl_QAw~!%V8K*XXrYdGo~Gi@|2|z1nN>)R*S5Z!y*I+ftKRzKr`AY zf>p@9Q6;k&VaY>m-b7Vn%sR#d5ZU%givFf=yz3uBcvY@Y=LalA9685 zV7zmEBIg_La`L571gp58IZ4If8!3^csmy-Xf|F1DF+w{33cNhd2t)_c@)h)A$LyYz z(sG72@rc+o)R&=A2y3Q%CLs$_J=Bjq*+9^ZU93TkTIr3kb4uJv)R)-U-vwp1nVWSt> z=t4Eo80rB>5&)m_FDbk2IJjzSNd2AXA6L@;X+Ir)AbQ-V_)fY*ye>=vTdi` z4X=dzvS2%d6+Z{0&x2wFHVO)NMw4~BI6y!w1VoDDVi{x4seQu%f{f;s00`~6)UIBT z0$BBYkb+<^L!<;*bCS)PJwWfRBoILedHACvBb>jk9g}a@gfheq-|m#@*;AYu|Gz7R zIyWZm_701&1`4V`a%f&NZGiECBBCWZd$vSzT^3e|&~t_Ay)d@0S|P8OQz*?T0Ai5b zye|&~2a}K+78!yOI9e6P$0TbIx){az7FnCD)+lPbIm@wDaVc$urVdOI3Axfk%`!S- zJm1Ya{x~#kSpT^@ZWz$(0039r_sCzLddV?&bT>qj^JsT4V4@%GR_KcSd>X3FKL^2B z8q?s7eq!T}L@Yv%?GSsTi&~QJb#dI1yeO)!3JJZ7K8^7w!?jfwJW z{Yid(A!kb(rb0dA8Djn5yR|k}R_+qUZC5TI{PaL~!-6oig zSD?1d8(($Ov4eVcZPBpq_KM2cKmB(9l2j*>^cuxQH;fu|YTtv}Hg1?sDZ*|y=7wL_u5VVq z?#jm|gkUs2=bCj}$`H@m$rbBmsH}vVJW?vmk$MZGDX6}sgeZIDHURa<-dtH-E%#=a zL%^9i2sl8H$shy4#QU}1^S<*(1GsYHV?Qok=HcRXI0L9zqsIN0U0AP9?eUL4^WCDK zRV>XrIWpXbY)iY4lZRgCG*?Hl3NFc2v_yiz1eQV}7Y$~qVBjG=o*jQ((}wjctE!8O z>`hhf<}kPM@lf(fS@QY{1aP~C>}M204kC_ur*@s29CmCx8KL`>^b%~%#tb0PN`(L> z4vfDDB8Jdfm|=+?TEUtp=C7p+BT*18oQpcLNF76z<~e(x6VwqYl{Tr~~%7_VHKmdTAO6OhP%eP(_p} zfP_Oyw5@4kvXRZSW)mm*MPd!9xD;L+O#b&I;tuO`2mS2)sCReAC-pp&30801Y^rWr ze~*}&$>iK(Ub;CwhR$A}i(dFk))W!?S#$1`xe-prD0hP(4B+mwM_hQ^kpR|hDU(-E z0LWwlFfy6U>djjXh^BSx0M-Qb2i+fW(jRt)(u7;>_C;qUo1{B6%JP@S(3`2&D{}(r zESgC~Vya?dCJ}&B;=&=v0hs>vxBpqXj7YB%)V>(3)B}JsjyKkH61 zRfcKKMJD_v(MYhn!qV>0s#_gk0qHK1AJ@2DHLBf0pN>H8Gip&7ZA}sPrqDR zQatwLp$-V)7xC@N#C@xIQnuA9rfuQcqK->;5fSq?t^j$}#tn~oYtPm7lnv9mzmaUmNP@jfToE~#q8J?hIy_wb6x2(66 z$lcCahAB#(v83gxOJQ}I(u>a7ovi)W6gUM=u_yuwc?y-%hJoQ&24Vj{T&l%|GL^1A zWB46o&RVo=)yBr9R23nVldmTjXMCPm2Fo zb2f^#m)R$MpK$>Hp!_IpN2HB?6Ne{zqWzRU2Lb4R)4d*?>=rheq~}O3*_j;#YLy!cQ>P?>3eG&SjygUyuElty$au+$*lU_u*ZI^?yy0zK{|A$}Q4kA*T=_ z1k`fJJVrg{ql{gR~BQ-%L2r`){dMot*}hb61m_P^-Q+si9tW0`sIA>ErdsQ1&dRcB3jWbLLc9B_4YX8a3N zKlo-rO3{+IylT4g(^vr+sjwZ*s1Om5E;c;FEL4-Myu3TRxd{xej>* zF_L>r8=)~d9=`FC^G_Un=pQb5;^r$`H*Ngt2cQ1W&G+7S<)8j=!co7iTr>JFchCOe zM~l$c@2}syrO}ZmUUbT^u_p~_*Rt7~4V#{y_R-CcJhP*s(!r4d^gD3Bo5!4WP?t_S zDk^6D`@3uZ_E^^rd%kwhxPMJ~=YMXwHx5lF8eoY}?K2|d9w>WG%HK@5O`+vk#&Wi} znV+t?@5Td=*xM3X?g?6b+_$UBLr5kjp8$+)U?wUp8A_W`8;!=(Vnz_C&LaUL4p@e8 zSY32V5qjf4o-lCy`DZL!v%ddDe_py~oq_`pkjZ3T{P6Qnzx%PevI;_w5Ym{O{nO$B z-8;8!(m>Cf=zWxI+z7MiMy^$}3)l$=X1=n1OIefSM_+g5h|$OOZ`GvXigg>Fnl|J1 zrzcls%rWl@&-%4%U3KPu$%1DiX=L>l61WYnuw^V;D@4?lSSwv8H8R9AoV z>+*-+oB90AIZht6mZxL$Mpq0zqJNi;tsB;>tgilU>B=WQp8eF!InF{*e(L;FPCKN# zTj7R(+-$zD*}ARM)pxSm$$)@~7#9xeU$RQ?Tomo29Ne@yNqlHg5Fw zf}cM7_IneAaMWnH$x%Jv%b~E#9vv+|9APxQI(^bz*dDPN@<@~3`6!!LK{;sK&00{s zCb8QaF_93P&K`2~KVE+Gf`HR!_Yt*Jyfu6M83@4GpjN@apz<+=^W9NMFI_kC}C z=*hgW)_PHi+8`id{2ZZT8~S!^nDreT>d(aRQP!ICz|IZ&S*Xrgulht`ht0wf+N@eQ z^o||Nna#=4= z$sd2I9CT=9nL>lwH34kfQLcltta^b&WF}sCH$FP;9e>_wClBa7{omi!F0C=7&q3qP zIjL*=)}wB^M`vOHP3za4^^fuGTQmi*cGH$RHB0;M*SYV0oqKodbm4vfa>hl&Jol87 z`yV!a&b->CHHP%=F>dszuI*co`pf+`r*FL>PLzbw_&=U>@{xxsn1}TkclOAx?OKnz z*}!zYiL8K3h6tr)-9a0Ze4Had6D3c$7PI>%M}381mkX4uffQH|?t|x_HuA6@?vr01 zy~F+>9CYRFOV@8K6r(0}>&zN|Mf;|W0Ic0oR;RS2Z|C-XJGbxMsr?0yzv5uXeLAJDq++1^3_|)Bo0mXs10DvmNMgp ztlhdzsuLlXfD<}4ZG1}ao&fHCZE8g(C>9}ZSEI_z%+$JRbnDpe!~uOO zjc(tf>D-0Co_5Ov3w~Q61f6wkzkgnJ-q>MBzcKUQ?|${I#*!4wPVKv$edV_D3ILtk zw4C$L+eh|0r0;&6KmBfjZBcXqkP#Htp>*)vyM4EFuHIH&PC%zNE$2Kkeq_Ic`*!R6 z>AVGqrd?$3+@T1IvR_qXMSs3ES}W_nk@BdeUaium_3F4!LO)YN&#>!5dOfJtKqvRn zeWORVZ`x??;$^4Z|Kx(@tAt3Mbwsa!o`34tWBR=D?|JWjr=ns+^!S)lYu70G%Pa3r zc=N-GOaS1-Ufm{LaK@>J9`Mx6Iq(0lQ1~P(%qXf~6dGlw@Uzkp%STC_rBj;>jCZe&!hoppfV%qfen>L$f#wIg#v16!U z>UY__d1p>hiY$3opYmK~B-mKN?si2E7c3+tOY0D<=#$-)A|RKqSr1_4x(((pfK}@@ z0%+2po}05qaq)yFUYxgZF#v$4%=ql@lcoR|cI06SHlbUGJ=?czzP-FcYD54*z;`|M z(yH|v5>bljQK<<61oD4|gA4~5a6lXoGdLg}MOCMidEI3mYo%gfhV(>Y7n6re%-h(K ztj~*aEA_ysZB6VI^1vecGeOwN-GM@II>kbGI+8OKR8vq5WPprX1m~TVNdP*vX;q`R zxLJexA5Xmf^$FJx=((R+!9?=E+~dd@1Q`U?l&PjnRiAy@b>FMamhC&>-7?(bSicG)03t40<fGw%Ht4Lgs9omX_?pX8I$lP;uT z=bQh(${;@+AI6Q8cu^CTN{fp|9K1h(GynF~g5|3K1ROm1(U%k7{S?5deXL_zqp0Ze zXI?+{&PQ*V{9Z-13g*8$d)||u&IT}`OGgtsi!L!RbQI|S86X470Q>FPs(+V`+bSx5 zShnhon=b$CuA3%ZbMZMx_fHoU2TTF$lhhbs3_9eXz1y@}@Y~XNzL+hK7w>z(ey1GW zzjf2505OES>mwF{sIbeq9D;##q6k7B04yBDlZf?LLOhcn$Z+1Q4p3Z*k)!!jvPN0m zn&4DB^P722KK|^RAFe!WRQp!Vbun(&vN?eHi1L>clQD7ex27Zzp-gF2N;5M6)I^uV z5v=_l5+OPyaM_L>KQCXE5~6j}Mnn4a8q%lNxPQHH^W!f%h?s*P1G(0tHvwSPLSYo};g0GCgEX6hH;gvMju;$)aP z5;=ckzW_*L`B-Si^Kdg4tfC?d33tg)w9xEe7I*@u^^r`|D3Za!*_|PFr%|0879bOV zHjNsTq|@umw*9blrJHZY4+}3ou3v{{jm?uCRaI|&{hu%nj0G#!0H|NH22}V|A8^A~ z0=O*A3?>frJ>p{q9tL1rMdcp{_Wf<`I#{)Z+&W-BTJ^h%0 z)tSu1$*-%JC!x=NT@UQkamng6zpYsv_MX`P>2^S9Vz$g`i(yzRk#~wI zLoO9~_lvn5M~z`nNpbqplTWx~%vt09c*@7${O6OezjrvsvN;hwdEKA7ci3~*_dnkC z-0MLQD39D$XFOvv>e3nk&Itnm%C=XyIF?sd0Z6562&c591i&V{T20M>ZQQyIiqgXR zq-;mI%dr|}%B`qP(?*?IH%DCBqh_ho2v|HF8c{Gs3I(L7h~LTNZ+^&6fXR5U001BW zNkl~Mi9Di4SNb~0KUE3GV8V_;=(94m2S$u!K>T68EQtW?USZ977MHg4Miphi)V zgB}1hueZk;eR_0g*2rvz*|%j=K&}`tyZFP1>NRfUFf=n$jgq3HyX_6&`=u+ddFJIU zJIaev;_$uO-FenY`?hX5qVJ(E&zPyD35^+gd}(peL^0fP&%t8P*4il-BH4Z5P zp=$}VV3^=?sT3VG%7aH8OF8reat9%+3)C24buMX~%&YA9hd5t*$09|LR}+IX8F0Ws zMqy)iN>ECl-=@4d_g=V)s_F^PzSgE`OpqnT1h>`|-cL7h8gg5cGUXIeDF zNUASMy<1SPyXrQpQjCRa7yM{x63QIvnHcXaS|)cQWSeF6;N>ajcOp^3_sGNY%1QwB z>eLR&uX=TAXRW}a?np-&!_YWPY=bO>(Ej11rCDYfD1ewNGF2rU35vQ7R@O#@P?jIW z<`y=s6BL)m#2`XfR@sVumsD$3gOPL?Ap|oA0f+*a)%PS%3D?KTsP8IUz&jH66; z=}H*&?t8X;=$sR)Gr{ObUVLr#yv;jgJcBPCbohN|42i&rU}Y?MjUt0v)T;yF-;0-R z-dB_6z&z{6MF3hgZYUSU8Kz4K@!;hbx%fHqGp@b9$IOYQipdgJHc=^(_s!Nt zSv}E&+QW6)zRH6}wT+&*F*43Ob+)@iSYl`RfkK2{w|1@a4VC6Wz1p>*6``zX@$!`b z_G#CqVck8}JA1bJ9MB~eIwD-+>gF{^=Pbg$oN->pYB4jcQd7>}m6^S4MrBxk-{q|~oo)mkb+U6CIYF;A)koWqqZ(uEdUuG; zUll>!QBeV)ZmrU=fmOREfE^W;h$ce((K6Xak`muUQe1q208~|H;6>p8ptPh2KxK7x zE~t5?LJk#4${8yPw1;FK7};mtE#&B(c-uWn!|?-=06J+9JswGjviL2P)Ka&mJ=#zy zn_8s+c2rtg8rHKb0ng5y^VG+)B?Q?UZVeunyBx%t(Di{?k^|&|osifTZJ z6aaav6o5cpTnGSY)}Vf3heZ1@zU%W#&d4VyMK%07mz|U(z0FITU^&dcT`&sm*lWVf zb6=zOqw?MK8mi8wD21ud-rc)Q{&1#w-1oq)02VJ_Ww>YF!o|NVTiL!<^QUjU=B%40 ztlzv<2)g2ok!_nd&02FvQtH!;*kMT38JY|kkS8LU#mpQfnNW4+pwdwNabuaML*l%Q zsAGeV{32XUW5>wu1T`8W3`sWKL|)aQz-k7OI0#rMr3ey$&<8oPx^F}fBPB_ffF||p z-FNXHmaSRe@#Hb(m6fJ*k2|ynfcd{I2dOjc80gl%&9uLcYuUKL)X(RPy6LX%6_sjp zg|+RJCUn|OfX*f3#%`s5G!GfzC9Bs~R8=>syT`tJw))Sn%T1Oe4(I}4(ehPJ zCxu2Zau%G0A5CuY_&hn4!m_pN>(#E=tzGM7Yd4sD-P*MQuzYR&y6dtXI&o#NZC^iS;ppxuhP)~1b>8`v%)R4_%PzUtz--Vc(W(^dD)JNk~-;9 z-!9QrW68P=71h;^>eSx1b+i90T?K9X9?_)(fJLj!a#qx-Q37D)#?7we1=Bt)VkDR> zlHouOT}p4IW_D~r!rb3h0_fSURoz-Ox9->`4}+@)4)4+lz@p`=GRlynP208~ckQ?o z9-a33bmE;Y8#kEv z+O(n9-M+n|!mT!YVy(D$dRfViipt5Kd;#Fu8!ze9x&;71boQVl#tu6Mz@+IjbCl0B z?SlDg(pz851#ri?r?hF>P(C?*K=0!ZJs@D7`sFvVMdmMA4q(g)19B4V{3R;@j5&V5 z|1RmX+psCXr}2C;Kh0mZ62O>a4|lYH{ko&FYVsG~0C@J|vpcnD3P6xJ`^baG9@7`V zq|d%KK)+qG0>BA9x)h~SfMVVe2X*V;rGu&3%;Bg_djbEtb_0Op_U~+wb@+YJn)M&e z|D|rt8c&^fa@$7rrDu42k8T$qHvqsZpM9lvLWON|Z?EyrrGgkR?TxByz9?@wdU(H| zJGLfW;@cM=HMbBns#h1lwdb5NX4LWWNxyS0U%qyIOfev;`V*61NPnoq+@oQ!9I*1p zoJxsTr+@n0OOGyDwWdzZ(gt=~ZPnIl)SHxQM_wPmK#Cw2qoxG{=|>8)o<%vSBr-u}#P#>idia(TdLMNB zlqXhi*x0b{9!2RCfWN;o_3c^q)T@K`=~%Z`&C06k;|}dHSdO5B>32W>I`o=5AXi7h zpQhwMIgsjvqJku-&3xJ4o;Y})jt6vXx8T_a)@CF*+588jPHjAHsVCkCmb!*j>G2S~Ty}8hOv>u2FFTB;~woccdHss>r zM{g@v;k(eKb|aL(snf9Q?(ceb55g-paB(b)K(p*-$SpEF~2 zNjad6GnwSgumgd0RMJlqCcoR~h7Q-Cc$kl;^}(q#v}W_xJ!;mF;qHID_t|^jE-;9_IP2>xPdKt$>*n+By6Ua3|3iX$?bT+V7ELaH z_KhdUoZ@O_Cf0K|^p6idzw4C2&y6|t?`ICJ&IAD7{&vCGr>B@;%Gjr-OuKUQVIA9k zIquR8W!r0(6xS$919bPJ4a9j)2j zH>RXa4D`KPwFq6!)3ELy4eP2aV2ZMxc^}K+dGkE^-}5ZzNZu^frG$83(reY3%$SkK zH)~XX+3K~=Py6uZN1qLXaQ;ue{_e>0uFyyjfKf*s4m10hZAz8BR>Zhq5!^V7`4V9s zFS-z^H&kUzKuS{xJB9?uI*U=w8+h_o_qmJ}vxQ|~n$>+Fz3FXiaP%TT0i{v^kq}G( z1$rljzLA?*ZscFIVs)p}F1qRLks}U2q(!3!+se!5Eckii&xVvJDtKCUX9^pcBV$UFl?K~0M#U&J^4%+Z_{$(E3cSc zMDf<_?}py~j~hk}+P8Icb&V8I+qpD!^`~i4a%#kzFhd*!|%;} zVb)xi)hntp{l-0b>&b(L9n|fjWBabzvh{=S7oPp_3$4RDQ;ls(03LX6W>qFLrvIUP zHEoy{0zkc5rEVLRZ`j;-{3911b=a^2_ifv#enoZl+{H_u|LouIee*+2g1i_nqngBl zJ`h!FUROGpYsU3M4$CR`rn=+~w51$zd%%G3TUa*{Fv^l-%^HGZp&Jw&b0^$y@QcHN zoR|_?lBJO4A}h-rY}t902cR%vGXVbjeE_A09$#Kj8Fs2{wkYOG8ovFv+m7qg>&p8c zz2})%BT6xB~euG&AhtYs!0QIM6t(zl2kQi z8@WM|M!9QB^g0{kJF%j8wXD%x1TK@xBTTzEWhDm_q(9J(3 zF=l}<3d2IvR3V(3J=LsHa_MO!j_cDa69iK}N;I4!Nw~b>%2D4p-)Tf+dxUH-APhYD z#_8~_(NQy6cc{bF40k(UtOQZK<>3Y+MEr}3S^8ud^(!URx>M+bY)DOj$P3&6LLij& z5WCUJl1-?GDfG)&B5|)>cYrM(Dq|KYyqoB6_mOb{Db`~AU8?z=pl5;X@Wt;}e^S*h z19F%Fh7bq{f*|xA zj{ztZ5k^@gdMx+lFaARTOl>k)8$o{%q}I1B4@VXv^P}ER&xXtox!po*A>VZ8iti*Q zCm(&p16N-FfIyAw*OQ%k<3msWylf?q+gOh4B{Snd=3p3KSNgdV;pCCDW97_|lRr{CO;3O6P~>T)rv(m!cE9YOXU1apJ9JuNSGm%VPF z(Y{XBguos)vr7C@xq0>!c?!HMu>X1UhGmX^S!RcizG+ zlo3Pmtz@XXWOTDJ=P3N#RFJKBxZCX{LfG`uP_tm1my(vJa~q}3k&(`~qwUEBsu2uJ z-D+dMJ?Gm5lNe0Of@R6FKmZPyGR*3RCZ$0Yl6uzCLz1)e@?kySSul?z$ zMrC=hZ9g0o3!|xmyFNMj)Zv>o5!~{t&Yc2JqWpeQb|5R=>6`@x$8A(6 zNSRuk6XoE4iEEf#@J2xZ5y$|HKO3Rw+0F|XTTkh`#4d6yT&I~vkvqTqBC&$X6@^)B z**LAgD@%*x5ePlk1CnT$g&yTuVTe_86^lX5g%FRVPja#Ssov$Ny`U5~!aiZ=2?fbn zv+MRGp&C=S!=I)|&c#&*n7b)o@qt=nrgf9M^u|`D37Kt1^*;avIAG2&2}ZzL4Cn(t ztmM$=ZMeMV2uCs zGXf#}vZoN$hkj(C`z$Y$7n(-aOGGM-LJ!IQAoAS(5;7;_l%hd0vinB+Q)XF>h^%p9 z-Q(^uWJu&2Ntd8!4DC`+FQADJe!Nh9yFxI7F5f zIusYfhY=VQ^VU3fDzV|57)v5*;u)|84tp8mrxnQ;gGxw{+dtu{ZSudEsWHv(p`i&` zkWOAJkO)Gv2ieR5HUy-V3V}d^AczE^7!ZO|gc4-ZLZk)NNO6&%lt2lP0*Fw|oKiEi zO6&z>FmuD2zWj-32RFA9yYd?p-Mp{1=d1Zsr!SoDHFJob4;B@=_K9nW=a;gr%uGrV z1?iabc>{4O&AqWDo2-jT2A`bpL!N^thU8d=*e?M;=iE2DK+WN_$iv*pJvuzBAd@m@ zfz9e10@W&_Q1_6>(n&;5{!d#yIN$&fN+W7NkX1E`OY{^BQ>Y)pqLUq-@~Vl$E{~Mh zagnC%wv-oV<;$)b%_zDtQoy74hyaTzs&mEnM0nkteH`C1JNFZ@CEPsWLg8tmyk~zT z^qf6e$S@bO*VXMF*L70A%?leu%>~XC%S-Zvysb^J zx)v&%sYcR0Giq1@jvs!g;mF;GGJI+vIwk`VQaVW zEkf?-L^3B=X^RCeqkM-I^qODMBt0 z!iaW8_QWBPNVXobs)6j@Fmkq1xV&r_4Xnig0rKECFsjuBc}Q!G7)Xm%oth}~8=>bn zDycL4JlTyD|2{>v;a#aiDO{{naI3YWA8xFL<#2YvEaPc@{VgBH_JCvwl*iG6UBx1| zVJBtDqRU*tlqh4IW@XchUKuTcodMAAIeNPS=}bB{pU{*T(>dSd>Qi#T#7hTezhLOV zaR%#vsxC#kVeYJ{Zjr^=@FROz5Hll?kyJ1;5VA&nbrcaeB{xQ?dIANEI0LiCAJEen zk{3*$!!cpaw5l(C+(ovIZOMQapR!!)*fo;)VuhgFwca7rrbjH2al;;k8JA)=dBreb zh8;*?x> zBLXlH1kwNqDIlZKO@W2Bn(ayfVlO=4u#tXZ;u7JmaDz~$Oj@-w2d}u?p#1~QzS#;D zU^xE&so!erK_?6JA&@cu6S-cze53_FPc+Bkl}# zsv2cAvSvpM&jf

    #dKsk{tUm%qs`>R3eikXh#mVe3EI`A&}QnzY8*ed}5RN{Z+o z+Ahx)_jAk)BX^{fbJb*=tro^G(bwYGr;()NY~hwAA+KcdE)a4QYv4>sF?JvhW9EKs9OO)NAB zAP5|&y$?)!VT;mtlr`sL&LV z#Ub9^wd9&7p~t%~X@4Td;na2yxdQ=fM_G@XvI!?czt%kRDhELNl1!5Wvo7m=(&Urim!szA4?|ejF%LL_S}pRUJM)j4u@)4sy7e> ztG!Rgmz5kmBMpmhZ??Y34#C~}kxx|~J0x0L`6cCL6ujgu zRNHRVn(@8C-q#$CQAAEExR&aO9kvQppyZebk8}4;7$tLzT;3Skm*gVr;up%FhiHt} zs{@gS$Q@eBL&z9UQF~f;mPGAt)>k;1u2uUn^j~7i02Dw7WS9j5Oo7&5T1)DSEJC(H zq&=Z-aOHwsHDs&@{WkgZ(Ktn@~yTGl3BZhRvT}8_goMJd0#q#28lkI)$`eScm$O zH$ObGBv%G-R)c9br>H;=>E`S{OaAIRqCpGL{0@@r%>ic%jTfADeH3%T&r7%%wG!W5 zZim=-DJ(;1ZOLkWUElt#&zMr?Dl-@yFoJ*rc_$oE05%<)|yR3;!1;8@0$cML0Uz7rUd) zyFnUyykiZ~#h-I7~_^o6yB9(FvOrm_#mhUZ7}vMzp5(-b2=u zcM+rGLkNebzJ7m_L)L+^DSszJ<<3zTMSuA43+#Sl+gXd)1(ax=xFa2+CvQH;HXsaN z}9ALYVpgCxtCs-=Hpj@tS{4fc7%e`7yl zC0@*sBu+iL?TwU4&b`Zt5t?)R-BXlF3$HnTp|=*`4%`qeMO_J9zkf|j_R0&xHP5sg zWLK=m72{`lu8-j_mL8wC{?}XrPG;YjUgqjeENYl?m!a~r2!YzOhzuhDGRz1l0B1<= z*#bcR!3Wl9%hyEVNPf2~Q)u2!eI3MEXCHmEAdF3vOu(LS%V4WpLzM>?@ zE28ihFK=AK^WIhHr#SHu>v$PF z)L3+orZD0vh!}@U^jT3VHF50e*Ni;2R*jO`3m3<=B?QDp)Mtm7UUldnjv|Qmq#^#8 zzfMMJI4g=K^2x?>hrT_-g-t|yIUETNB!HAckc441-4@~3?BeJqc2EcnY_vPl)~5En zW#ib%A|BQ zhaf0CHEUFV<$EuN9yUJm#C4mtB+$O;WQV-S_*99_kcL_^BD>d9$kRFCFv*3Dw_F<0 zcw%IKXk`{TQ$wC4tYS9~gZQ?NWgB@E91$ZxAj;l;q*jgi3;Eifb=|Tx8<+wFDFgys z-L6^Vt4EKo)%Kk@8Hty8n9*! z>aKicV(4Mx6VG3_d8_`VD5hEcx+`CLD4cWT*mYaBqTrO+4o*z_M3T8KIvY4C8_#_YDP z)^@7^F(_c9)#(ZP{$YUhS{rvX05s9n$04zx{KMkRUt_^bPfixT>y*LG>(zOB=A7x@FQmw>-`L=Wi9f0@@(vBT ze1$2HCv69E&!WyxK0L2K^&>44@-bQ+kMn>dq1zKSU~NFv^%V6JBNJmrh5@QsT4T}c zPd9JWVA8uEU2^wBYd3C6r&8Da;pE#cI42VX`-~X9Xvy-J?Ezs7vnD&haY_-CgK9$R zE^OZAP2sU<~4jr)&Ww{dfLC1=#URPBhb!prQgmX67j)N*qE7$%5j z&ZXyUB^1sVYi=hpLR`j>t>xBE+K$o6kMsq?<}a%=GTamxs#R*y7(@ErQwRYeu0Cnd z9p{|*%gVI}UNC-pMTK0rT3V7`^u+DW8`Pcj(HEEe?TNJ;H>U~LoO;4-=bfGjf_+ZC zaM7|A41)0WbWFp@{Sj`LD(IS_!juY6h0AUV6KpJS_;=Vv5%ZO2A}zSWp#U2v&ZgA! z!a(`7r%Q^`zNhHcWh*M5`eaE_+IotijW;ezepoa7HWATCMsH22laJu>PKX1XdmJ3d zHi#HM6KQ%i9#gLl3o2V)3V(-{^XZhRdc}B(Rk~fI^LP>0KONI&;{TkqwY*~QOUAF- zyu|^o{*vWK^y%F0;~U4W-BQ-&+P|*fwu78m9*v7$mPY0!LB@HAh$saXf>K1q6r>0# zAxZ@o38Yd~0!|Zzpft&|!YKuFEu6V{*y$|en-)N@dcTLWc$5KFn=Z6Lt=~9#80w%p zwx!5JhzIxS)x1%IpMG0*)=hV=-M9%rbtW_ZU(bK=)!dX2qXza18`R!^PWbQOZn;7a zzk{!S!|`E_XpDasliTkUeWWW5m*Q~4^Q}(n1m~GMRM}9Jar&&4Ip}D5$dWH6X&kb( zD?H>-SlRF7pkOtksR5D*1Hln|i7Bu*f{hK$a`_uB(XWjj;wOhACq^mPL{;5|#`1ib&5GVETEinNH z;J{eDnu8>(3(IS!^Rwr1w}ipIT}xMQAVGj2Apm3oy!gqS zPk&gL30MdbAb=nWX!iVt1A2CA)2tE9`KWH41b{?J5D6j*m|2E_l&B#7^p*8n%9@;T z&UI%FAAMZ^R*f63ShwM+cV^uF^yI4QOsEg*)vk5z>BEK}-m7iXMio`n-z@s|;WyrY ze)`OC56yUK{g$#O!_U3$v|*zM9nq?B!xif{KK0JWw?8|jDrq7rXRm+s{Q50rO@^O; z-DyKd59+63escTsuUA!jFw3SsUaLk)hgL4gff|N7rdLU*B6gqoxn^VRM>ES%psnVv?)I&6OGn zozA;Q_$6=Nho%uLMY36EQO{%YhchRC6lPig_4lX)plnBZVVF8KWtmQhM=wTwcx@>z zDthOk+mAeGe*l}ywgKp|PsbknbR5*X*YGRGWim=HK05jBQAZtq>aj;&cF)7*6_uv= z5k2>B-l)Oajho;9a&AF!U@hcH|8$u$kM_mYl&~>>CwbQfcr8vL?3^7G);}|4lIo3} z6|u_9k0JPZ?6t;H5d}6IJ0T!_1)5XTa*VSgoBC}{BhNWP5m#ub@7UIBm`I> zl?H=|UYj-dwa@2*K|&Bx#KaVU0!7K&%QY{uQ;|YSkPt$E2tg2dbHd6XAAjztClBa7 zea?5aOKS}2ebBhkCv|PtX4IeWakDk8Uw76&ZfoD7DS)+`w$!Ov+IPRsefR6!yKAQl z?*CV`qsIU7l#}}(Hhs>#+NCvy9M)sp*(1BQYdvb*G@WB~CQY=3-`JYin%K5Av2EM7 zCQc@{ZQGvMwv&l%-S@le-v70_d#$eOt~%%0dw;?hqe!7i2ONBR+>L!AW%HlBuNRYv zAf7W_U7!Mou$>+E4hO9^qgC_m(;kB(#}D%NrHKY^tJMG)6ML|7T#E(>W)m9G+m+JP z7a@MxIW!kkcs-J{Rca|E)u>mNs0xNV8vf1Y`T!az$$q=}UE%;Qe#L*aNUXcj!h2dH z5hJsz(&GDAQvJhkp~DqW{az^)1S0;|@lvNZhxb=J za;N7XPLlaHGu6ljPV-l6?Y;naW}ZqXq^l03fLcu2NwRWdYuHoE)!b1C1}YR?r}Z0B zU@siVeV6LFzmGWgfHB_ef>CTaZoz~RG9M2e5PF>=q+bWu9s}DbM|#y6NCFMdMeh8} z06Cr(fdI^%OvUW6RYPh#>`q%Eal=DZ{u!l+(h)KdI&gdz=T!W%Y2)S^HC1xRIEbL} z3e|W_26R1ij5t#JtQnxTqub-2tdhfqz~ht-F10EEd6KG6r;SpCU;L-kwGhDNrUxHn z^79lEiUJ|ybKF*>ORq}1(rjkh+x30W6i76KxY#W?O$$&&^X|v>ykFj*w%$*58$9d! zxV>Y@p3r|hHfa-T07+fs{VHR`?~~+{7<{(}+{UlZs|$PIG@#_5`Pywdd1IVyQsQsy zg}cMfCpQq02s%V`Rc_lspPW;-r>OYiMJZM;xJwQLTzGCH93`vD ziFEzlbX~4X%H#OryWX^pkqy}QlwynB3L=q2!e z-vP-2GFYuBvEA$legE=D($=GZ0QGq`N&}~ zVc6G+qR2KFrc?#R82;2~1{;Sv$^07w*zs?(Pu8{9i^UexnEe9a*~j-|cdB;BaVY?- zg9w@v)dAUod{8KFxlbqx6cnWU`FgYaAV<69(&N6-|J>ICttO~{QYa6!bk4z^JGtXC zUA;9~eKZ%S7I~WV&INEj?Ou_~TT0%B4{%Ny+~~{xX1(r*(n$gC>}SJ_VFCnq1HC#wy0|)?$T0qcri(z#^!Hu3o?_+wr__>lCaspcbZmX#o%?DW(+=gJ+&7(X0(Hm7X^!djo+d>6 z%hO!GXZ*kKZA;;6RF!Np3vq@p@myDl@z?#H7HYrK_@yxfx}O7Eqj^iLE6o~o*AyN8 zXea9C#exDfd`&-pK4SvHeaw;Q7` zZxFGfSK?AXrS`*U+b5I3{$Oq}*y#_2gv?SnRrXZl0r(_k0$py=7<>K8baXgs8Z3Sw zT5P*&NJ9K#IyQVeqv{b;iODJ}k?`7|yIl1uIheT)$w6XYFT~RY=gk9#t&hXXGDIS9 z7?5~jYBD@R@06ZFz=J=F_{1Ys(Gku2)J)bldaY4HaB}L2XR9Q`RcSw{SFAq z%Er@zs&N-_{l|AB&nDZyeI)OQ0_C`h-gmFEfm#f!?FQ9~tJx2d&Yi;}oOyc{ne4ff zK2xIFG+{Ov5XQ=o?SWL-d^JAq@G6^)C8j2!zp$5>!y_| zd;hlg)0^$59j>F@NSxte0K4thu~|)3Mb7IKQhrwDioMst!HhiK>CtycC!}DakTsmrgYDNI=5~=;g7}0K+MbkC3GbsB0nKkx z42tpqSd`$bs|cv!UH9I%l7sTpfZ%kOnA#q=o zzal7V`CGli_{@F37q(`42?jVH#Hu?EX5%zW77shr(tt20K#9uRN7qskCP3D7V>264 zbXB7TKf#4GlVIFUrHym!MFSXJ&kSg?oUc75_#RH2qd)k%m63Njr*fS}+(NpV+#y+EgYTtK z-WS?arO2#T&MR3jk`OCt*!sLA{D}sOqKS6lQ9zr=@j$sljo~q+S=Kt3&d*&^z9Kf3 zIuj36l~f)kZC7HrD|QNsCnR)kQ!CEScwvv|Y}R}%)c%acBOPb8H7-fU%K5zmWqs59 zd;e}@Wr4?Wr-8jNfX7#M>_v3_pJa+bhe?^0`l#p5Z}p#H;02&WcSG#s_QFp+bS_+u z9^HYiIFC+&0nrO(dc#_v?c3dFK@fT67+oBM5C^Ffwn7qF0 z)o2eNCY?Uteu;Nw5P)A4ZWX>^#Z~jD3%7Z~O3d-l(&J0CC;t~ep9WYh9$~DAFx{Gx zj|>SsU98fpiVzBSJ|6tEgIbs;WeCRy42V#YTp&0Ks2Mm26bPu=a_QjG8V-I9#c!*9 zYfdE&E>laJO*xi7RPn~P(D(WH&sB;lO?K96md^t1p5E;`K@a`U0(zepNh5!=+`Mvg z#HrYUd+8UjP8HK2o}Cv#C>y*VMxVr&@Qs_|Kg>lVxZFCsyhQP%aFBoHgyJxUGgo1V zLIC<};v%KUuC>+ji<;%j3{84{l<&pi*{qdaqQoo<|N3X;k2!$S5$uYLJPDx_0L{|{vgiRGAZ6E{J zUS}yiXfHSM5^UU6hfwXClaH;9D{n0DOO2CeX1zx10>K{3ZR zcCu3zVBwk2s**lQKdHu9hPoM+@3mX&3BFj`dDw1+16R(_0`=YDtX$t)J?*mm2?YMN2QS;p$ zE)~-zJuh}Wnd#|--j~_8m|4F20sJv%mmvRbG2U+OZhq*7t{2ygmevijtc^&oS$3wu z+R3wDN5EZDMG~A9c?|1$!2+dlOC{fdx zL?3d;>lSxY=F@IAT_$S=_x*&T z`cA_ZlIJ^>z{eJ))U>c693Rud0NF&RtHny~h#xQ@Ai|UB@J2+x=l$=Rz{esmDHCK% z8XOSY`!zjfJblsapUT}V6&#@N;U2mJlQX8>;wvG!RR9EtJfNl#%1w7ZMdw1}4$R4u z5!M#pqT1mW7xsFdlSa}!r21l%j_FHp4`>O5HTwVgcAsS^@^_vI2HGn1 zUio6?G}~N;{wdYd($g%j`7*Xxe&@zcfCbW5gghj=FVD>t;2#-s`RuKRkwhp3EyWMw(phVl5z=` z9nAl@_~?0e!MD=Aw(Xokf;{}<573o*Y+7Z2MvI$o_c~i=vo-Khyb=qw-5{a1>tfilDmNWJLG_LtKoqvITcE4ogb^weDCPxH4GKUqa=Q{rQzzq<2vRlb> zs|FIeGQpuw7m&LfJ1LoFRT~X4a_x((${7*hU7kzd@K-%Zc}fdGwBWppeMQV5dv;-u(@xh?x_0SJM=)Q$w{7%=v@keN9T+$!t+)0TKY zf{tiT3q!^8B~Je2@_z|VkjIesJiN_L*eT&Kk+(-vKg|47NcX6|-{HC+pZW(Nf@+N8 zu73o2BZL92x{YLV!8*p>C7w3@_a8AqtdPVhtF>D9rsRA6ZClm?rK4{SPn)XeD-+H` zzpAt5`yvEc{cnE&jKvYjoz{;QuQ|r96IOHel$ZRwHMdZzj~$yH6$G4ZT1Ux2eD0wA zrv~EmxN<`cd>QOfx(KXitVns<-k=42p$o@nWKfWhAx9;gzgezRi>q-sJWf-jwOOs8 zOA1ux#3&GZ91e*9Ksj*yoE{%{^S8_XOG*rmOct;0zh?J~)s~nb_`ndAaA84c1=u9W z;(XGIqCY;)T;z+CQE~ZZ8(eS8OThJ7JC=dsbz5eI$)f4d^Vp@ysq zf+9qPQ3a?f$Wk7B6g(vWLI#_>-Crct)HyUuB})8PVoq{X=N2oU2~w_8+Ij&g8k<>@ ztee8hw5#<>MO6iV%}jsrJHZd?*R28lP#rI0wO!AW%@*xxm+$*TsK+Z$(V0&H-;W$w z?FqnQr7~_`Qmol9wHN^CQ2hjib-+CA*2BKEyc<6M0z817qQ~~$^T(4cuUo3YN&12f z0`IGSO#N6vI$p77u}<`9Z9F#QF)N>Z1mskj(+;nQ&lax$E?u1+kb@yQ`JYuuqP}Z4S9<~<*)ST`vl^Z zohbuw5csIf6)s#uep;_R+El)m#r}5}&b+~#``ixusgf!0#VXChHt4=V`=0NwEKd_T zlVirk7lQY#`QMn^SaZ*LpU+l}9`j(*D^<1Hl_k-)+gztpAzr$EMWdO%9j+Z;5BZp} zoPV808kGsM?(}}1X#3ioyL?)TFcA1f^QHp&Y-eOWZyulTh3R?9fd%zA!((dk=22u6 zC?{>5ydhJ+?pEBxc<{lO!z*i^77J?sRJ3A{hs$}xrN+A^Qk?I*4b)O!5@8fM(nh{Q z8gf2X+rNB;5=m9zaEw6Xa{#RHS}L~)h>!ZiaP zj}eT>kkitgWUk0dz>CvDYF)u>heAF`zMg>8%hOXml}Xw_>-r~+6Ib0zo) z6*W~t=l(~`T<(kL1ISUnC?KrrbJ1)W+r!NkE;?hHkcl=yLqp-uxv-u&=Y?hO`*t)t zF|y?_UH;x;ztAMa_uAlQX$hUEk;rk)u8DnF3feg#xI2o;G7f`F$q>dV;1^prJ!obc^mL3_t+93bFk$~T7>@FZXf;>&)pB>oB|x9^vff!c^#W>w zaZ#oMR1>gV^=&_9PKZ)Zp@9QH%}N549A()Ft?IMhs_9H@XEKj1I6yVJEuCkWR&>43 z>h^rSn{C(2x*EV9Pl98s*E{x^+bH@(Np!6@@>e79hK6CIC-z ze*Yl++ixfLM7*CZwu%hJOqa}ezFBV{pL4$r)RZ9XefiyiGL%h+zjeMFEvzfQfbJ~$ z)Q)Cu+i&~l`Tjl6p$nl`8!g4{;!-D@bQ!;95S*K{AB`4loYvvnR@%@FtUOSy7zNj+ z4CgF$TIH1OQ;8!NEboilVsK^&jLQ=6jDCaMeA>&@R@4yi{0m2%$}Ca_75rRhYn~AW zq*U*$9#rtuVlf*W=0mkuuh$h+yiE}LeU5nNc7MFCkjKhuf!61cH@Su!OVE-cyD-G9 zfl7fRUhq>F2P?nxOfDl5&=7P}wFR8la+ zNJw_=#I-Sl{18tF7wk;Ev=^#bFFAy8fGS8N;zp7c!-pV~BpV$AmzKPSrKrT7mY|_oE0j=~z}%YMbKnf8m)wed;=ZZU zY&bmLyVMEA=c+38u?-~)wr~Id90jGgp9&NO9YqOLI6NbX3guU^C=;X5?sV5opF`hl7=R$$zv(`Yivm z{jxiQiqGJ!(~1<7Py4x&Ia}Ll26loI?&Fd*p5S68&408;^$!-axpD={Y^asS-DpJL zTNqM!dU{^1het++Uy+kOTQm)A`)lnVo`WE~8F6XqFKCosJ3%1??cp^mUJ(PCw4XX1 zod+zx*cieey7F{v04&$F?4`e>J=Hb9+ytAQ1v{l|zhja(hSyDi++>;^28#oM>X3>I z+PHaxXvJN_D3$?%ZJlcaxpEZoM4u>m;a@(xFP+vufwN2d5RZ8S>&Xv>%KFQFHfv;6 zB51W*ss*WQ7QwO*azeAE`5C$&73|CE7T}Y2fA;{it*}s_@V3ZOzXblG{67oOLZ;yY z?0#-yJ4!J@t$9j`satOC3{^N89H!4ZuDJ!_HmF%E?GYhu^iBZ3c6OUe?3azJQ3bRW z?KND}@vxM5b`bCSZpyt!$wp!P@?NuN3e}zA>I3l~V>9UH7LVly31;;3dgznv5^ibI zEF4@#<-L&L#{n#pw4#yFqQXUeGJ!fq#?$7%^-@79%QR}kU4?bY`|@P(EW%(eOH06& zs4zgOK!mKcL)r;`fPnfsG%(@I*yDu2HDEq!z>!MpUl%#1tB+?2`lSx(5fL5xeguER z{{8bhWY;?3>^k@=Z0e3MqhMK`S>5b&y3=_~^F{vv@)|S>QoCyqYSo_MG7U(k^1lcQxlNww z8bTi=b9FJfm4c`W)o@iMASEvx)O0l^@yfF$s1lKdvIwoIm9x0J>^b)wj(pC@O=*{$ zkvtsFHqbE_iB*qmixuK1VTz??UNFul%v>uxl#q^nhzfSd(qQm1>NQG)wIejCV(uN* zi=O<5lRw8b%&6KlIQnK7W7$cX;I+9AV>;gO#75rDMvG4--XWk8nK2YGmKCIU;6b&# z9$n+(PAS&euMCHwn*iEQgS;afI&l08M^Rzgu7w6SlbPPn!UtZKi6(J7mr0NWEM5r) zc>(^XdRv4dIi6H~B<|a|Q@Ic?N~|IawNS7}|HB_l%3%ZX_*IFz;i>2TwLS^flSZsK z+_DF3h0$`1AF3u?69WYOq;X*bpwy!Z``~L)D1U{Nx4>sqiRX4+2$EYH&eHXg6`o^SDV^?9IHOHFz{p z)v^>ulHU*V`5NKZF`Iwmn3-rZ`I3GkMk}#SgeQGq35Zu3ELDJXIEBycl*o+D%rs>D zl-;KUQG-oo!t6(5Zc7WQk?ABuLse|VJFvi#!Cd#j__Dx^o8mauR}yz&?2347L1Yb| zbF?vvFI1QP%`6z$JL+d}<3-SApeYzSdLIl(y$<_@b{+n&B$BkgXvV^Q_*SXbTWQ2w zw10lVU|3cGLI7E(3VRu3SUk9$M~zMF4@&mJj70cAQkQ3tH;S5^!ymWSVaY!;>wc%hHH4NS3CuT5WEj=pmCoc>R2Hh+IUlo?&r{-ImQdkusS`uT(r_RYj19pOM>Z4mQZE=Pn1^e`YkLDgTsV>8W#2Z2tTfdu86rr@@Q zI4Dv$vD9xi)Go2wh)FWnYlP8lNgdy~tK zwe}`zK-?<_*Xmvj#xpiDuvRW8c)0OUNxYOi6AD#jWbr}bR{${)Jlfs0D;EZbQwa7? zg5V83DN9w@Hd)G`A>>a^{^RUD@5S|sN#m#CrtAdSi1fVpvT&Ydp;o#i{>>$X0_BO^ zn+Y)nxB7dr9zI;K#@dL>ue(-?J``iEs!~)+j)tVFCm8re03mA2&^UcGh@89sy#UD$ z13FX|8>%6Kh)GXQ+{O*nv-uXUsu?uQ?Bt46X&aT%FO+hLT!~VNY*hEnZKHA&X9hT2 z%CVG4O0!3`GIeKME0@$X=YkGby|iOPt{;MKQHPe6mDE<>Od*c-PIQi;-o^;`KgB}v z*)caF1ke50-R1C7JFTl-UbIv~)iKa-PLg`p!!yObX zC=TZ3^V)_uDAYVaxW-&OWYUKH0c!?#aNu?fr36FfMS`XeM;)<*1k;V}5AMGi?0`OW zT2@Hk7TR1ifAU2i!o-nt#we_D1TWH!8^jQ7N}Xz?vHgg@QuQ&$dRNqn=3P%v;84t0 zZOR1OETA)^q!^`WU6f=w+&{NaA`yv-uuZt1EN2|Gq~T&t;{-KAi;H{9ps}J>MSR-E z^+-Cb!|%KZ#B2u-#jn3ij|Gd{)X9FMfjuq#;)kJVKbA|zm3sf=r_{-HDh*QU%@jFt2y0XN zpo66;S#2cu64f;dJ28rUj=wc3U%5B9)zeG%r=2veqkIf@-IS^cM zSUwC$3wABlj5`4lJ#?&-S!{J*wiXX_TMS_Lrj9USDkNbS%BUnPjz9o zui6fsh+~bSt2Q@I-jzva387^vF-PZ0)>Qgo`P;`iP2cTYkVpbw_dva!2WJCkfAoUT z7+pr@SHO{$Jk)CoHkb&5FlJSW*xqbZ0k|IPh}O#+P>;Xnt? z4*mtO>Z&TG-*@_if{soDoV}zn_(q6Q`3l}lQJmBOPl&=zL@PF=u;Vat3k_Z=)oI99 z3s6Z*(J6-|TxomQu>hsHvsyZX^V9|L(J0l)E-f`z5n=vS7X$^a^XLN>YL*ZZgbH(Y zi{Dqw$??U#Hp*hQOv*12$m{BoCYAgV9GY1%sS?Z42DQuc%&xI2C%W|snvx;fb0Qr{~8w8X)SLNW}wuu zLJ_V8tIC^y9wbRssD(GAqyg^R&gRS(=_pnrwfiUG8-XK zFV11@NvV*rKKLcNn9iEyu3Cu;)(|s8;g>u9oFKW3@(?ookqwUO>$Dd?^2_TTLbBq3 zNqt$FmUdL8`)q*b@1Gh)rON|*jB&3}vW()h;BZ!PU_+l zW%)_aPDc&r1-+P)muIfbJ8h{o8f*9vi8q_g2elNeHRHEW1#z?vE4p_MHclhZb1Xd?etd`(NtyErMRZaRmqYW zYLlSC7a3W1M1pCEX;skJ=w6%!mEY~F{} zK_t87yzM^?4e}VY9o}z~sRCJ;@tENMI%5#33Gt+<+eJ3m4e!N8uc^;9fFMVdXnGlD z$PG#L+P4*zbJIb?gBANV9NzY1yJUrmIoqaVU5jp~`aubD!}bgp1261JA>wr%H;r%Sc)t$!;Fpq12S=6+RByywpK@9}kfoouNm$44@8y%}=rHnz1_x5&Y%E;#)tiJufV zi*a(4`8@|ZuA=Z+g;!Lp_2@^A!pGI$2zJN3n1;dT^n8vB9ms&nh0QM3dikw?SkR>#bH_n;X}usp_M1MVDW&Cb3!UQfQycv2jU5 zW69wJ%7(~coHIMfk#`>dDYn^V*fi1BLupSJ> zq8=#xoBhj`#R@%8pbkU!@u|XdF<&>9yXidnnUDWy47-4UIiQgJDC!$3YIYbrejjd_ zPFNc%rFWS`%3f?sa*8@WklOc;t|~X)zmz=@@|~kuFBl?IGC0qc7d!lPocpuoAb^+u zWT9PvcImJbx;TMq_uFHjkG$EM@Ak{w-tRqFBXeAaNS+?$j!e;LhQAP0Wse1w`FAvb zR?uFFC3^dncAp*1@KDOR*MMdM?Cta2g1CIo?uD2@?TZ*z=oqsi!uv~5#jmnsIBWm4 zMaM(UF+5x9M)2-`qh*~fW^tlj(h+AX!Q)D3uqxeuVD9nik*SHJu)?BA7#()gBG#)* z;RlW=kaBtbCV|~bzcm~j;GBuf?Kn-)T9O9(pP27w`|I~wN|PtH8%@?_j%2%>b5YEA zm|r1HsAIc?2SaoP;E-j9Sed~RRZC^Y`eC8co<=|U-HoY?%b5nvsd4+MGr&tE_RWKaPa41t=Y7(y4X}*#(Rxi z9@~SKJ^#V3cP9N4QM=Q0!*s!nL?fnxp$Uf1^)|S_N1op&S5WjKM6HN(Dh%1i0fw~z z7>dSt9WHMNB2L7`snFrZn=ve4maL^d1E}FYD5AoQ(QfgQ{dP>X+0jgyj*0trvDTEU z5&t@>33w8&UXW%^HWp05f-FGGM#JlqkU^V2oA94YiC;kq+kv^LXHW=?NIz`9>7c4X zy)Mhp%FL}0zOX^XZR{*&?HztQ8YiY95JSs88D+Zf#~FU(2RF7XiA=21B_j^i__j{SNYZ> z$8m%R6SC+-6cr5JgNdE9vNbxL^*$4N%3Dt7Pei(t{D6C?-O{yUd@~sH-V^3)Z{9I? zd-fO?Lcw<*8=M^)o9!6Oj#+vITc@c8+fq3kexvUimU?&Zn(CaZEP2gtLN;09VjHEU#;+jlmmc+-`(%LhCyIrZ)bGrW* z2(Zhzeao2ArsR~33=XyfokFk4qaQc9!sQ7Hh|2Y{9DKqLOr~1nFt8ycrilVWZWM%2 zp#N3{Xu{SAl6AXd-$eL&va8%Md>;F%dy`VLpm0!6<9S_FpX9dtOm%!6(7$?4ahI>F zZVD66GyM%AJ_L);d>oUS+^d}JVaz-CvnAJe5Wf!QHf>ys1^Ppc_kL`-*FQ4xA^9F{ zYd><>`+mFzIM*_UD{*eL_E=p+Y$2}JiXDh|j!$5Ib{VZ#Hh#TLN^iJbEHd4g*V?ak z6$|a4V1C&B`#l$|eZ6IJ`BzrHoB90jd+w@ci?p%rf*6r1g8C|DnTg&LO&B>&flmA+ zCG7xN`*=7feG$4Tf~|z(bcWL*S$S{8nhZZvZa5&zb2C7DhRgGH9pQ7P^XY``+;vEE zC->{v+qvhZWnkuv%(r1TjI`6$a;c3tC@-!-Da$V6j^BU|cyA;e4SRn6O}agr3XrcKU_6 zllFA%O)ZG=yW*oYce~D1yU_5UhTC#<)%cywUc>+BEhe_-X}X9ahX!dnT{&h*IIuG# z6JibIcun4ZwV`@0&QU#^*W{uPaKi9^0~uz_9{twd?grT^&^hqjrbDN+(Sxi<;5%QV z72O5i&xU&W&7KNv=}?L`a2y{BF5Ujrpb@lqaht-? zXMQOA(tWa4?7gaqyhxQ!{XUpNBJg}4oP8kiGTJ|-AapF#dzdaA;F<;k^6XsaR&!_# zBX$IQWqwmK-F}50Ck0*Bf1SH!)N26>rX1t z1=8>A*PjP7Y?Y}m{0zFyB@(Hh=AV}>JOuCRtfrc;HEg&X5WP`waA%7Z*kSjrVT8Q* z3>=sy%tz>J$>+)_pG%?nx<{OYMh?itakRcBd818*WK07MnMb z3-X)}y}q%0*IK4Q+|=@?6l$o%T!Npya85h+oT0`B4!MH_ZB7Gc2)z#i*Xv}J%Ub&8 zlQ}%bPdc}G%}QIqWxm?dxJawq*d8Q=5y>T(_LQI0>$*u*`2Os7zrbLnR?FVDV#pDV zzg6y9sp$X0f}Ft?bH4m#aCXQ(g#!lcwMth5XKshfzlCCvTDkXZ_mv$(aBYy?WfqCp ztDXBP`Q9o`C0mDDJB}>=3gvT*Lc7@%i^Ofo|$6nL80@bR!Rw5|^IB&73RIP54 zA93^LZaHuE-?%48D=EF$s=uUJ(bs6yx=q0^j#8_&)-kW$es8_(_TK=}eHM6~4pVKA z-Egmom(Immsev$vY58GwY3BX8_~p%k?XSWBz~uX|@e~s?VPgO=`43G(vD!PmI`*z< zX}N6|&XAS}fg#km(2HaT&*0(BF?8wdWhb(Z63bHWL%&p;=P+un3^`A})k~tnz-_E!h>1?&xKosswnbPmLUnbCf z60lzF>y_~qsx^*DuquqbT6z3^t52r|>LK#>=;Jk>Eb+`~vKrrQ*7eu}ZP>^Bc2Uw8 zo1~6(`pJ>pE#*N>S42B_TKSiXyHZM$K=8y@TekOT9ynDI+IEqaFATzoaa@R8u2%{A z%y$@4?4tM?gUuZ;83$4Kl*gfCM=1c!)+*O6J3ZO*-45QCR4A?%OCJkR*H~-UH~hNX zldpH$A*a)D(-sR=w;zNlSuP8@J9OHT1le9Ly-*B1<^!`kJuhDrwZ3=7j5Q#@izT^i z)XJXJr`j>lLCoeKZ3AB{Z^QMTFSmQz{gJ!dlnUcCyuf$?)zDi0f5U7U=)h+4O&dM^ zGg%w#pZT+SCSR=#zvg%FcOo{bul;hBt2f*s54p|#TUFA2w9-q(AvUI$$imT;$bl+_^ zO&Lp(wYg98N#^=Am1O|Nf|33OdcON2Qbb>uWeIzqdZJ&R{UY-EH?s@yXu!oivk7L9 z>s(8-rCKwbt#TL&vgtM+7cIfy_x5O=fO{0r4Ub&EC=Wk#Pr&PJV)*y{GqIL-r%lr< zbQaM!(RJw$9kd%b>L`@C&_!X8!c~OsN5AHuzyqvVapZrC{Tc-4X@$35-GdMQPaNlA zAn(mqiq&OhlAm7JAD=atR~@gTgNO~rSB|&tV4EuK50<~B3gy6^>5Qh%$Uc#Hko!(o zc6w|c*NI*a!*ahYk1{xwenlk+x$tXV&X#y816ujmeJ7sq`%{4iy8i^e?nFj(IGv{@ z5*UTlnhSvFO#0VS0h!S0%uJ5=OcN#u{N>6*8F*9&C(>=yDHrA=6MBWogT+knCNPe! zscss0Jed9MFyKe`T%)G4Sfsb*ewFz!V5?5JRxN!+60ohyO|V+?2#j9P^ZHiKR*HcZ zYo}nBjUUMw(Sy_r?Sc;ok};b= zz?24HmP_bqy1aOz4|dZD(kNO|L9hM#a()fMd0bbcI?Upks~@a$EC=gTB{WV81A;E=Lk;2-~5u$e^(Xll&ah@dH{sPVQB3;@PoAF~6w z>Va#|pAy?X{$~@7fRC&2L9`$%u@KDf&)kvCo7Bvl98EPn0wRC6s}G6oFXX;}8vKET zXsz?bf9ROKovpTP|91auNKG7nH|>vj*K9l<=3?ylPSF)YsWH$;zHsvz3dRm@wD^37 z6+ibr8Y+|~dg1vjgcl-NY-=DoGkIfwJZKWU(UjoDn__(XOuvmbyqt)T!AVqnU}sqv z$AF1kTUEoSHWx$q9~f**X9Ev&lOB3etY|U}wao5jY%Mm&T`7NSJiHtsZA(B_ z#Qd|Rk<K;0e!j)BBHo#iSNer{4fpByC1l(gA9JhV{e-=J67l4>en)ryEiLWJQNV zAaGl3K95UHxv?8h{GIp018tw}3ff6&9qAX!HQH<-fQHg%|5UyXB5#2bFn9LRVSnF; zBcu~;hTgYZ^Ut{m7W>uDa9^!w`YBhNa^2y!5E$Ydm20OWMaAbswa8*Ex1Z+Co zMH+hA)jHRAjtRAB;?%$Y&jOrDn)`olg^UocwOEoqnw`|#rRVx!?p)1R_9Mj0mHWC8;pc3=FZ+qsp5`UoD+UgAUBSgq^z0VNL zKd-W1cP76stSPv1PWYTILx9xLXTSQ+*4H9j=q*aL{FFFiC<`hIuL7iA;Hm_zy1dOs zG6XvF`;aD}xN{uDggK|eRMHV8Kz73|4Sk4VqXnc)O$DoZz6HOyW0an51ATXKp~*(a zzZXL`8+{WfBz`DnbFKL2V)XJzR4gt72lH<2PUz{A?^sJ?&-zPpxFbBStI0Pk`7PC! zhsa|rpv2WWcfQtpqab6>Cw1AUXimlPG9J zFa&vHKTnLfADaNoN(3w*=^bq;4{3##GPjS4)!3`uM*TG@EZ1(WXzn*^Xf&?l$A!GW z%uZ_=+HX)rf-%&k7hpDQaFZs0_iaA&@O35IRjSli+Z|{&d*dr%xkiU1oB0u23MSl? zNTyJz*IghS8{V)%L*0^^FX)P(3Gs_Qwy9yzMKzKlRd2Gg!Sc~2NPH4XCUH?A_{@A! z0HZb-+dC0s+0R-*O^@m5)*P6y#%MUy=O_}J^SP#ua}6g>M^EkZ@fK0|_N>$7^LS%z zS2_ANE{Gm1!_%+1z9O8SC~*;i?qDUEe_{&CXa850Q)j}eC4{HLsCRse4~)KN$)`V_ z&{HU<9gh}mfuqx%mWtNK~XY)LdilGNR{NEd! z6`uR-*OBITEW?x&ji~FO(Tjx-L=c#7diuvrmBS0a;0^Iin_@7UVVXUMdhXwcdXd}T zHv<<)30-u>;0zmU;5h^mVntkqOIO)i6N^K=QwXTIqz5NQ@F&<4N zo7Os3Aw6{0qV2)ZD9HIc>CUA|2;wO#q)uVnT4Ag_%3Mhe#(QbeR497@lTiJ=sIem{ey}TE=cGjP4Tc32j%sB%XedVKI&A%@d?`4gE1{o^KEfD+4wYz}gGmrR zeWcC#O6ypF-%6V-*0-Ha_6y&$!5Cjn7fa6q5q@M-(nhj+Ln7NcWS5k-;2oi2Yc;xn z3W@2y=$;7DzWMMRhC}<5zTdfOHJU9>Q_|Pd-3RsNS6we%aB?`@1^%_EX1>s%qspo7 zOO^`eEIt8cb)4EdDy^0x0MmXFdNP`r#x4!@FQE|QGc1O$0nC))RLa#XLiZhLIgoW2 zCr=P-Obu9Sp4P2W|JG?Zf34fIuzS&r-ETwbu%M)XZd^8xqiF#btA)D*dw(pKv1(vJ z6Mf@>7?K&(2 z^Ev~yZu6*8`R7}*$D?UGSj4~p((W;9=(+@Ao(VUQGTrWhG!?w_kJ1Yn8)fi2AJLDP_cDP=3xeNe16YB_E z%_`Pcf!&>8K<&1rkJ^b+LQ`CA=UIBoGAhT?TvxNmu-c>WAXr2?dbd_qEv` zMY!L<>o2}B_Zoz2y zE#}Phgq;qgN~3iy-4wV<+8@Xui(jJ^LJ?E$DD>=v>y4Cz8fsI!MNVX2zTQ&PQq$4c zwUakk>xcoCj}V?J*6K|gAq2v#ZQoqCk@`q%!|bXPi~yDFcI+rOUsIXk`tdh{M3c}r zM&UWF9@qhc8_hNPjekRJc^1p?=BrTy7*cBBqtyd|ofL5jU0AML3iX@?>C_zlI%_EC zUO9WHgtw#z2TGx;G8pl^nI0ta|KaMLq9b|3_3e%`v2ELSGO=yjwr$&)iS1-!+nLx- zCbsqO-`?Lo`40N5*6P)(y6UZZpXa*s$oHh*ue|ZNr1bWs_ctgLF?mr(4Lvo<`@3x<2A(Y@ERe+^luD;2v~6{3sNig z7HyKhH1p=lC0zPRB_>nKB5c$hit4gv2^i(KMw;--JGw$|jC)GuQlWkEM_TtiAJ(^j zkK@h+UCxiDahAb;*ZiUIiCJ1`wt~Xb|bdN9(21KXd7tjUF~=^y!0Gz$8(JW+b^nW$ew(=pC_c zzasUauIM!z#Fzv4W_dqXcVw}=;R3B3dMI(jN$DN55H7y(2^cfr+83sB-?0P7Exv1k z-uwQX6sQND+R=W2`$m+`D1KHiFh$>Y8{tMxL#258jm(d5wIgOX0-z3n2kgFoC9|J{;H}g&3FpW* zSw60F_I%XJ$0cKDnas>S&0B@e*na)T1R?6FcTbKm*d zvHA8~X3y_Xo#s9x__bMkwB3KbKOh3|LpW=Gi#zSl(IN0X+dgG{2{mYS=)9PLy6(Q~ z!ky*5tZeAjY4JCCv>pcTNRSUqxZ!^B*@Z`{L-0eI@;QvW6Ha$L450VgR%)rDiL!2I zKQA>o^fJ=_wzL~;8M}oy;Ua%+R+ynXQ>D#g`1_r0c~s@;B*c-8w`I*_f5pSX#T6{` zYx?c$2AFiX*|i&e7IJk=&_0+uqxpQ$K?yUD1u9vuRy?uvT~NF7(IXn3HI{Ip8(t; zx&o%rFa^A3*9|zX)r!243cIdfSMQ^daD!&ocC^umITIh@;$${ zPxSvp=H5L_ZU4FOc$E6dfM;In`{mX*43M__;9(#FN4E-7vd>5|Ld?*Fs7sW4U776u zcAQ_L#PitOEgDeI7P#Nea)1E;`szR3+V~?-E*BH_ywm7@zuYZd`9t6PD39|vpeTIw zfxAGL=i*PE&gJKl!57ng3S-p2`llM8`sQ%ISMYvpsKGm_!~N@g^7_N-BJwmNm)&ji zn#Px~Po}`v>&Z_cDvUXnwN&7CCJqySzTpxvpxyp+`I0?42DI#{|Ie|&*HszWIcQ@E z$beXKgB?V8=ESZLPckDThIzQeojSE*I`<@i_`Kg@4?o&D>*<2oA;w?7VP{UIj@M`E zhV-4yX4UY0Chs1@SJ3SZmUTNHRgYnKd1vCznFrmF?Cs-yxO+rC*S8rj_EUXzC#fBtOt@;}|puE0Vl6^kxD6Zauw zuxJ?Ar+E%%YRz6R+9tvoQt4i$q_X+Gn>9+p)G!BxZo`D$(VOO1Nh{*IwYG{4tqcRN ziFzXmSBIrGqtn{Egr3j6FHC)(w;JwOc+{;wQImggwM`dVFZpNQ2U|?S5l`JDW5gdP z-P3x%AD>kWJP#^3cM@>ZSWjjMoi7V&xy>v`)qSdLimf{sjPkgjn}}CFU$avp4rQ%E z9M=|BD(~ce)w#Iq9^l|U%KjqB)1gjVoJ#1$a=zzZi4~|dnKVBG&&^)Hiv-$*T;D(G zHRAc)H4{Q~*ef+Usy>RYGd8~`co$B5t4(NW>;CyHU2+z%xLQ7gF>>{MugmG|yczeO zdhl;{3F`^xR0Vro-!x7F9D1rVd$s`jvKBS`V78QBhN_L!$fyH~SDk z_xk+XC)ueY8^#V94-ooq5=Q6-RMTSEQe>KCNH4$VV@UutD3%wdKd7ZMvti&dIH`8z z&`ac37Wtc)%2D3ftdqjp@UwT{`L59c6fD5Xvn6} zHb?q<$EW-dTA93pk1BH5@#i0=3l;1ml%9YKJeEaunYp)A?bv7gMu z2fqUq`-l*+ojs$u*O(}BG4HfC>*p^SSyq{~&4a-a1W(9VxW&@EIFMD}Ok&UAIg4f5 zwXTY6F)bRE_Zy;q?#)El$`}k~8s;vdviv}yyPBx|(E`iNNqG9=#JmRDD zK(dHZ39yq*aSmbsG(S!w^evEL__>s$!qn0AmZLQk6#PyOeTF6;9*K`+K?PO-CvJ%j#rzWnbs9Bxk3_dedTfjIDCdYY__rlIssl-SNK{qK%Fn;Wm=uLl5#I7$j;RUmkngM=Vb{QP)_M=xqJQv3omA{LO5$8ckp#mJn z7D?*po!21*q{2u_d@y4;`D+iGL*{sgr(_wYv~2F)m@<$ZXtYg8J8E=SK~A;=cDIaH zNGT>D97M(L6!QdunD^$6W4_~d!|^e4y~OqRoJ4urs&7kQ>WoB}9>Q}Pq@W>a0AFK& zAgJhq-2}+OPzGLN9_R2IL$4R45IcxjQ^-HD%6(HyQ2#E_5X)(~L%|eIs_{e2o}=A()3O#n)(dq68vwR z2j&1jbs=!Uy%6=fwvkPxNKB8PNlV%v?ocw{u~6LW2lLxGflG>nC4!E92Wf16z=pH{ z?GA3D*}Ci8FbnPb6?2{X;*iu>ghIiDMJsHUjW-Ue>c&~2MC&U@icp;S_ZeHul;6qP zB)o(G9udj#XHz)Dsec?k)Giz3T%9>?J51w97;p+Vh%2caY}1_v+tR*CIKo$>XL{vU z+)=HP9Q2UT{v$!uG1Pl*XH;v_>bLW87}M|~q+knRlv$n1w)VwX6FxUI^=_b|&m)mW z8P9``Puhzko&zJ3csZE$qt8YZNbFspLNS;~mteKRNMT1&wubcm1BG>^+awdT-H@@ev(2~N@Okw+3J#qv`6N*{+xZ7NH zQ!qsq)6A)WD;gb15b=Tfh;DN3puLH4xG36g+cqSy(+%R_5!Y0ZO8L9RAUY0BszbtX zi4P6a?#>(63p#7yU+!^}V?+UY0W-PiGrO-T5d77XO}=5!pimoiqp&qqGpLAtpO(^ z{M!OJZ>VC<_yBlAY?3*mdGsKADIVox%KPF75|^QWVt2v!_?cSy=4LvzBWIrzoHb~! zk=0^RNNM#m@`6DmoT6Qhet9t*t7chyroTT3u9#CVsgt7yXIloJ)R=%C4j5V#NuR#; z^)c{*C}=H6WMov|zL425CYT_&%vHBSIc1GQ4%RB@)Rc$sAFBuj4`;&|cD3b-Fba4} z!un&YdxEf(pHSKr)~P1?H#?I*kf~9$c+yZ8g>iajdl(gx$;QB(MRK$4Ni!M~7)b=9 zY2e?aet$z@fb*Yu9eOod5YtnwHI1x|SUHZcdGv{$&ZO2VOIipQn~nX_I(&l(X9gd@ z8{R(f8D7i@uE9Zq8-<3A(B|T!n zh9b8z71JLMvhoVUKV!2=E5LBhuu7MP_(f@SB%C~dV@}hQN)~Bf*nB@M?d;AR67m2iGgmR%Sk*qsbvLMPb>O%n^B;0{jt zV7mEXw2H8&DRZ3-xuhGZu<#L+7JC&Uoyo1$2# z&`w$rVj*aCQfZ4Ma)Q6x<<8hd<}YucgvRx4&!Lj7^1p=qihLp?8v-QS!^TVxTDV)+K;@RhRr| zhzyHNYrNGR*eIF*J^e%x2d|?zvNE5f5--axzmJw@aw?a7CV@kZNG%91K>-kTipyN!)k$|OW_ zN_fTzMB0~}qrDu;%Q(mBUnJLBgz+5m;u3`8#<9dmaS~caI zIY=ygEs zsj-QO<7qlnw9^JKx#$SrG3pZZi*ucd;aVa3WbJ9BeIm|DP#_l($(Tb#g>)g%#-++8ce@ zsOzQiu@udkWTm=+HS3TUa$aZYt<>sb3^DVB@&ZaG_7RJfy18+i5g=-mE>d?SFkY&* z8niuX6^ncdkFMLO!0+WSC84cJA%GsDo|1^2Q6v2H8_^x?&hG5nbft~mfyak@jTGKP z{&a_{4NZ4_2Abo+r=N&|KDcSk)Aetb2kQ4Ve1_>KrY8-unGW|F z(LvC7Iz2C&Xqs>d{m52Wy>drXu?B19y;efDD3XZhUiDIRF%K-OwJjrBqg5$x)Dbwj z@U||^MdU6h{1d(oi!(ebE6wglu0+{tQ5(wc6qVlfm{&_}UQ7~DFaUn266`f)@9H{| z^>(_!M8dyig@S}LBh3Rk_R0zct-;zR$o74a2H}@GuAyCV>W631D}~DQP>QxL#Ax0` zLU!nNXa-G`fCL`K$GAFG#NN75Ahv1Pn!8Gq^y}2Sn1!b;*)SU~{v{8=NRk0ZXClYi zXra6*4$k>kXDqi)&)sF(U)LBaL?{S~8QmFN0DDPh2ogJB0CkHjc@9K%gSME()Xlst z+Zb*NCx%Tfsd5l7FkEY$MTcdGP#X_}pe~A`YnW`sp;&#zDwE(lv!NrC!QoJ1!^(-I zCrIdCLidx}&!U`rk*#uY2jr z%gj=4m{5456nah(gG?**&cJX6c!X`Un{d@g~~ z@WaK@Vo7P8A0y4Fn)X}gIA3^Qq>%v#%^irv88T12P)72V+;k9WGGr%z3Nw#$U%X$H>QyK#0L@=CsxZ`#)oaf3k3O zRfRz4d%cwM=Q^{&4=*M+XHbVw-4;ze@=~x52RKuB>{ij4qi01ebE2yiH}GU7Pmebj zPT_gBT!&>%E#5118ZY+YELHk_0QLVMdxQ-eKff_0+=|=4qm60zrAf79%4p@sA|YAZ z)vom#x65~`e_#bK$K5HBYq-=hF{}ZQ@NmS8iQW!_%KOaXGZ!g!Jc~DmxnFvK7$I!F zPqS5scQ5~QBd5T}6xF(!&KM^%n&`ApwEux50hHax8ZJQE8;)k9Wm1aU^k;NEG)NjW zzu5RVm^04$d~1vhl33mhnR(PE&Wsa0vT+HMnJOAtvy@u-G59LSc>#NK)v>E3^FuW{ zQ1&;q)S-1SDUaiBn-G!%-1sP}zDR+Hxyt_9pIp})O46*ly2_!qtriS}hCl6tYpi{d z`#%=oDQP_{%eWS!x=>wC9Ei~5sm;o_=yTwC&%Dv= z&{H@l*F9ARh$$oB_WIv1V{J0mDt?8`RMZ>KCB9J%iO7@ZMS~txdu&=HqYh z-`rK-?MA0jg*mNEQK67O1;=W94TJ!s!xI?k8E2*BcjPZE6nbKV^fTo0-?tLRqii%7 zwU{19fWzwVr|{057vCT`AvTKQT$x8HOfV(Zs@wy?auJ?A2?~#RC1*d-D{BCTVkedX4-((8q zQTI3xj5~tsj*!f2ICoRAeQJD5F-m@2FRF^|Plcm9EU;KyZLq7v{eSZf)+^=qX>-6S zrGCffIuLsYRBzwNbaz|h1AS#h2$$YRi=(A{%%qUr+?A*(M0h6yjxejUvm&awdtO0m z;)xzQB|mS~0i=mcXhc^cUL z6!0W>AWV%yL4yklDxs(-erWE3eNr$b*+soo7eij?PL*;Ms>6a7nm{ykbqn>@U$rI-Y}_#nf@Z6S zw`C04J!cv88>-w(Rp<(xr+@!9JaAITOQ;LPK7}bo;C^7>n4f9C!tXQzE%UohJ=R0yXs-OP7QQE@7gIOxB?|EEX2f zd4)ov>-ye}%i&PbDB^*uESC*^RflqN_$~2*o_-DLm~c~hky@pI%WXDb^?yXa%;e&` zFn=e|H2(Z>C?oyJTm_$W7PKGH zFujEXv+9lbNUMt_(F zDn7_2Y1MK@#8jtf^n8}7@t>@?@3-0&dY@W(yVab*+hM@5lZx<$PFK0_Mj&@iqA26I zJPvPbvf1_9?FWk(yE#q?71A_J&D=p(zaQe@bN;aLIUl|jMaW{Yw>@slE!%HCELJ(} zy!0LLPEI(ZqT7zPT8^)M+Wwdf1(ls@82{_@NU2~Hj8=*Fmnz{WdN!Hp&Jlk9b z3UoSa^!sVqMP3UyJN>?|`}Df>{?u81F6({W&SmVWVLEXZ(7G8++UjVw{yR5dxdT&# zHCGOO>oaS&+SoGxYoV5a)%fBUX%44#z4PaYgh4+0X#+O;8XYoL4^u%?xlYwcS{WR! zyXZ5pQy?`>!?(wB9N6LWwTSDY$_S;K=6AgYuhYsQV1J=z5?&xs-`n>(Q7x4)OI0^! zEjJQBCY>AdF!KOBgdNBENsST_pSRxN9_aP2{XUx4uu$;ce)%MD2JoP=`xYO#F&F5~mg=DB8+BTQ|9oCnv_`Eu7_MXF5MToY& z*A1Au-8$Q*{&L8qeRn@o1IZZtbhFxP8-6$q=?7&ScGW*gY$>X^c_W9sy9Vq|{HWsm z`1}1~lTod0BJQ$OqlVfCgtFdbqJfMer($U6j`s|8QNqP1@JBEH$DIQ) z!CdYRm7H`+-DgTIK}Z)Mp(xN6pqyhK2U5M!T%!J%ETH#vyS9R zK7ZlL6RcOL-7BS(Rr1)b_oxut>RK=Y&XD`o$6!iU?rDvE1ITk#?leoS#Ns)M7KHH3W__m-q*f{^+W|+VZro0rD>43{CSwlX0{pMp zMLw>$PdVGO-Jkj*hC*M{8tA8M&zo9U?k2}^LMt(Q+X{owsiZ^MPYLV0;^lql&9FS0 zoKG|g{{IW70}HYKgVQ?*{q-w|qwbNxT?K#f1DzH+c*Km5u3Pc|#ZK`@d;F(MzT?76 zUKx*8;6XNra6?{Mch_QeM1- zbWE;Y`wMxP^?VXSPQHW66KDNk_oTLyC|l>VQm?xhXfVwiHR$ZFh7*dwm_GhIdQ0l= zeB}Q1nd{Jl_%}CT2lZs<8N3f7OSb;awV)v*EnNd#+}xCxe#?EN{6E0_;nn88w;{Tz z@4hR7fvbfnCF|wi!x1h=l$XF@&g{n7>@7Dj%<)(83<0J@iM4$R1{(SEl9C!Yc;E~! z|HBOf{?7Nu`TN(av7vYY%T2k?3~!Um#X!#W1cCcvv6!AfnkDm-XE8Uz=I_zGo|^-U3cmpf7$2#NlTyp zzC9r%d^@N;A=LcXE!G)U9wr60n^w zp0B~oRa4jZf07GOj-hd9u+^*Ie0VM<7`9?XW4%?JDIJ1Gt(=^mcm!PR(l?NP z^p)-S2Mj3rP!`u|<5ku|Ao3=KpxWg8fPafX%1{%oY3NXXOLgPDNeKdZWo@hl~%nP>|%c z`(B`pwXbzLhs%*czf_Px7h|`&s`q0w4b|Iyo$-tcwC!bkRR7D-KXj%*E|(UBtwKX5 zRKOS%E1rI({cX&)<=>>`-4-6bZHAVZ^lCJ4EZM@#5F8o!8LpQlS8w%sR(9mg4NP`` z&WYNaNo9XwGRu?plMlv2)&n0Nk4WQR{fD#Fa5?{2{k_RXg@os-H`$?e0FG-Fsdd=O zea*XeRhi$65`tMNzrjF@3q!MhGs`vxq@x8g$HG zNoqC3S4J8^om}~RZ585LR!M5^a=6m2*jK_7?&05DskYMI8~uiS$3g!z3&!0tCM;vX zivgmZ=lZx`CvAyluln=>!liQl^w+IH9n6%IoAJ@haFuu?OPgTmV3^TU{2o&UGL~~I z{-!e@nq~}+EF2HAmFFx|CulAGm?;L|b7X!wP`jv2L+`N8%3Q2%0^`mkbC$by|L2ax zTZy}L{l~Mt^1YU5N~-ePhb@`J65O}}IbRNBAqv$U$748o8m9%@^c870H#9&$^Zqsz z8LYE;i*kM4&3f6>e`3iG@$6x%5gm-7%YJ%9Zp5N7vl z;?6c|s+{gjqEd2#ny1a7uhYB0h_-OA-5zUsX^$9}%a=mP5s}*hs>(!|BDFJU!rolV zCJhZ_ej#r5JOu5xdw!PPJihJ#EPFjn9w}1qpDV)N0CQ|l;3Sue_E1ziOxx_u%F@*! z?E9R^=M-^p#h+U5_=>80YiY$ zvPBFF=u@2Ss+&;isGDArFM0bBCnT~O%$9-`HqPW-{Y-x_ybFr{r$7Hlv)HJShT%jU@G`Zo&ybw?RuT^kBpuQgOwC6kjW9zJN z9)M1(frny+Ab1Op0j~kd8GduCBFm&HNiG1bJNgGWmNSmr9-Uiq4e5lP>Yt}P%)A!g z%Qtt*SVZ$JP^{H^BmitW!^*wu_MatMkL`Mo!8gW$o6~Ze(hKNiqv&>@3L}wE6y!o% zgyr&|c%7OUSc8ZK5m<3!+-kEEFnQY5qJQ7`$tuz8F%2le4x;>t=loN zuH-~C^ZnJ+TueYayJner+>D)et!A$h`RQgUc_8{Z2M@CChL*OjCaYrZd{DJVkt8)+ zt^Y&Qq!@dJYd4&dMDCr?%$e8t3tCJ;Zi^(iM9%r-rwEPvhSuDc%?@UYYyJsV6yTU% z8)o+g!R~COvfb#M>5v{H?O# z7d(nA@x<-$UBm@wB=ZhtF?6iU!sofly7EGGKB4 z`$!4_@bTTtr9C7f*a0z9GazPKCh&fjNK0`^wNR@(pAaWqnzENI9UHu*&g*fReLE8Y z$bT6e`qX9v+x6N$1q*Pwx-kLB`rLn_ak&Vi$8}}72!b)aUhK43E)sdV+y&~7K60&E z_`ep-=4oNj>46x2+=4kbMoMz8N@|&r{CtM;&>&C`gWMSGo03tl19RN`eFZNmSgm_M zaRp+PvH zt<{vPpDS$W&ZLO3C1IXUTQjkc@K@M9m#aN#-$1&&QReV!UlKdJ@gr!M@l+umAaUGt zwuk*>@-zVGfv^Lv!jIM~pf|@7_a)bv`})Wy7k>WBs1p8I>{6bxJP;%px?5@BKgLPm z2AAJ+i#6ZN)y}h+>vUfldw{KpQiOb-@3-BE{Ix5CHXL8dy-)gK5ZHj{50~R!!57sM zzGjn7Ak%nFQ-`(MwDC(nLff-P_hBJ%(m}l^>`v`>!6B5oiha3WQL+3q4&aOH5@Iy#bc!hZ?jfd|*TDU8{3j!xf9yJx*W|(M z7Vkkz{f{4jQoc{+>zQ{wzq>@(2txc)-~Csg0w29%C(o&Q3-=H8-=y+~x2qi+_bSTZ zlUPC9hGz{1jX5*jd;q8p}~ z6^I2WwLyX0edVV-R=^fECBpSekyeQJhK$S!y)K{I$Rw+-e1MWszknRB*iIcL)Mi!m zYN5QoXfau>jClm+ai#$lVA*za@v?fdmd^|*a76fDfKiVSh-U&H(w`o5u5&oT=;c>Q z$a};-KPjwaQrlGK^gg(wlg>6m(4+r5{4*A0+VE6l74*aR_HH9d zj!(PwHv+uPH9Fo%>96u%LfsWwa#fvjaUlSk>rp+%E+ze>JjYE3;B~2+cnespQTwS- z@B2COlVaO-yuL`{iKp1@KkdX3q2Kd?U)_}dakql5SaJPN7qYT3#QXWFLRMd{_R&Jv z>7!8Rv-w6L$%bf2G&szG{?8&{X0CS)3<8Ds}Z>3L=Su4JubHvGINpt!EtGlo^2A z{`hD9xKZej>fzmwJhl}DN-ox{I=ohQO=n#SdMR01N*)b70#plKjHtOYCf3Bql_6S{ zb1=bl=6#*1`~g{}$JCo>Nxv0ICu%VkP?v^%5`B!by1N!TWx7Epjh%i-a4l?=>Io&r z7NxNZv{TT@N_CMfV|VsyP$va|S0mt3*3h3OvPYFiB#T{* ze9W&Zp-@(nu1F+Z{VYRxjZh^clq5~BX6iskqx8*0xkNZiAthggs=G#8Bng&YU2xb3-z>HFX~{Y`iB>YknC2CUyhNP4>YA8F>nZMC5u7;c;;F6pp2FQp)E!rn%@IpjxpKX} z1k4pl!BXc45@!v@yWX~BO_>$8`Ahtb3Sk`(K(vH$0%}k5m}#8m{=8;CB7|DZRplMQXGE?Vb$r@7bN)U+a)gTj7c6addD85!~h=^?hc!CI`8q$7r7 zbk&L}e~m4t_yMtTLe!Rl689wOLs8mc{O{@DAnZ$B zdPppHFzxswP5g3DhW~{kDCskFu zc&w}%FGcvhr;5sU3He82W6qsQQS-)xY*NClw%a6WUD+z|Y2zd@OjO*6;2H@+>)p~U z#mfI#TVl1tHmgGt8H-Gai;81621?4X85j|P8fPsmSyUv=ch1cFHV`A%91dt zDNN>D+YLjbE!vb69nyTX^TbK`Iyh1GXedK3a{Iwf&R>*Te+ec(&Ex8w@E zDxcCrsE{+LiwTyyhtZ%F5@Ded0@x8Lg(6l2aZzFz>3=1DA$W?k+`0+9LZqrCB zqK3(=rRQ`m+;_Qq2r1ag6|0qAqzM?ND7D?kvkAJCiyO;UEjEMHh^{8ve@b07#DWB5 zmR77#rGt_fsVsnlg&7;8q@<+Kjz{3s{~rsWCM_vRMNdsnN5`k4Xqldq`b34LE&Lf| zne83`VR$SP7~NU+w167Sj!7Q54=Mt}*z~|`{mZ`0GQ*i+53i|r5iR|$$)pS#E(LWr z_e?^Sh4?Rev6Ny|(5^`|}k_a&=1qB8+ zv70pah?RIeDh>4A3`kW%(p}?}YGvd3y_ z!Mah6e@U*WWYQnyz=L^XN66~7yXXu0Lvi-R6lkmBC}T1(T{Qh>Yq)7-YB6^A925GI ze{{`8gZ8-?2l<8zbhPyJJU*>m)z#I_UDeItIYva1qH*PDojAlI>exZSgm~RlydU}u zN$Fxmg@}vJV=|D?*Q!f*kl&R`AzaS5ifs261n5ZOWcY3E?r{5Q(k#*}{Pr#^c5l!F zmW@(Zgg<*VqmNXwN6BB!7VA+Q_NG=)^=)5KnZfmIO$(7B==L@=^EQ#4k6}jsicrq#B4R@ zKJ(F7Vc9gomik4`248c%U>2&?le= zm2I+V3h*u4K9-tf}CWpuGwhMHhrMfD`dR^xyz zTDj&-styigJKvZFrnJ8>4*=}W`t&!JBj=DhnlT~qkKVzx#9-&l5>J+#Z#^QE62gq) zxmcOJh>n!&Q4T^64~+~B4`;0onXR@)%ckhM zh1(ivE?S<%mZj-2#yC^fO!SsXq3H^tcrFR03i?MhWcXb}H9vHk3av+`N+hiPL4uvV z;2RURS75u-FFv4$ksR|@5y3~wi$(6ONa{6RJ%?sfqbI|Sfz}&&Jt~0{0bt?AcE^A) zg|ndc>8q1sO3(}f3kedbu3wGk!<3zB4kXW;!!6!LNup=QHIFYT-Xmt{;xmIS;W!|; z@UCfVe#Snv_?-r#<_ftYBmNj=9>mny09$q1&w$o2Ud79lCoI=a6mW@mBR?crUVLOY z&pjQ60o5y&=UT#^G;iywUR+KxUxmvtVrZj>?D`^cw9*`6A=mo%y&}A;RGAu=v^t;c zQs_M@MXs(@iB3scQh^EGDlgoOwy~FLGt>5-Nx!}6^g`HnR49YSsx^dmV9WR zpqo<5L8n{qMn)N-!qeJQ9P|Z;)LJxL04K_6Ow`keZ2;c!>07{~tV$a0Sc4Y`xES_S z^5CKWTE@{i4@BD&@J@9)B$gz+;cQZD1Elg%A`p4t> zl*&iuB-$OL*P8lf>{7u@+JIXVYyaRQ2W7oY6V?A~GkmPh;dfvgSuj%3ot}Wb{4tB0 z56jensQ=5wnfA@Jm<0BG1M?K^bG|EKm~sUGa5K68ipgP9JvIOKrW3HyJ)0yT>b+*8 zgiO*3R#ec&8=P4gQ|z@Ua=mW&bX05sFPnxeiu0LVX`Y2j_b1R=hmpvNHvocM}oFMhd- z^vs`P1?(=gDG7N$R&o>eknqXkdTvC0h?qB<^d%~FThBm6r?$U_3B~%0z=_5Unkjms z2~0$Hg`p)PVe%f0_;Wt}Q|&dcbbBTSuywtD2__tytJWpoKi!MGHJ?*z*P#7)xr?f< z(DyE+0_$QCpY|+4(W z?{5CPx+|A-kzjX7yLgrSqdH(ral%i`R@(YY0tUJEUAcyv1Px{t={|tT(d8oPX7W+d zZtdE1g?SA=QZfoXtvBgRJqF==p6E{R(P!}ATb2}y0=S&_RUaqPYA@!lCJ-(uX8l~23lZ7FQVbXl-#GFuZ8Pw?f>y1# zc}FC5X)hLe&ngGzg_2t?VF&hZ=2gm06}#YS4c zf|XspGj7T?KBL|zWC(e6WU0Ub8C%ZJK>5@Wt;0nQc^zJ27y4M;iV!QwsG3`@({=V3@*V*JEkDmLxJq2YSQ=zk0S$Th7ZD*VRq-C?~Ly_uX z_oiPV9#`P=30Y>jdc*C;5yE?|h8pQziW7UIiZMzX95C2dYK2I%9lkiuMI4UQCD^4) z41Z5JJ2{KRh0xd99NnvlMu>Y*?BRHD;Pr|f;!vii`SCjNvWoSo%Y)JDL_*zGKH61& zn-T_2Zt~u*Bqt$z@61|j)-yAcf#SC3tc4t+ zJW*q13?>N5_My)jY>y+`eE$wA)o4o z_1&=p@#*6upl{2REWVOJw_Wi%ISr=TR?;S&n*b#xDJ7=4c6G<(&zPWF-a)Vw%2%HA z#1N$=_RTk^GxrRCCe%=^r<>VEz3=t*IznXQlvKa@2TueA;|!E;(&JF02v}PuF_%9NntdLx>^E^EuMIXG7SV?O=?RUWL`?fxxaR_}I&Xvx(eSx_71#`bAh&;kV-O$!Ze%;jTbR2}xU+`de=zy3mhfDbEcnc>}P#FEG7?+RCF(!W&igPnT+8>rHS@5I~ z@j2TVY*2(rUI^5Ba>Z`Vk(6#Tu2@RqjH0 zmTme=R(p|(h2#|bIXrDITmNp4=UW@C=Nt6O^$D3;kK)qY8x5}t=>RDiud;S|e$J-J1{!+`XlpatAfr06@nBc)s(W&BLw zh(rX69}QWfuRL?#Kb5ue*`FV+-hbl~JO!x0EkG}oVMriB6xIt&T6NjG&JpDrJf8rB z$cQuJZ*!7lai^T<`U*r`uh05=U9Xn1GAhO&e^TTKoyE#S(!_|ekcGK0cfkMl!gxlS zIv*hreX#dkM&@*($g_!aysh4b_ums&W*NrXtUbQl8)k~%(@hmkIQ(0iTdLQXYbD-1 z{_|m-9Da@Ih(Jk6_iYWAuKz%x!FxLg1x>Dh%Dt+T!D5-w{?t&m>h>I{o3nP8#nUGE zU;nb~>M=C$Lg9SlpP#CwLBqw1^bN9ayP5CN*(Uj8y{WY_-d7XoVy&)*b+1ngY^Reb z?gDT)Hhs>U34!b}|~0cmRQro)Qg9uFhByI9{L4)j3{CuiW4?_ICvp(GT)dZ3lB!Q@^ef$JOn6weEO~G>-53sueoC>#cb{CJNFwwO%08&8u(r~ z;JjXx(e|ER&WmZ>By^CKmJ$>HAtQ1iH)0i~)w1nCnbNmnhrgw8&$k zpGB)-7M#i8I=$lILm}XdWvO+Kc|!e#?|&wg{O9fIhNx+2fD8c9j)b3q3A4cU2HU^@ zFvVXtG3Y<}btd1ri4(ixEh#H5?<~f&7rG=qbE(r)<0RukKvfqKl)hM1=lK4YM1a@T z+PTNQ>-^G+O5c>Pk}QoT%*Syt(%1w67D94X))~qmvcLzu?-6<;sBA>~z6=+#cT!0X zPKzqgvCVGJi3e~0R~ri*neA*gRG<0yYFw5HG5d7{)R(LR8=c}yabsNGjHM#0{%!EU~2lVJ{HpD~@;9bNOY&5;lAgL}Vc zdxo_(X{qWn zM!T1)7b+iCi*%#IrJvK#slKHDr0#PZ4AhmrDaf5J=Mnjon1l)nuP`Z3YCo2*%bXl>o05V8yH``jNkL(YgvT>IN!&+ zl}}@xVE;hKWLjgX-QBbfo=8P{G}!>1TY@lxQ87r9_)W&Ck|fU$%q}~fDQVYB!TI`a zXCva-X&fNkY(Y9Ka;!xEEaSVm53Bbm=Gp3FsqJDT!wSd9sF1VU@`I3P@q(}%_3fO_ zh0Y2h^G40bRPW>>Abb&xJ1An7(t-w#YGKk&Qd0oInv5e*Zv z@WSDLn$tfY+E|vV?-0VGFucC%0Eg=}ghJlYxZfk|(~1<0MRSX>7)fp_s!cv}e;W88 z0v$}2*pBO%11*2CVVIksUqAEBXlc4`|42HI5r6XvLa#HB=#a|a$TxXeGZv6O_0PD2 z))N>!bRG-XDgLE2%#38Jm-n0SLV=8YZ~&$C))>IKy0zx3bq2cGuL9Mr4;ViX06WvX z-|&t#4-@{y5BZY!u5an1py z^KfdB$=+__&k2|oXcTI(&dzR|m?-XIzjj^#Afqa_A&>E*O)8X@BF8MG?j?PBsfg9* z0}=3B(P{J;3g`o3TDF!51q}11E^ha>PxK;K!*9ydtb0Z4w@?# zZx_Ebm|h}RN5Gj(O_s4GS`?|r#6(yXA?R$M1U+WZ6tRHne zD}_W)Lr3&7qcg|ZnQQ$5e$^jtTbK5*C@epZ<#3N`CE~c{+_`IpUm5C+))b}AM%ll` zgz__UFmk%hM(a^29FPU0>=JmJp8H#=RkGSCZJzu&wWE`0s&s=8c0|F&51LK_kq9zk z0SfyEs|*t97tnQ@!l2$d3CMUUgQv-M)D+uy6V#Vxji}?ks+K&*bzTj0V2ZR{Fm^b% zT;qC~I2GO53X0Nj)+(P-*HVN0|_@00{kW@*O?6m z3G<6Kymq)U{B&-{>}4`xL=nGs6ze5axau?sb^L%=O+E`np!!H?E$P{(h+pPyBH69T z77o9<0%E^Az|ap^gnCVt28sgT!Xi!bvfZ39GZ`d-rOvu9*eS^n@T*GoX-6F3;Gq$( z#zP@ZnJSmHvNaVxP?7>Is3j5*^hepO=?==78fSm14f{)&?}un?U@1avWj=eQ1Cepw z*UTX@3z=UrP@wkSIt4fw08qfp{uG(wQKH^4dYPStzbMnxG!E1cS0JkeLhublw<8Qm zUtPWN)gQLpJ=C_-E;Y*GLu&*yHxBF#ZM2)H91J^U?jlun0I{W6?I zoV;HJG&a)n64ekCIJRwJ`2Wf#FdHm2UM2#&*B+* zR+M?vv1A`B9JaUDK^S9w|E6PvZl;eLiV@G?R>29s{Wb44F0as>yW8+-U|%c=+EKQS z^wUEHqkT{!%~z={XxceVX3Tw*3&+n82{@p)U&j*ZnU+_Io$JhgmmIcuT!z`JkL4ON z?;Z<@=h%%ao?A*);W6Optf6Qextdk$eML7GZNxL5x8W#19P8nwZLDGg(1=e!;?_)L zsg19BYs4Pf(f11(8^=`HzPeY?qx6{Sp|{<3j!ET8(X{0j2q>X0Wq}utI6gO!f9L3_GBhsey<@FNve(J< zd!R9fGew#aRrgh*puhzph6~;dP$UkXdRT?055_@)A~y9Q(4*R!^65-j<)E%8UmBPZla_oF+^vYmYyg&te2W ze75_KW>qNt+CM?HfSV*o%E&-;3wlP2=+5IwQKUQeuZ+!^vB$b@a}HdDC50&jd=6uv zV}cD+Bu@B*MLswLDNNJ!_-+p;XhQ5S^xH_7=oULE8B#cDSNxyn{4P0hrg=|87Lzy- z*{N?|S&^%R4zHo2j{>lSG`F&GQo;beMZGANruLA6s9QG1(T)P3fSB`eXSUs+gZq{$ zRTG&n=kyG8ZI+`hjV<18&1l2%7>W)Vf2y-Ilj*Tr{=!gjXPj-t?G%Mu&zEFpYrh?a ztFnu&7HM(HY#K7T10{)>&;ZYnBEmA$@aUJrTmyM<*KDF7zDM2bH<#OzBJ(EAtuLUnQuk#_L$jn@p&LE@-6z z4u_A@cGh15dh@m)mlDMlVptoxRYo7VHzPmRmIRo^e_T2&FC8;SM`IqwhN;ZAi^E1|QPa>>Df1Lcm}l9-9%*A9P8ab2r;YB1#^47O3jjP+Hy~^V zZ16rhH!JQ(dZT^$s#dk*gCB4>$4}RwG8ztf(0&a;xC+^w>g|QY&y+5%uXL=Im<28!*jNc>_R4Gq&$6` z!v)oi_^^p9wV%LrF?CLq#aB`rj)S(2VXQvb4^;2PbO2KqwF-_bHRMEiYjrx4_bU{q zMV9A$nNWalo2w~jn&J7RS%TwlOpf7uBD5#k;5mK}l}!IwV;reS!Efql--7&b&a70k zyU8xQ^|~&*al8uwjutmFuhKRX^84^atm% zJHa9{q9%{H^ju$EIUttM1hgGLL$O%_3zGO?E7j^)0o4Rdl~{X46M1j|?KgYc`1xu8 zZrCm%q$$q5rNgi8r10rekE=4gki8R5$nIZ`eXO(Anv-^|wbq*x*cp^=$#updY3LiB zLim8)g+GN(o*W=r?fXFjGAiPe5pi^cIDoUZx1DXv6kBG^6%&5dNj3!W`+~wYss4i3$7O!sRy`phnV-MY z@hlxwWAxidfL8&Z1r6BuYfUeY)3tCs4a&QdpiF9&seyvw`(zC0J*piE!kD#QJ9zYe z{MCJ`!WHw<<1DdgBBN5!s8Six-l}&PNV)LoT#+8N6sHhj6k|nToDjntkNeK-wb#}eZx=v&%5o)tn#%HQ&Yxs>9p1ruB%NH8B zUz~h&CrlToMH>fSc>aq5S54|K)&GkgU?SvmZFO>r$ISED+nMZqw5&_mXld-hd!kGQ zjW{yg!*9d%7B#Hu*$G82E?%oLY*87Av=y_|*kqnxj|imX>U=V-p~U7^_NrnA8U~1&4hs7;F4~huzF8+!0Dk|~VnOJug(ycKa=S>4OFQvjXSdISNJ8n9Mi!MkP zB$D^NHPwG%`N-rqp6Wi&Ixa58Oi8v|x*uwf5%PbKwd)N1=SzPB57Rvi0H!!NB+O$0 zJY%bZ8{NjA#PNm;1}eFgh`XkYGhh8aHfUjLYWh9j5>U6$MN7jLYrZ(LDxHj?X#=6jMjD z-}v12Of53s!-P)FbCx|Pv&43M?e#h8-%L)YDe&H)wcNkT#PgGZ?Yr-sbJb#{@_Hfd zq_u4@>O2T)$V!__IlG;YL{iDO*>9;NaWiY)R;;mFX3x0&hC%_H7CJz1|>_8YG_Pb(p9uhcUiKair(0=2al5| z8RLvD8C2^mH- zqIpY}xJMW30u zPo@bJl?}LFeu$hm^nS^c8J5?iwZAIe+V`zMv*3>-?r3^h)C%3Aw{`1KN%ge0AL-s@ zMK%pa`j5rniHY|MiixZ9W zl$f%3Ok`4K{F&%#pvWqw~ zFbI;jS$#-#L){1O_6r18i}FmEQ-3{Rt!he~6=`EJxs1Xb=sgg=`yx_X?Z>Y(tnvU4$0vgfq#v@&WX0Nw@X3BKbfocf za%rNTGL5i#R_p_xIP4$e*1HR69T9o>)rp8sTpGBTSWuO^LxUL|vn5q;Dx&<4r*RkTS$2Lpsd zW*tA6my^`10VnGQqFuU2A5uumSO|}x)K@PJB6=i5t+bGr4^#bh2${n`v%YbZ{#bFOiLm1 z-ClmD2_6_gIQ4{s#;`R3EbcN2Ku=d?X7rUfczoxml!ykEiVpJ zJ{lm#%PB^VU4HF>r2SnbDs#om&D^sCep{n{iG=vK(_iRnrd*Sw`bz6BkllvF%rp%~ z0op}BJqVc^A?gIj&~uY7_U4eLLv3gXcza~>i{aqP(3z`m94^7{YS_(>cIo3qAhY*DWffr zgE-S-EiP_1JZvjCW<${XINmAQ7jSdd61NNNnWsOJblTXD^x{_R=%D@bU@cN-i~A z*)Vfs*F*^uQJUmv>?05wT_!04@1}=Xn{c?z66J!V$#j=Qbh!G%(Ly>7&MNT-62h|+ z3#bJB14VdYVS1~M3_TCuKiaLZ<4V0k{KZBDH{75;_33~wqpn9cYO0W+TRiT@Wyk|_ zvQ%64rz-6!kIyoEZe*h7OaD)g`De(6%|8M(V$tO#0opEqnd}TmLIW^FAoa6hVk&R> zB@5UGQ-x`>kll(Z)HT<;Khw;~nA*x(Fd?-4n;B>6B|v1h9oTVi4j{+y?6WjlSI6i%71e+FG*jQ`F`a;49b16)^s;5Oe&7VfyrFKk#q_DV^ zi_G1hEtO%#L*b}CFpoS$O$T>MUFu$OEit7B$Q$$4hGaOR5i59E``f}W+`h0 zhB`&rLOw!%!eqso$Y`NN#KCdiz(wosx9KWB2oh$|5Of3xLuUEe#QZg0rT!E0*3(3N zNckY>NWBXSwQDhz#+%3Q6WE0u#pGJ23V+!seaFrvj2D*bG~zyUwO!_1vQP4+&J0%Z zi8PwYCz3uI!%ia!O07Vt-3K)9%vbu~y%o@gi{PQX9`wq5RdJ(#5a(VUnN>}EWY#`T z{3aQ<8}aYp1dm05SNm})I80mZ)R?sDJh5#|p5m~8ug?LZSz#({!TrF;Spc&Urv5IW z!+K#MQkT_Yhi%#3IufZzdtVQ_#`yT_ozJ&n2hW32(E62C;Nrk5eXG#(+;4&IfVs_8x1Kg0_w33H)@L%9JF$NPlNmP+jk%3R>6moV=pi zZ#rE$4(wF{(E{{*g!4%rIR0W&oO$Y2jRRa#{D?0u+l)V=OczCfk0>S?OWb@fXi3~x zLzI>MfEkQwV){S7^TOmZiT81H>AU(2?oq*x9#Ks^n{0r_Wx71MLp8 z^T~*=)Mo)WSg3bAuFzp(;`}hAXiQdzD5H~hD1t9?CdiISQ7~_$e&Q;vtA+YMkA@#M z{7B6leM@Zk_`>5$v)DK0|5?n^R-l-@cK;<0Y}9!D_Z%m~s(AC|%2ECyaH;6ZtZtSK zk<=92N^NVrnM#^@++}Igw(JWR~XIJXZ77QXVWk~d(XMhxH0YQWN$T3<^=DY z(I9jhztREXD;l|3XzC$OkY&7UaWM7eq0|9Cr?~UfHMhV1z<{020T#L=z0)1YEaO_2 z+VhXvf`EhQKp1YHv7T;`YJd~6Q$##U$If)zM1QKS^^35>gpBYXFJ;nTh6!8>R+p}l z@$|*)KAhGyR>!xh)hwIOS)b3!KI;{5lOj=|GMv#E$XF=PLcxLWQ)`iPAcT!mItO+s z6^mU01nEyC?u%8@f3&;Oj&Sc|)n<}ez$JXdUjC&~Wl1S=UNt54Jyg3svaT%9_IIw- zYkm&e4fZfQ_j;2uBjW23wA7?~d;b^o=iJBf3~zoiIq|jLcJbzdQLpCQ!ZDGr*yHi{ zxOXDUGmLCZWxz!>lq%m#(%pJ(8w<>@!+nW^cd|Y&#Nq0(>PbJgCv@`Z(S~Xwju3!2 z-)lZIMjzudxbHAh&%GGDY=2MsO0j@A_Vc(isOKpSvD?{^|HEUBPZqbk-@voe+rbUhrXlvnF)coQ0TgD+U0} zqrPgFYbP~z>K8AD^@qTdD^@$KQNsj7Zp8mXwhFYvpDVUas0gf+K<(rfTA`5aja2^W zyqne%U}g010SPo)Y0)D*G?JZ@enzH;zwEy3VH@0R=i@t2^COW@O+@SRSb0l||BPMr ze1Cqhf3Uw7DmoZM1|!5{_jtQ1MXy!ox7gFyTbe9FUSKVSfHym?CL#A(kUoG#Q(4f< zib}N6V3^U%A(@AG$m)ug;}GEY;}tU5(o8RX9BbM!nO8Y{JPQ03uyZ)Mtsdz@GYRqI zVPwiTVlBa$pV^}ZQyq5($i7Ze!|Yii;gAK7bhMr3z;YkWS(d9Sq`3|K z06dJ}d%>Ae%WDK^BY;eRUj6|bYAI=l4mSCJliBkln= zziC}XWB*o_l*{>*qCaC)lm)8=moI)@-6MNJ@#?P^DuQ71ez@z)|C7OCG#8LRZ+eias!pcMeyc4se6VYJxEZTl|s-s(?O$4l(k(6LIHYuUjzvoR+#ILg!@|0A$B zKkj<_`>6B39Me%lGnwu?$I0u9{vZDu1Z;&5$i`%jHqk%^qltzXy-h1b$Ao*H{fUFy zI$y-fp{6GPRE^n0AVbf=dM}2Ait{-B5-$)YUa#x^4cuA!swTqH{g*+5h|)4SZ1R3?eg6{Z8$a z;F(DIPLKYHVr48KyhghBuS>;EY@GRLqOxjk`*n>y&C_z4wDJk;MnxrM>NE z4prIFQLYOfX8VEkrtcr!TaEaQ;9H0X#%q$t>yNQw`$%QMT%Ch~1R| zq`Ue-2?dy|O0s*iiPy3K=c3Qj!IK;727B_s_a`D}w>f^BmL21C)cjsE_b#*L-=RQY z3r$^S^4I-4D>`6UQ2+d~3907+o>t;VP7#l4ar9Mm81APiFx>itd-@TeuJXoo@^~zU z0bU^HZzgD7oT3plQ!2EYz^P?oU#VQ}y)OVYJ?-|lO9mu{R6)DPyN*`Br`hDh{{HuM z#x$=nOp_MjC#7rSWi~Q6hyCd+q6O`L3?Ll!`o& z_w1cOo6mn>RT>OdT~c|UTQ!i`LKU*0iozj&!iU45duL|bh+|i*ykHY*7sqr=52mF~ zby+$2~h#L3#338lLOUG3N6!P@tV+L|O_;7wh?Yo$?|*ZT8NaJ&7+ofQ#j_ z=^n;I5&7Uj4#P^8Gku5E-XDexH!x6L{K;USent-(rQ?^S;;6)xcZU$GQf{1dvQn0 zQq2fBA0Np#O-ek7HjU=qt=fHqE+D&eYd$qgkLq0lQQ_zEA{nxi#^|!a+&fjvAc$bU z-&z#15}(V%{TWJ1asMv;a`;bB=)76rJd7?bp$_{ekb&E|S*CHoTZ@Jm@wIExZo&OH ze$!XMD{x%{z&=^gb|o~4((*cEXRG7WWQH%nd~mJ<{w!>sO)jd3vR7+_R+)dreK!#F zzka+5`lJ869+UIYJYtE1Xi+CwDJ9RVss;&w+h;9ve;oafiO##6Eo3dN@Pp);jg_c_ zf1wdW*`UVF&GN3mfaCiDb@_k7RBLB}Yty}`8O#+e7M35ME5JW>x1QZ@Giag-C8$9O zJ^&XvH6_T3y+8;u#CKkTQa@^n)fFfbzO3&$k$8Gq0fsQxH1W1oWi--9^UdmPy_2z+ zA4;FDH3c#BCvmyx%QaSt1YkqPeawb>2>O^M?~i#u&Xspw?scF0_9waC%^Q#*ZwCcT zR6g$z>D*pbJP0z-Fu{U)^ceN|pQ6F{nH^7i4+gK-89)7c=^`oHYvJfin_UC}b{t=S z$5OYuqf?f}pGft$q2oCp*ZA&`;EfC3;8K54I9j`)qnZshyJgSzsjkLb8%MLVBDy0# zj_2;_rcqqnxT>3|*m}_^8PDXuK|MaKY=)J3=Z6hNtmHo*Hj_j4 z0z7^$PNIu=ho*-6%sZw-3$%=0bW#9jHA_zjzeBOQLMPp3gXfR8abTxBfBs9XK zH&;#y>RFKpVd0dY)wdxnu+->M5Y^R{ytCT;oAER<8>2hjS?PS*Cj7II1%MF#A0-|C zA0=JMN#sbf`g56K0tTNOUYj#vK(&egeedJ~Sd%JXPvcPx4j~^;;{uZWEEYonHp0W~ zb#I6Nnq)u#|1U-e;J8PgJKr zo4!Hf9D#;`Akc7_&u02C9Ss!?OffcX#r3Z}@_|{`{m-!NKvEFrB0WBgyC zz-+wGP6+$|gQa+Y-RX238uEX%wDVr!LMq#LyDKL#F-Zqb@YQbztWP0+gF{ZHq?=^1 zyE-4|*zs(xypi%qQOC8$3ORkDo7eybf6cHUaCyG3XZ;#^To4XAu(r6mYYYZ+Oy zxn^ttb8MV?(?a%Xrf+Br`$z>8aA$1+z}Jkz4WmjdTUon>ApBno0H5nd403gRqVi+* zSZb%2W^Y4_Q_)`jg}ASfsFP;L^eNd@Ru&3gMbcLZ)ZT}4=t-9P&u@sDiC?GwU@9&) z;JC2(?qZ?FzbRVP!2czD5nI-0-$hkacP;W^0|uzW@=NvKuTX>S%7O%R9=;m3fsv>U zF#N63DkaRpTvFS|<`lfK*?b^0W&88A*Ay=H!udx>Hax*g1%{0Q;FI+mGBz|F56vj?Cvw%rANUcs!{h25^2>I64#RjTLU9 zL4pc`gZ)xmA^+ovG3mT79vhZm8`&puG44}fQojFygwKC7?mkzN`gG+C@5Xi}kU0A? zgF+J?ZaH7pKQ#DWBjo+i(+9q?h5^Qc))KOIBBVlqg0bhz53ev`l(6j>3z0E$1Y#o` zYd9UPzDA0ZL;vF7Nx!8fkEu!!u^^}03^J7YFCvb+1*6T^>(z9F#_J#9=`2%$QWtiM z?AGfGgo;esq$5t8EH^r0{9F{_-4T30f1&v%;}D?&o}Vm&e-$GjKoFBKYB1Ja%AsFb zvk+6$(0l^n^a*b2Q`v{m^Y6FiCF|ufNLAJ2}mRmSeZhAf}3%28?4mJdD|@x zz;JkQXvJm$d_4^i7qmN1<*z1e?>y_xU;&(G%RMk zo}0I%Tiv^s9Vs;#xyKv{B70PNzo*esO9%mjFy{z<6!E-TJAz+Xur@x3znxDIKW}e4 z-6)`DT+bbedVll3+bM$8PyKk#f7o!j!>m;?wH2>eBRfSe-^ygj$@P;xn6FZ=Qy6Cl zmRv8Vz^n7K>j^X*-kc2Vvg#K&b(K6uygHhS5LZU?T}y1GlM_=0cID7 z4p0hOIRXdBNi6I(!{pIqe}tHtTe(BMjah6*+D~~!-CLX|Pxuj^)t~PK(cuvq8@;{*)-gA=jyu)IH~E{pZ2AxvsBNV*C)CLzx73v zP(1mi#%}<->-B%QbT(Spl+yd9{fIt9d!bYkCvsa!H7}cW;T;1V4*cmlFJTWq3OJ{; z(4qsHsv#`7u~W}AEGz&Tr+nuR%n>AtVB$T8x?v4g(yKvrgb^8GcQf#+@B&_|f%X$a zHy;}ta43G$KFZ7p1L|S*9#1hSuC6hRV-L|s&a>Q^ESa~3ha8!`QJQ&%slSQLJZ&UE z<4x@;!FO;*;oaJ7x(&St<-AoZPy8Ye`R^b!$`jKxTK2KiDD=Gc;PIz!LAP43zBQ}H z!si!_Y1^m-1qGl)!6VIFR#rp~C9Diz_n3AQE*&5aG8A4?ZU|QRRjL7Pv!uuj)On}J zigAi*+lWK`V0QvJXnFDo`}pY6dl%JVZZS|qazF-7kh&jU7Y2yy?eQSZJB?trkftQ? z08C@zR(K-!;Vq;R?yzu8YSJ=aRKCkgLq?};t;jM-{s&jP4Cl4=sV>D!VQJh3S#PGa zt1&PTmMMv9WK2v%!B37xY~_OtB#CR8jzCKS`l1>N3jiX&s^m@3wJPwNJ|KWBZG%|t z!fW__mlcS0KB(?wp?i<~%gPuCV(Js+CGSHxU`|%iI$rA_=4~0Me%UethRamTMJj(K zo%oUWb8E@jXh-yOW9#fqj@^6P{yUh}QVSfC6jHp*XfnT}b*5ZT_oZ(dnOaTtkKJ{~yY1mCyZ*ZDd%Ev@% zLv){qnd^QD`g&tTVr@j>)I6=N7aeP4PrwYfP6@+@I|{D5wUTiV#%;*?->0dGGol*3KaF|4jn5HAnFq(OPJCaZcgp^e@^z&s3vF@zxS1(Ql zkN;;+1$}-AmL}q$g6V00$0D}r!UDQU{5V>O*C0CQ`7;K<%P}canJG6>1OeboU5Nrq zwTu7G)?Oj!9F5w#U7hH~;k(n87s1GUKL4NWD>KSiqF2G}?FYfrj!)$uts zDidpW(@LY*PQVo_IDK9QEN9Wm0Q19J;jf)hqSXGtRShW9m*`z#DRoGB#{KVLX9}k5 z*2RUKWjfyAR3T_8cc;Z7QdZk^Ua?%m47`U1_xxv;Z@+Lr0dCJ0ly?Y9w52^j^*mu5 z=ZJ~pMW5ssjb0|5D18usKc-Q%L$8}H5FtE;Zd6?apHE}v@%`6ZE&RcqcQ-Nw{|_u3 z3_izOaqpe#1TJ&-%BdqFGdSMuHfCLCR1W+ek3g_Rj{jWn8%9;Jw9><$pdHJ>G&`l@ z37m!&aI>#_zURi9KZpPy!C*iG<((#{PMxTy9icYeUxt;V;f!AHjk=4@n6{Zg@Jsbw zCbj;3l*{!J)kef*!Ts`100<1g-~hHkdH!sNUZH|dt&g6*W#Zo=p3bp~xX4#i)Tb;vW z^K_5RxE){$9Q;R%mR%nY%j8$fD5)4cO+|OKk3bM4CYlclvyw>Apq89JZnTnV2?QiP z_Ho7q1&Y4pr8rc7Xk0s7Mwqz*zg^XS{Cdg(Kmoda`vhv-`&Sm7X&-B5*bU2f(}8R4 zvm@c*3)jU@M3tJ&+p<)h`H(5!U_Y|M_$O4cOOu`W)FnXoUq>yK_{iAu_laQZD%ZSG z_ij%eNWx?lv#K}7E|`4XW}4k|(pevR+D7|~0L}Y#RFh&MrnvG&I~jQ^iƚcTPr z78i5%L-7_g?A@7H0?OlWtsK(01=sa@fnogptn4jM5W3o-oD3+TeL<8$Eq3p0{|_%+ zj@WH~e6Lkpd=tNM`7vEDBco!e^#o?;7qf*y!aY@O4|iSu=?1lDxs3eNt{6ku%on!YUS+q@(6)GT*we?CtWYy7cOazCS;PqAP5joel17V4zZ>FgB<%cO-s$wnB%_={m||2Ul>bYv zPlv_BFOzUIo=jr|%wU8fJl1ZV6ge!%j<>X}C_@5m)XChcWU(&x2ISo(Zvvhaubb&4{fKegrBNzs`t|GeM-2hZ$E^zccXfYyz&tk!rwraTzeWosues*cI9Lx{E_e^9 z&4YeC20x!u&B@Qz@BCj9Y24?3BvL!BO7(J;xYy@^zt#(fS-&%@{_*lUtaCYH%i@6g zHA}b6R>|QFt}@A^HFlM0bS(RgdaujST4tC_r$VR}Tl=t$ZLmYw9sQ9-@{wDnAbYrK z>+0?+1i>l7ws(Fum-&fZwyXTYJygwKr2z-Byg$2;#E)=JV7GFPk za#NS`@td}~kA3ADzJyFdlyozJ+;8Yvtmi@IifOW z9}drxbxpIEM`Eg(nWF-A`(4?OL|7E-?hz?)vr?p4KoCFeeL|)3>-seA%K1Y=D z>#;?d*@E4ihuRac$3w+dfH?WcaKTDcm~j?IlC33$>7LhV5mpYU@nRq{T=1egqzlYCo+$X5xMlC$&b(yPcAJ!{`ZzY%;uwt-fepmP*b z>(n9?V4e$CVVQuWOo;5#f-xIUhm`B27ndyjf_DD%Z9hL+$`RvFWOBs-4Z7i=Sa1c@ z@u7q*bqb~!kT?pyKcX011X%)rEf-WxEq%}f)?paT#H&J{G!Av0Fsp7Cn*1}UOEt+L z!PBL=L;f6wjUd3hoWy>N>xTvZ0&ym={3lH5YH@1NpP%KzKb;VW4sgzX3KWSDn>l7i zt8(zBAbf94Z=A5PA{%l6B+T4@6vjVGkHL>?+K)$-pEX(RT~%oEoSWdEj2#AVq{NB z882DL7n>6fGe9+I?VIC+uXi{<6nN?hsj84_jW0f z_Y_Ap;aP=>8Q)SE(O4fjVm5vc^PBywWX2~@5z;rLS`thS$ExIU6+J$_fP@rCgud!3 zQm}Z!mr_`wAd-oeEQ7L|I?F}p?>)v83J)Ce_+|5|i^H(%Z$lvlcyu%NQE92$xfe%z z$GjvFg^c9}sIZUFKGn~ed<#i>I~@*PMwfiXx1L8f9b2vZU3y0KnRmISKSqCqQFk|} zoo9?|05FI$G9p3;ee0+=%OF6eL57kZoEbJCP|L2l!g${>FpT`pJMQNV!|OONw^P?K z+P-iZElZiua>6HPCr9iiu;dYa^uaOfaGo$&9D5?|xn`!4);9JG1UKln(F9gpW0S`tueR<2g&W=u64n^Sta}>a%S(b; z;B{L625Nw>c@mU!N$g0*Z`wB@W^HN6A!i@aS1UA)K+X?P*@U1Ft?P@07*^*><|9M* zl)#4AA-N!vu1}!^XTYhu7$gNqE6M!b(W7W#aJ-i}#D`Nsg|3nd$7|DxSB@?j*;)DH zT{O&&_fI6zD&kasIWt%;ExSYPr5d4YxyHo~^Us(knqNLyyH z%uMO$jUXC%E&%|5+w3v{01_c!%p(9HXrdtaAR^2_Fe-S8mOtDL9K|7e@GJC)z4p^# zfDI&YM>zeLw_KEz{584KJ)FFuZ6ghccA?UY944RHziV`72=GAqTQ##yRk+2__2$FZtzLN?=Y1`l;Q9y= zek^A|9h{lFE6|MIn=fQ5Y35Xcv@ttrQ%Qfb#xQ z<>sv9Bxz`bCnC+4g;diaCg|YkGX+#6noxM^+%Lv=exbkj=l1KSc)6A7Td@a(bwob6 z`sMW)3L^gJ)`R^eu!cd%62vA%OjXW1RcGU(*oO0Ly#rJ6l?Lf_%BRWB6qUdG^+(LH zS!F{Y#>(W~hm!}GfpTwKY;Pz`OMgnp4$!JT=uMpUWskhuZA6uo zLxF&mvmsc592)8=B5Bpx@-QZY!eb~`gOQ7Lo!QT}bhcpGbuUKGCvjEeIBqf~vniK> z{eVgeM_$R*@Yzvvu7k21Nw_uTKCUaLQZZbSf%Eq;C5%zJ161B2UXm>s=pe96z=1(V zD;@+kavv~MuAk^Ad>EXir+p&fIrUKmA89B?{ci3V%pn_BzL!7^D}oqo)l_3>GOg2! z;=cMD#CPpAuT62(_uaj2RC5$;7-c%;gN_PE($7kAB%3Y^Kl5$Y&@SQ(-PRuo$Wp4$ zwT-P0c;QJPZZ}h-EcB}4K!GhG3QmY2HnuU7yujFiHe411B!?AxK=siu0Bd;PvyqCu z9`Q?=q{3_pjmsOBXvjYeF}a`c-3_@)MIc5GcIZa_}Qf0!%E`2(>^kZ0J60kRdHu1DaVshaNKi zQOuc*ve3(k5-0870(9tA(dx0u(kH%j8K?nlSnaCI;-%L8caBn0Z~1pC@qkNWR+=!M zeHFwIY~R$@9aiR{kUwe8%EWNm?0WETk?h19P~0Wmb(R@Rv#N-Z>#wVcRaEK9DBM{X z{$;rSeG%WIb@#-Pp2rXV7RPx6@KI=tq5VcN$I=ELQa=MA_bLOmubYV|k(FxEgbWj) z*(8GDN34$_g`%quo1&4=oWvy)Gq6(wElJS9(E#Z{Vj*Hcog4G-@N`n@8Be#LVdH(c z_&kEi8FU-N+@U=e0lij|ejk;8c4;+*30>aGGipzBOS{9AgSAN@qPh-(iyKL`1SDl0 zZOrX7pl81Aj11CVj(unS8_3m1;#{6a?{Fm%sT^pkN=t67ihjon{LI@tt-w04^;D4# z!z(*FH>!hp^4Hu1;$55@GJu)J>#X%aNH-sAa43&P_V5Le{G_{F-5cna04!DayQyXX z02G?MPs}WJ!VDAjHmW873AsPemR^23@kx0R*~Ae&OY}>kUry8p_P|7wDs~j~R&n+t zkQdJ7jXjU5gSYg>7%)20C`Z36D!<%v?JCsuRx z0Zqgu^t@Icl=>7(wnmm>@EbFy`TB$er2u`DpDV%s^SISm&Pfkl@_ehYQMVm6t4RTD zSC(eBT>5+!1~rk1e2k$bnghCr2uXg*#|V}jr|y1CpR{~|*m$s_2FWBGokw(-3Z3|n zz>0FH0Blw*n&-Toa`u~$IBlO>4Hz?ehPnYb^K!j*1D4@g4RlbJ;hvS6<+?H^r?Nfa zcmf*zS6D=O>)TFbdc8Q~5Qusj#58l~#0(A31#d_aUIz z%`}HHq78kp+xwy(X{0NV+mp~OW)l@(DH%?YD#I?$USkwo)CL+fEJx~Kf1vIKWoS-E z`OdJsyx}7zhw^6#X;qiOY>{aBG=rsf8%jH-e&wpFGvmQ6e4`Gg;>M=x5 zdvs-OvO67cM`RGRlt`(ZZ|8d2y zY2bxh_D-Al$v!O71yuOW$-l@A`)(D z`fluOu1J`(M0|xi?4=+AiCBQxm5dnxXKb@gChiRK7tOevtpv|#`ZRXBgTt#zD|**d z;O2O8>DFJvVW%Y659oodXj>I40A4qLq`ONF;5ce%C-*ZDGq{b_eR4i_Hu+Afojt09 z?2~r41Y_~0K|IZ)O|0O1OVP`TNk)TFb=2XGo-Hyskj8~MUupIB1rWz&@YB%}r_O5k ztL|y@<_G%v-qCs2NdU5pMSj>lW_%10oaXTyL0Fzas*w-PN{(*5;b4dWG8AoIURYQG zl>wL-x{?qz7$i6(c+tj2_BLT7E3fU-rTp)!uIVc;0W7Dh^NDm;R&#~S1_jIVpVJ)j z8gd=kfGpSX{z^{!r>X>y{IRIm#`mOmEgk1*`(wW$m%}se-z>C9SbOm>QlCF@2}&Co zCEzs!PsN%Paa9%skB}5g!od}ph%~UU7E@sJ@#X9F(ZDdL$wAhbZgpkmIt-OU`9Otf za6++1r{V3O&wO!e0nwhi`Gdtd1d(!1>FZukZ|c?Xp%S3k#Dj z(sy?#nOmE|$*k7jVq0rX4{N`f(F3MNm3dFISuvT!m#VQUI477Ng&sWCUG?}L3guC2*=&&vb$H!bSJ!X5~4d%<*P>DH1E zJy{2ptrGXl3IyK;JKfBNzUx=*;?CyfgTrdGCvLqnX&OE*fQyI{aUf@g6NlgURNVef z7PLKQz2S%t%c6*0n)GC5+_t#%WRq126Pu>HrA7I|g69xSt)~-6i5T1_N=z6l#_i(3 zv#8`9D~y2dcfc0rtPYZ7ej_+|hle032p(|Lo4vrp_>MukLMYqxPZc;(Z;1I?>u9{C)ab`I08Dn9J6)vi7{+uC0d+%Wev#F~!j<@t&`XPIK>IHL*7w4R5C$6a3E zduYF-IU-Z}c z8p*b|pY{NuCc4P2{D7bSttF4;t*~5nQB=ZEX(Xop1{z8{o+2qf_zO`1Ra>3aBH?kL zkY^(eQMq~)to#=NvZ3HTAI?}Gxf!zfvR$8?hKMZk-^H z6__xp6}uYTV>X!fnF;t63Pjx0qa`VHxBlo1?+*;%mAdLrI zCauk3^sk_Hg|oDg$n&c*madawEhr@oMTFyOz!kMSdMxGL)tie*yo-2=~KzFz=2KG&b9S@a&>c z*z_S%oFHhva8IfI`7&QyJX@Cb*?(Bw#kD?am+j}F2uPJ!VLIbh9-?g=!R3`r=-o+3=H1)*%w%v9;iG!(m9%jArbDF^L?H?er)lIH#>u{9B{2!iA-2#GGifYA1G{)aXQOZ)0tM4g%2g#0 zu$|OHq1h`jBxU^8y3dLS^`}0Znvu_4@}xI2{=i?Y)0T>N;r@`7k@fp@emaxYn9_c% z4!fAtscqZeU@(&T*QfFP^a1*JM|Ud|pMZ)`y)x-h=Td*#yH!q(bHozdJsNL@uVZPK z(AW3v>?#-rgbuz9l%Ba59yJNVTZG4EVd2kr<=aF{U=nVf(=Fc)Z}}*8zI2P+w}Ksk z#_|lBHy5A%l1Ou?C%k||f~AoO&5tYdhQ3-8x7VUapJ) zK*XC;RFpqiD-mDjp#SB{XFRbP8xbud2lRVA?>}-I0rM{$Rs;yW9m=n9+RuTip7^U% z(CV!#<_DfjEp>0M`iuZJNG#qNu=Cu&i=y;T$cT%Wn3)?E6;)PNmNY&rT1W=$ysTgR z_!bF83ENO9c8XCk{e3x~6jX~J&fC7^XYUx5hqap3s!3Yqs31R4ts;Krc?OCbLL^YQ zm`N@{?iZ-U$W4`E6`u5%D?m;E#Zd)kWiwI%6)&0oUrXVO8`95i1 zc$0U_>tzIlgT}VL!E%0<&vUQ6GWLjo=%ek{zsQDCj|d7dvoA29BLl;%C;qyIeTI?36DK?)bkm@qm;zdnXtn3&LfxZjMnS_b$BN`9j$CVR5j zY?3@HF>kiwyLsU@8ojK}WbnK`1bx0S<+ncy?l^EHcU!#``r1$~_a zb-oqSX1oO#*F#*on~Stm=|8Rc9)b5DFiu8u4dtdXD`+p)dcB2pLj{X3cQL_C^kn;x zcyw8bEv(R!{Mc0rD$Z7(D#idB1eih)`3OeoC{EJ1&Px{Um?*t-Qhj;4fD%!oSxntvg=*Fz(Nv(aH5? zHe7QaR>*?%r+7GJ_;vbOW2^m>`?=42TWds?&;4wGhrOcu{UlZPD!s+{%2y0~t#UZ) z&HnFxpB^Edew#tCwe2R8)kqt@)8het_w!WfU+q6AfL9kQ&a3=#2rrj5H_b1sEuDSQ z?o7D>lfRE%TuL%fdW{cP2+-{t;+&o+shcQ?sA%(ZwB#klIiM68$9IpSG_hH?4KdD3 zLvSsRCho3(yhxkfUk<*x((X2!UCU&g59ttqnYJIQ0L`a$H*T2%IoQcAq2=0XDaDJK zPU%cpid-rh=$=D_hUL$<(SJv7XF2mu2O;vEGxy(XEYwO5U$?)oKWa-`&L^7b&gQz0 zx_M0dg7SR?wO>BwuKbKzVgGA3-7I{6W!5jx10C+5SFQEEj6ew_zxJCnU+&Cu=CAa8 ztJhiPRCw9!Hx3)VE25_WgzjElm%ATVuASQ-M=a}|`Y|D(kK}Pu&f+43S*X=kjBz-y)5u6{g_j=Hk0WvOUfmdUDe(#?9^T4 z`dFI<6`kYP>~GvRIUB)W0$&`>(^nkS<7~`kK;@+odyBOcc5yppa8JpJt?-oshxq6*@tVM zB}e*Vm)@I_46nhzRi`h<$^wJ!vL4**2%HOyVCuuTSK$ZneOs<=P-x-vA%Wy^O5pX! zl(R2_Nn#?>$O<7!sBdK86o8-}Ek}$WO$Y`MYyJbuTle{m$1(t^T14(iT$8IUKZlbH zLblzRYhe@=E|ysX#1liJ-F-LYI%%o`EQ6U$6GnSbt@^zG)2I}D)pkeBQ{G$y zT(5k;QjP`!blk5_*#EV}q{{2PPr7HN$dpt2OrHV)g;(At!&@Iok4W8`FVEkvzW{b+$>eNL@x!&(P*Ij1`;s|80e>fw)drqjF&~(c>(YD zoGtt*ATna_rL9iR?0%Cmr2@n2Ar${7^AwbPUv}^!FpOQvy$`sRo(osuC znqxgppdWDpeTK+>df-fEvFteU`O$rWtmR6HNpOwoJEUY(`erWi0S4zysV(PQ5C-cl z{AZ2Hte8Gv0Ib~kU~@$Uxz?8hPpqw%{SSK|DRvTo_w{6Kqre+9;I+wG8q)E+R|>j( zu}!P+6Mvn6kxma(;Dlc}>J7)q7qx<~JH?{&2?;-$rv%X6a@UJJ3+*{=y>9jxEpM2Q z+&mr5<2Vpb$D)XRnU}2#Ceiu~v>0^eXG>zR@|TJZ&8PBL$k1=n5%faeyOZDx#O|VO2 zKzYU6pBXFVRz)YP2J+t#X zv@4jw;2MI_6w+Vq&Akepg5s7}0>;`)_KtIz>1Y4?PG6*SZJ)O0YF^C}cMnH$$s$8> zfQXDNX>f3G@vMcTva+Q#bNHIT8&(i0Bs!-#DW9HZlh3q1@wc0|?_5$Ro zH`8?5pDtI$C&f7&TlCiY$#82_y&b%wK;W7$FIjFp4>LGMul8!OtJ+MTxyxNHwYSyR z+WB5SC@xj)<)96pG{J%aZB`F8ts+vR-RCE%7 z(QFZOv6U9OQ_=F07QXMt>>bD0tiMN;N7OP&QOC5gtwqv_;>P!MmQF5S*(=D&gOKof zyDg6h>US}|xBT>*^^86@RO=I3r(BKe9)mkms#}@!hkvYz5nQMXHyufrqlru9*J5MiODBP=TPdi_J{w5g z_hNoBHHKPXzWGzELSFRNc#>9ug$V&kh^6B4oF@@7r(GD(L}m`%N~*g&<*TzrCM(jh z9?tF7_a9XZsP$u3e&1c;p>~yQq>appfHoLivBalgSr)-p1xSlp8bceTZjk zvwJy??T3>>e|BC>Z@V4Zt+anc68h3`X&sx1NWoJAgv<_Pa;MWMP!qMN@d2o4MX8Bo zloSz*vox|K@%DbN;)n-Cj^9zlAk*yOP&-t&0*(91?Wed+cdBOw1R;AoMU{(+$Z(tM z>zK50qa_Oa) zd>9c=wV#EsW@NQk?WGKF7lfk2#{U4$^)>+d4QbIu#v>#O-Pqvb%jS}YzZH{@79^ko zfLg?*^pGkEY>xndKPl8O7!fzK@KxO&<+s7qG+r*zl(bUc$$YTN4R(!7aq4SxLl`Nht*J;-X`wysEkpp z_EIeb^r9V}QZr~q84kgF0O)zW;2q|FS?eu?0<646VP0)H>K>VuZnEvaOK!XV=#L6F z26c1Wtmgj?b>AlBA6tUK1D@i7f}Ld%@8+t#fokGfa-=H8uy~ovB6TN-Kag8ExzFuZ zf?*sEc6?#~&CIb2UT(PWptC7k?h#adr7IcPFQn__8b`D3G`puCz2rRi$dc!O^karvV5Tag3=YyDBhPts}fJj4*I5 z|4ZR#N8>cYms2H&W+E!{r8~(x(t`ayTwL**vXLbH!WFU8@8~JcAI^C#8I*_DhB8s2 z9>~9e#NU`rP(*BqruYM7I;ghm5wN^Fsus}GnRcxNCgYG+VpPG~`Sbltv3xiEopW1% zsadHQ;aD#13IcZ>5{7jk;&sZWr8FLm)f;1f&AS zNssLlQ^>lifuf@Qrlz2zqM6Y|aSky!S!qjZsrW4xgixVB|0oSj@*Q+|@@s;WFk=$Sk$|BMDWZdM&{Ooo8Q+(Z1UbyOMEuO=b<( z&@CI~`T3Z|m3&i#g>=OjXI%!{iJCwA%k(lgXW{amSWExxcA-qEAY_N<)O&Bu5Yjq8 z$%`MS%Z~=ikY4q@7t4QsZ*=_&E;QfH4z-H{=*youOf8NSvDSF#UK~N-gwB_C%0zcy zfHWV$+dR`#4zaTdBFcyP0wUL;AosKcb(Y_^>)4~Jq`72cewb_yIM!$~F7Jcz8 z4QNEs#_7cQPRT&09T)nTlp;OP&%Vk@srlW*9qnS?$BXTH`!7lTTHo_%_uTH6_U{t9 zZ1)?DttxcX(Ey>vD4EY6^Ha1m)Y1xaN!G&y4y~${X2r9|8TuSBOzeT_V*;v0a*eGd zFd{SbA{i9md>E`eH}K}r5$YKUlP~Knj{SQ0PA%sfA14{jfC?lsYivlORjtJoxxclp zh0uaFTRa}8g`qJRK_Z5{xa2Je3O|E4>!gz5dH!+N*+#8dpzY)8ZT~APmtrvb78wa< zVkZXaPm??c$g69GoY*;gY@-g#!*>u>1xso!m*ROy1S2Uf21t*>64w<5dHPa=!qJsf zw5{-r2(K}Y9d9dLCqdKBBm~_2$i17 zaOy?@-q{8+e$?8V`cBwqY-!MLg54q_<4zGI3h1e=MLYgIZ@mn_PhyG-pbrd1gulUP z9}mg#ZvlQFV&)4nLt=x&qrjt#zZmHd8wE>K$%()sEBGs6iyGF6xWHg>c`2T>&<$gX z`JaU#K>BlH`e9PjKU{zklqKtRv8O4ShyZ;#fuVq%b2rH|O4@1}wKSRnHRvGXTlo)qRk@9JYev95AFHGso{QUZ za;?C_xge$0J?i}Mf|EI0=T_Z!!L&c0>U>ORa^4?Msq-~!j+1W7u!guOK!1b*OcLu; z%1W!`6HdK{(}lCdMAU)qGk0}Kz)Gj8_Ne`QS#L(VVvF6vPU52V^xuQ-LP|vnGO{4F zKJ^i!XCTpbtYnrC9!EGjCI$hoFUgmtV{iCe0jiN?HaX{}8U`fiprqmQXXma|(JzpP z@AoA%uahjdYA}QKOP>-)We>1TMk@Z&u0gj68V@<+YB=#eL7>}ZfGA+*u*rr<`O|W~ zi~x{rq@Y03xf;Y!UP4Abl+{9K4sHx}v13d0Su|z1z!1GwY%|umdWe`8XC(j&AwTwy@k*x54e1Gf0jUfngYo)AH|yOcwG z{+N#%lU&-m?SuQf8zjMR?9Qyivga@-CP@?!;B~Ip0COaSTq-AS6F+QHxF<3#sVhFU zQAgMc4cbckKMDY*J5k%nNk5p*zwg!nkKK^UX`7|A68Q63aSh)V+rN(6ws(XbM>({^ zWQ|H*iN9R!+f2AXc_uzE(^?J<*YiIF!F#?xZ7yYvHn3)Lem*vr{+arEs?(brG_YsT zLIfyox*%xuAGJ)UGn=viCf;ZEgv^m0iZ8bFM-@;UW+iPX_eTnoE8A~Os)G1txLJ}bGehZ|8 ziv&W*kZ5D76vjz2nba;vqhn#^aOpXmYtDwF&F&hBJn8DBw2ti{1rL(nX;gvvb6$0Y z+eOzS4?mo-8(QcC(w<&quDb6A&$y&E@_utOM z=?FnQfAhVYebX5ydxq8p0de{cyG!PJ zo}Vq!PrCeWr>*gCw}_<_l;)=D!a<;CCVuuO2$Z7-#R-e;0%_2kJ##zLbH~A#%H+p* z89X4@`|V=_Nf5(XfZtwt+YW!)a@*~IR`C!E59Ys(7R=yZ#1B?1--;;?_dj*(zt9Q8 zvkQJ{qtcVPS1{IBmccA1Pdetr9M4L8>e4=#^j}(5$4E$%iO-S}az^BAst} z_Go245elf#7qUd}^F3`9#AWNy@(&PO#ZBuH8QwZnhST?}99qa2uC|HSit6OHm6 zb}r^^nw99GqHd+wx!i(Vrs{yh0~7^wn6#gkn47uTEf(p{OXzInIPQ$hj#*N> z4Btk66ZkmqcnFCRTi}tb3ZG^q=~`AhLfNB@MczNI<^56G)ocI?3gC|Z{{Au*wFz?v znkrQmm4fvY+S8+7%B7Z^HMM=~5M()sVHT|+TuR;MeB1ecmz&Eti2_LDc^o z8+qtA-cRb)N$_y4ulF=U{Y?$?)CVC)e?eenjI+rYON?9E)!6COWcyw&Lu1RzEr{{bRjhFn%_VxKCJ_l_A2J-QD^eIla`*JHGXD+Tj<|S|{Is z9?i&K_uP?-T(5d3L4Uf~_LA(`XxBDZsmw^H{ki|6a4Y@SW|XwCY#|4LPWx{D$MnQ5 z4ujw6LoLDIkMpI;mhMN3t@=I7QE5;J7U24{RDb%#sCffPrmTNKuz+rkx1maf=DZ4p zC#HZXfo#Bq7BN>UM*f_RO`BL76Ab9n4?QUZ2*XDVW*~GS22A|K-jF9#2|T`k++*#x z!BiRydEcXK*Yo`-Oswh5vknE}t{<<%Q?!IxzH%F_6W3kWp9K$p?Z1xFP(XP|HTtxb zb!8s&xx83@cbjPT-MOiLYDKTH{BLWzPMiOS?x=#WBG5R;yW`)oR%Gg=_Pv(n0(Xq) zk$4fCQ|~@+4I#US-1e6InK?wy8oiD=NXkJwwOLxG{O^-w14G26lq|K2Mh7yp7Me?3 zTd7vqrq;`y{sZcgj>yat44T0J8(w}TrK5ILu%_+pR#|lVM7{J^Gg`2?^&gweo8Daz zjLF>9*9qr85aiIm#_mey`68Kqa*UhevN_`f9Y(~noLYD=fv%I-QNrLB19vW%wQcx5 zsmg#aP-MOg&2EjJoaFswL`})XoNO2kKN0f{uymGrp z;${5K-0D^OOKUNbG~S-mF1_C24{hIm*yh@^QrLF|%X~IF)18=gCf4$!-uf)6u>A%-6W-J$43d3;`}uE87DXE~9(^N1-DWRge5#3LPkH zG{5&QWD}J#=g*%&MLf`@^7B`vOx>(T>>a5yZ|?$(8W{FVqBJc=b({LlF!zOXxA#qb zvrda!t4o5amjlu$ax?4qW$k97^R}e^pmSpJ9(Asuk{4yH++-rO!g$@@oB}M4<)wJN zABF9j-mpFDuj443uXgx)3#(kxX=4YEyizhKCdoqVjn1`Dt@Q|*G~$u^V1{68%HREo zw5LQeOqq$P@F9dKOvH)COj9CU_gUiq#-HafV&al0inZ5o^wM0DMXb2IMU{D94%Kh| ztZ61u9`3+`TE&!W4)hofnVJDdWrT!|K}#aMu8GUNyFq=(pTYcBJh-M*vG}5V0h`33 z*H#~9h0bH@|5kFI{#xMCU$pcrW0My(-}Ku|tay%MU;LmxMEZiQh!g%Lj1*Ff`ZNYj z84b_};K)o!k>u>)nS)IS2WTg>2n(T-0|r{a3J0K%qN6I_omvWqFej~|82qUyQCSoG zi+}s`QUyE|tY*!#;;@k%7>NY&YQ%YNNrkD%XbRp{H{t0DuPz%LeEASfm@DtkP9ZD2 zqj1MEj}0HNr|twiYB())re-%#Fx(FMFQlfYyM(1#m z|7;v4j7rF!c4YheZL{B(;`WQHz#0X(OT%;rJPGxa)|3wzQ(cnFa~(F9j73VD-b1 z4L^+1!*VDompkYM%^;=u~h)m8;P^nU68xd5XV#>2E8$NG1zgIORK6x`DtgshRb|y$>!hX5JD)GX^6z%R56kD)`l(WQ?2{oahy-e&hka z2#``GCKMHqOiQ1MyQ`008yBG>26=QS@ff3KE|_#Z*3S5H`?^|nrx6~L*$nR;oVO1!SJ6G&~B*b##hli^0w zd_(ucI_9^_qP%HR?k8mw1qvlGCJ>*t7uqBzgnj0DX>oALrnPr!Twt2S8-8gKU6b6B z(KKbN0()$50C6$otp~<(5=kty)95N;bz`&?xB3Nsc}-J+K+y*g>O+i57JT8DTo@QF z&q#T)cf!~_rd!~)UKqILhC@{88r;MQEQZ}kMsKJiO$7Wu{HZ>4hDcn8cJ_0+XI?22 zR*oU1Te;ifb-SqL&9{Ightp}P`|+VzKdiwFUgqC4y$-`*U_Uq_%$)oy;Ad?vs8b!; zV(96xZd{`MJ%o_5xOeJ^bb=$M<&&PqA#+z%2bCN$g zDXt3R%j0*3N;niAgx5&XY>KgHMv=vsVlgt8&Jr4chg)aWkXCc4$?%)ri5dMqN3M?m z0`gvtk^JQ}_hA-hVY)VoC1xO%R zhxRi0QLo@=wcvLLO5&)#*!aaSB9}!++1LUo%Ne{1L}GS^Eo)oFlD%KQ75^TpARndL zCY1Cist-qK5m(wW-IFQKqn~dl&bx>eiA6s8A|gSiavssbKT<>$UQ6BiiEeGgWDgeJ zgLEHh8UR(pM@c6IQInWY!Ye*Dghh`sp}xlf;G}@s8D4DgR72S@B2&3g@globvm|Zo z-a#c^SJb263=bm41v4Tg>AIPG>0@&ARi7Z{?2}xvuLFqO#}yzy2uqMUe%Hsup?^%W zv>Asmjj9I>JnBY!@}mVwW@r_w8;B-_sDz(2;k2yy+pI%E2WJ9_L0gnaoPysvlk8a0 zuW`dQhm@H&<-{T@j=giIh5Ru@)Nn9OaW8xxRs~Q>x$|jit$evM4(3CYZte{Dut&lJ zi4uXZVIQ11ntc1zhLkjsQ(ss{|9kLP6mcJZ1^kG3kf{Zrse0Zj zx?{!+4>Yyt-zsHV;c&Do2?y_Ln2d*8X#BDM&r?angEHiKqzgNXQ;r5%DK7^O?aV&t zw!N7pET6}!kE+H{+#M@FB+a@_!@&3xi>UiwVACN12IWRe?Ew&6eRW=Ia)$CBJ#q5S?prv;0wtJqTC{!dM^YU9u;~WLS`y!G>hC2!R{(N@7_o{!EcL?LprT>vq2v^)>X zF}UDhQ(Q$NIGuLa-~eR6I!Y~Mm?@Z8FL>Q?iv$CsMHg;$4Hq%c+cAF14|1L2Sk8ll z{re_{K|fC|k7!Xb^$$8l&N|I{Bz@g4=E#sOgZE`xrODYQ@{VOIO zNWeM_ywUn*CuvQx^5fU5Tp-=T}N#w|WLbo6l3H<<(D^y6L2l$DPO*2v*1rIcVXqnD@R@+)VP z1z%`nMGGxp@p{Jx^}xazH#j2Si3)NQS${|jyDbbE3m33LOAhx+Z9wt`CTz`4IG5?Z zWSHR}cw#`%3P;{S&8Rbjt1hI7*6$QaWD4lyU`*6?&$hBUl-Rm0_baRD6HAr6Uy2i$^|sJR@NWBKp8C4pnkBpI_L zXO-FKm#Q3mL7M0hffUV|AG4+LQp_2zJ!*xc_ffW3{Zcls@9A-d1xyf2J|cu?s6GQoXvoneTwHj+3l*_N48+VW zOQ53CLp5d|M@90yAn*;rlIg{=g;fsk*5&X^bFpXW8mTL)qm;m(A_dt`@T6voM^$sC zM;f#xr%u-Lpf0n8}Bs@!I%~)Sk*e|2M~Q7S-37uRR}0%`v~%6S|b^^)i4({G4L$F z<&+qESi*s`P?r=!(;6qW{h&W<=WZLKP%#3KA-|!}|8l16z}djmhwEwmy{dFs5$UhY z;ku}0+LRv1oT;MXU?ayhdjQdYV9CQ-z$SP23gMgpmRKsB_YEA$+qVcOZ9Ge|v=?7M zwYf7BRXh;KLM+NT^^W zh;$f&>Z@0t9`ZK4XZ56`v4QAL21 zX2^Ux?G}(d$xD!4bD@VP_rB+VJwq{|d-GW`HC;VNAk8HtMtPng;HG*p zP1A=tXkTRf0r_#-FF(3gXz*(NeD5#W&hZ`sko#UhM|FHGW(UCP_7jMV5CdtIMF|lnsnQ-EX zZF^$dwryi3wrzHt+wXVpcd^!8{coSfI#qS5p69ps&MTCa*q_K!1|6N#7r+oEBk28w zzScOoYbue#hZ zlhcGG2)XIZ(10WQH;KRDkwc|7E6HTmn$zz4_xAcRzs4w%V$HNzV#vglLiT2Ubx8D% zx2I<7DIeDH*=@{~z?BM9# zZt%Gwh`SVY4o3AdT4uxMa~x&BK}r8QY^~(91J^#ViaAD^sPbl4yILSovG_Ju_|A`< zxw5Q#i#+Cz?Q{Y0(yl>I8E|VQAKUa!C~Jc@%Zk1?vJ+C^c;0T{>~A0bm*&x1jQBV~ zT4XK}&{u5|#_zak25Qd}&`|G`m|4mE>w2@VP0C=kU)AK2^E)*9{9A|B;d5~VQ;YjH z*PJ@@<@mU?(cNY1tAAKeTXqWxHfu}yiE5nzxoi9w9HdByY3_q+h4w$lEQdQ^Y2*K? zR4};;l8jsIIFb2mJh}HU_|ZSKaFv&WCO5C*!G>~&`B#aUv9psLDhEKx{rlk8V8#RE1t$krf+vp@ z>KmUztz#iGLaPG|;<(tO0JwUep90?Z{eSk&6{ri&=ss}(5U&@rF%CQhXLxZ}D{;$t zC&=*2Dm>6Ox^&#Y0zEv41;Q!p0{5tLRIv`@R3?5w-%WS32%X4(E=Gl}>`0cuFycYn zFzq}EparLXx6NPDmYwt%Msf zq~RiQ)|dI)UyILaBLBigHbzA!pycWGAu7J6x6q;q9ya^89kd$*78vt?>IR2Fz|JQZ z&Zo~9WdSM;PClP+lE&vHF(nV?i zU4nv>lGqR>=h_2>i9#+K_}bwNarr?~QE<`_B*-YqiwH|&;d8r-4F^!6S$?tS#&w%# z+=A-nX4qcThC=VXx7E+zxyAQ!czTa5<&O5`{jPC&rVg{=JUhDWJ$pv_Lmp3_K(NAO zvgFaqJXwqsG)iZ5Uk?$knRpDev=n4Mb$0}58i>O`sLg(JhO>Sgu`KdULu;&KLCkuc ztkt)}+q)}KU{;wW^&oKl5>ATX@>=u><-P~Z@I<9qpCjS4UMYy?$>-`@s zf=)Pnqsm%R{b1O`#af-P=@7^s?zy9fn zApK(;2c`GccNMz;7PY~#Ki>pO8)8(EfX&&v*8ubu5IUdJeJ~kz?2Ss3{G0I0#ttMv zhzZ!gzuPqH?PMhQ>`TTGy#E~K5_t2(g?%=JCgMaMIQaduG>al`gR+F)@XI<^mxv|r z?R{EwG}Zzsm-%roV4vwEUBB>bOH|U_ujOvHok${h@)*>v+ob63jDSMG={)azyN_EW z{Gr|d-q*IfNL%`q^0v%|AaGxp3?Sa%@Kn0@Y{u~e&aWH#;554U5e=35#O%V3qB^1+ zqJnegcc9Lt^lHJ9IB$q~LjNV%6;u9cw-tYJmL7AaX6Qvv1WUqMV8$_10|Ds0TpL7k z6;Eil;0*t5Nekn{21T2(v25w2Igqt>#Q0(Sd$xw`HH+V8%bUgUcxl>Nv)1!jtKVX~ zdjEOmeB*P!ln6FVB>vyYR!|uFKz>UM{vo?1dz(e8K%$+Xwpx|MOViopgOpe~FVZ25 zi5r?z4lxP0{SANF(rP4zrfc|QBRq>Ji_ej?z_FEQm$_f z$LuVM(^IsS1|C()**bvV%wJl?3kQTh7`zUe_$qCqA{2W}`#c^g$h?5h@1sbkG~+=X zZXLi#V-<-N^oz5j)RR30`LU~fLTGN6xh|_Ec3ebcLLi9 z1r=_g|1c7PAb+Pf!B;FyY<=LycPG)H+`sI}Po6t2a&lw4Z(1Hu@IqRt4&GCnKB*lk+$Uy$(+6+VCpxiNQN4nL$6G7-2&)FdLQSnKM~Dbvz^XVcLHHirm-AP zHY#WURd1Il-B17{E!bt9r1+e*e2+xVR5<}|TP<3$ja*3?;Z~`gQz2%fk zZ?#OJ`my(m<#mgy^UV<* zLyOBO6lB3p)i_T1-qmOPYNLORja2-+2q#zb#f@NjyJ`3!7dJ~R9;7&Z4pvibqH2TQ zhf%}#&c7mA9`lEA`ExO~)6>(u-y4T9-`@fKUAL0P-^d2{x^r1-_!^R^#HIp7SmOrQ zI6;L*(F^K`wV@Wc2=sMVlV-%6SEEx1CqbS{^~795ALo%6%`TtWm~DZtn;HlhrsrcH znAn3tJt#VcyxWMr%$#R)VDP}+UWj3}Nbt`ARw{trLL)w)>thuj&APCo8EmJ1_5TIe zFM;5Coi0cDERInWUnlk!sPC0ba9>B=;TC$m4+HwxgUnCzJytG|#`Tdn*znVM3-Stb zRq7n~m8pauH@BT$Zc}g#a_ju1hq&^11iTK8@fbQ`T9wVvpydW-);Cp#1@z!zbDJrp z1MCbiTHNu0oNGayPk4aIwV&1G%qGAH!)u9Z(qifh62K_%Wdkw8wN;4sx4->=fcf_9 z%yA2_$)s<{A%wpBL7-cn1mU~hZZY$(Rt@AXvF@rG+D?m#J4+d$wRi(XwTsvzls%$5 zR?Wbb4g7^z!H2teAK)SJ3l}7Q8FUhK^srps`Z3u9=8wR8^t|s@nF^$Gw)6G;Qur~7 z5Vd5#{W6NLm_+Yk`*uM^_??TMfks)9(?RK)kwM|>X}Ow-@iVX_`gHNK-(hf#ed?)# z1@##zJC*of;{JXkvp-w(#tJ8i5yluLG8Zuzz1i+OGdd(4B&vj1V9HGbx7OX@EB2!m z(lrQL-2|<54@2YHvKsFlCbf-x(vVA(td9xPVRmVO=oR;Hjh7S5^GCj~!)ZO;k`DrJ z>8;sj!{$g0nH*zVe%yY;9l65-tL^rF(-rC+hfVJu>qK3>PlS9;z#Wo+&@V_xmxH-` z&EJ~LT6wK|!c{e0{Fg0H?mz!N@%x3)S7|nmfYxA`#}n`CsdnIWmUWt}jdvmjdQRsH z9*8kGhOi^Nr6*)TxOLP?eT`XniyUsfn1b@xS!DH)`Ox7=Ku1R=pnHCt)i<62nNPO+ z4)u+!HtWA5UXEOLicPNcYd1&!V(Jxeact$BmKP1@5(K_dRW8$(<*PLd&qVjb za3p1FGd_8?`326hWZKAK6a755$cBI_dbL4aXH#c_A0l-HVYuU9=pAVBpI;MnS@_v*K%H(C=;;pQ{9r zu#kA~m-WZVeRI1`E(A%j9ELk$M&7aas=VxY3M~uO@wo&)kGxF?71x?p-Mi|f-nG?K zzyTzaNV`Sk6ktNW{cy!Q@qzn*KUryIny&9fO~;jGELn$=$H+QS<@f68&Z@gd+#?bE^1ax~X5>n+o zv=(66djE>P1;@~oHZGLgo!rUG3hX-N2vw{#^Q&UzT!w&&J~SZq!auYPNiyF-e0NBp=B^$RdQag^I~Df_Xa;pVg` zVKZhL?m;D+?oVC9>N%1XeQ-;hDAB|eVZd0(^n4S_6USGQnK`+0I7-=ftyK_JXB{;% z9s%bei69|(xA!+u920o=m}%$rc$v;+=pbEd7uVCBwxm_9^6Ech@jsZgHvK%slVVj4 z$;f0W%aV->kIZ-2U9Y~Eu`%RMx`_&>613x;QW+@NH6c)xJXZ~f4<**Y_P?k7SHpm( zDXpmAYCCG~R!D=|=hpLnwGw+^8KTXstz6X}d20+8g9< z7yDetUJ~Z~eyR1lct5eOJwJaYKE(=c{Qj(S+ z{>|t<>o$ePlXFBQYXznE({7;d(-xm=0YR-ispt1vHvf9_r|oi%K;qS!AGe_jDl&3! z^(-k!!ZfV1H4u`|A@D$lmTIX&sqPmkO7#nwfqIL;Q<2o-Ih#0{MN7n(2Um=KYBtql z`6!HvQi^KH`Tfc&$rO96rSfk=yqK!%qZ~l1(d?~0F{Fzf>~3`}1~A9oiQTIcBop+T zy6L4^Qrx*&`45kIMm#Yb_P} z-Di1?oumW2lRbB*Zvy=KBfAQ#1*W1JN@_*9JIj2r9x?$C0-ggFralhZyAkszu zdoI9k{<+D3V9jndz0-M`=cAmk9JG7vF+HD;llfm3;I+FNpX1qg{`$kdhl$CsyYe1W z_@@I4NIY3dG7Vz&p64Bf0lWglVluK|2}9wG0MHr(E+k!~R`wSdx%L(G1v~a+=1_zQ z7|?O&Bl!;PUsi3!49VT?ii>jb*($t}=l%h1EQVB%UV=s7@(ZHAZ2jeU3#9yfYIsdPj+;K238()Yjwt4gUcTPAl8 zwA?=Xyd?t|JyA_Uy@uoa3OyB&J|R3yPT99Mg#moW(&+lSl5+ouFXV4rg-YJ z*13-06}{0eBgJURETlZ~o^;W+%C3iAM?hBPo_B}AkxO2X)V}xaW`Sq15?n}xn%!f_ zUz!XW(AO*YnRRTleesaYB>#WG!noe+K~zzZA$Skv%Kb`ODy)9PcmVf%LoTjLLmU7D zV$Aun1?c<%V76bCA*n6HRx%PeEXNc`*g`p+5$>g<+H9w4eA@euc_v$qE;nrC@$npg zu|PRl>TemRvR=XqbGVPy1GKr`ys*UW)ny&uD*c*r5luC)tEMH|%7XVNM$G%>B<6)@ zJ%j!g8OS-@aw!NT0QiIHui;v(Eb;p>=mKSv9~NG|GQ2&r>G3GLpEqhy^f(a#=JYx> z9KpY62J9{CzK86}=KaNXYl@Posv(AyzNSKg19Xb3B$53*wvV1cG}`^WI5xt7*F37= zle}3OSy{>2P-vhn=);085qI+!(feke z^lu{T4B>^Au&vLXigZQfi!IB(0fn6`isIPM>N9y*83+}ethhZ--iiH@ob(3(;9ui>JO99CKkRQ6@b=BW zUbODH8Ia5s^q4+zyUJkSUupYSh6IROs_L}r@H$^VRP1?O#Bj^mEO}Y-6U=dIB4(gS zH&}l;OTe;c{A!tc94N2*PKPB=1DO{z5@zA%=}H4i+^N)X0X84m1P% zufO0})4soi_Q7h*^e!I&7#Bzs-4`+UEv_EHZfD9}Q3_g{Q zIN@AgE+19G`JoUPparXbFVFkVWk3*^x&)6;Qt}4qVpBf20gB_j#Xp7y9yh=q+NE*gWrCWuKX; zGsTMaY_^$=1S%d+I7dE%f*>70Mg6TGu3D3!kI&Xc|5R0+AEGpC3A{&5++qpV8h*C? zVM~{V6U2s!OQ)`-GaR0x zq<|h?RETHuZ3^-ou4(Bxlrtk6K_J$&?JZ^ZBQ$sOwn;~OIDX76v$Y$9OM@bUI+od? zw`K38$3j9epfZ$D(ZRoqQ~fiNQ4x8ZSsniwAJ?IOf-d*LC(^g7u&>7))Q3K|strHn zm|P&r(tU^24N7D-Zu;My7Qe^>H)yJ9V^5N<|aabcP)Z()Z0{XOnNF8wF zz5Z1u>c7kmls-J?(p?TS&dE#eOV!oY+d_z?Gd2*!PcMEG_KZa9lMq|(p64G<%Sm+o zA?4ApgrC}F95%MqFe;4(L1_UFO_f$|%1&`s28ZS}1UG`7(M?Hh+%qgA8t{(^wHgXz zRluKA#epUqPfc$QgOfRU`c&we>|uSA5QZ9>`PkH_$QW};DLDe(sSunwM0?p|8s0BD zi>iAqAB$tj3^g_YW+Kn+p+U?_QfY&QA}*sp6Mq<)c7BLK5H%YH=>ewA?=QxlU7Bt$ zXC$LVJpo6C_LXbJ-+pE_%JCKE+K{#$%tS6V>%aKNr)E3E&*F@N`A!>KKca<+RHh~A zoBA5Uu|xpGQp}J;(8d@lXD7-!_`*W#E^Kp)8)CmQz0lmF4QiCOSYwgCBJ@}aR4AGG zSrHrur&(4_g-_S^#RhlG=M|W|#xS|G*Vie&Tq7-w#p`~_DXPJXXCf3EP$Ud8;oHky zlj!WC7C=eatW$!#4bV>!+d47+Vsz0Pj5vU)HRtOOC~8VafiFXpveV zm%IgUDAW%8HkUZfm#D=5y!y*u2t29OFs){z9q%t(xGBg6xV+$FzEc0VDRo7F|G#p2SK2=nu3bHL2Q;SK-DB*Q#M8sfLS8cmwauG5s?BIl*u4F8X#?T3^u{izu|^q3 zWD_3IEU6aj5&Z;mskD{ict7I+0_dgy)H+K$e1QK-m1NoC6=4jx5a|_NG5e@(*hs_1 zM}Mi3-hP=7?op=hQmMuZyvtmg2Cg%(yva{fJu7(ZRHA^xZ$Xy9(zTh2a72L}e7F5* z$~@V)$8&Mudk1SJakXv140b}FSi-q_$1IZ7Snw21bWAixgv}xK?DxNA&EY^F5A}ld z?{IoQFFp~$YeaBT@4I#I63Oisagr+9sCw9;rbnWg+WHxC5j*-%GiCyBaZ@3&UCL=- zNaThilfCdHCcNAsRKfMu&}NPTeefh&5~1n0WWP z=fsS{)BH@LH5U1S*@DaMW002ZtV|YY(jZL@ne2yICT7(jXBj%v z38&j|PLvH#HRk@0HdKWPd_#I((%qU==@J#ZktkRJReJr)d6O1Fne3)e*LdM_j%pB{ z0?!R7t@sL7qBI|TcqbepXmp12ei9Zbk}og%5kn+rp#zb)ycItESqFmR?%9r=y#C1` z{Zflv7JVNX)%M%~^<_jnC50iUAEzQJL}U^Rn-ARBIi3GJ+9S|ki9j;k7NQ#yOHUVK z^#)a_j=s(o51FD5IXsUSd`4h8VALi!V$>#7TjG>Pj|{Dv`)eugBM&&MoR=5sHeLZR%A}q)9ckxv#r`DmR2>5F zx)kHqQ8LZv7u4pAK6%$iQUdQilS|pn@}paZeKB$J<+Vg3tY;x~EAw=0J^pGDw)(*R zGn-p9Q3)BlQ}8s_yEtIp>$3yv<#69-=PINl1nwu=W{qNKG&AD8e!B_< zIQKh;q)?7oUd0sw`3xW#(S2e%&CwffDt8&VW>!Muo8yXp&N!P_;6lJV{@n< zrKpB;wzPv9T5&)0QhZrs+Cr(SAP*1ST$C8ZQ6Iw72_*UUplTlz?iAoAqrj2lOc zY3Fv$9JVIUbM(kOxkv$d0n(HG-lcQc$Tet(+(B2V(B15PW&px@E@|d?y6`B2eZ+c= zf+=Z2edel#(L9xkXluzGW8TvIW-&#;)7Kx?B#e+e;PXr#`eT`gs;W~XN>*H zP2wLCqh9RSxG%mWXQd!CZGbU|Ib>k}#`KdV*JNx=cMla*TN<*2Cq1clg!}0ijs)P$ z*R|0*;GA#c%ojtiA*4_)NYKOP4w1R=BdS9LFBsraQ*YkFO`q04-mNZh^1r8pA7Rp0 z7fd$p3f%RJTKhuD&(did2oI;bFE2`Cw*4g1X-5-Q>-cGBN(>Oe^tY{u=L<#c7znpw zFnuE4<=06+Jq|(Ma#*z8X zc8SbeYz63?qvafhdO|frkEHQ=Ud}2&Ngq${JlDuDf~k^xn>bH+9P}Xi@wi=&!?ll1 zg#C$vsBvoDAg4Ba@e!JucNK|^>EZ5>25k&aH_I6KSS?cK(A83xAR50eyqIu(+^Dd2 zbfbPE6S=`4otPEY+dwAjp|_i!eoZ6@GQ4d0vUf2kdGX)DDA~9&Sz*)aC2acLC+1{b z`{en9j1Z_z+0(ualJDJHjLRLKe=q-WYvF}_B@gv6{dy9>mB=h1ylW;;dvMK?Jeqd>x0}i1 zmV;7>2D6Aj;t+oyN2^e%O70c;uDb{X@CE}l`_P+zKdS0V4Gs=G5;6UC68~c0gufk6 z4(^eP2L_>9oVq_c`LofOS*xK6pq;s0+e9IBk2DE%?T81yNFv$@xVt~A2|5zr)Hi~O zZY%^Skeq$7ByMW=xh~L8cuJtLa1PqbdO%7lF*_9Ni1|7#n#fH`fR(C=uTbF`rcB>C z$G6?V2+u>;SE3-=Y)%#Z+oY_uEM6m`;Zp`>5$IAf|jtju|Su1pkMwXeneBcF@>AogdP;W5vBwat1Dv4C&jhO0{Ba~zISryWIAWkojB8yt^?M}g7UO7pw zg;_aiT0&$xLrU{hcPjBFxgF2##P>!bIVVYwfR4Qm3qjfOIpxpLpLEjD;V1(Q5_?_P za}I1K0f!-i4m>n}1qHDKpbgEno0&Rk?K(@feD%Mg=(lV*%7YrpdrA4}pCNM#wlc$2 zo77gK)k&qRS4a{i4<{FH6Q-iIbi?}X`p_(eGX4J42k)aO|}J}=_wead9f z2(k_(g!d&jk-{Z*K9%t?8^PQL8fhMrbe4|KIZ>$Zv^pQ}Dg+nls0=41}t z;$$GA&J0$ziX{@w=h@_QAFQnVTqF~$NTBANG4i*8)3q~4<$Hy^rII|7OWcx%4Kd$v zez`1!E-5DW={55LWI3wzEg@j6dFlC7>>%A9%ROXZauEiESBe-rom3eYav6d@A{Si~dMQB%}UxorOB-&lVXOgIUDTe6~SN{*m5SsJG)U(|e-8FV&l27)wH? z;!3x_ZJ^_xSfFC1>iv>z=;P(T9)-sWs;DTxm9EFrR>4=($2c9b>< ze}XKM24{2@H{xEx+~+ioA?B)HBc~gDw>_m*{{tdg&_-}T$4>I<jvcMo|iB&=@8Py;5D$qT@q`c zK+B*ahmguzKnTh7PJ%kk#vD+dEw(*-``3kwM6w^$Ux{duA-Ob(w zwz|KrW(2wV=GA#$tTMkZBkF177|;f?J^2%foy+?W2-SxlH7Ug~}9~m`%}$ zjWCSyfApgg9mB0V0gH>tqvB*p<3XN8n-Ge5{G7_bAPQz|rSoDD|V zX3pJ5l5iVKyI%s9>`aHX<+mz@RM1e7B@4>>I1qvw$}^&?SXUEZoh8Z9dY+l<_FeBo zJy5z|EEZxxoJUVedN=E`63Bc>{s&e?#JX<1OHLREo|9L#pdY@ut`Wh7Yl~rP?RLli z@{L+ALE2*yh-$g}ybESFL?F-lBlC5(?B!Qe+ zmrV&iMN$B!zHep-RWcHGK?p1-$xM!XK_T(0QHbq&=-23`+o-I*$*r%VFI($;r4)v; zFjzft!3wIItr6ITvF>uL?WLBoW>sa4%c6QceN9L+jvD4UEvFj&igFU^rtXo#%p2K< z=Ft{H)wPeo_ja~kLr2GitgMtoF)>e_5t_una$~Lh^`dX6#uI%T-XqdMuQk9^u5BXc zT`VHs7Z-uZ*e$Qta|MB?1&Ak)%fdLK?AwlIl$<``si>i$8H922A7`Hld5nka%o9KH zf?h+~>Txp)(Qju>dQf9y8@Ol z`c1w(FMc{5Pa8HE7yGEID}U}#ShQ4Bc;AF*D)w9vMWrxC6`WLwj_7$#k)#rMfr6p8 zo*lQ|&0CEbD6Dqlovp1iie$sEg$&x9J(jy;gK=lpaK6-YX3Y-tN*pWHfO`v7SzmF* z|8$1WilAguZM~myt#Qon=X2eN>Me6~=&a6XI`$3a%?SmJ1`FM`E&Kl+mTtcGUHj|m zs8AMQNBN^iF%T;Ui11?}{74zNqF$iPV-I4WY| zklV=gdNWxIV8q0?_dSTPCh~^ti!hPI@0?;LXO$0_GcV8pSLX*8Q~H8`%$^DWFxG|z zc@@z|J)=P$Md&9n^8|VB`#39>I`=@BGjYNEQ+A|{h$|UjoeY^RFBbVdo#~qesSzkc zeJc$y8lQtIG$X`~61Q{18-qt-2`WIJX1L7^Lqn`F2)y@8D> zzjBMG`w@Zklcr5Ocs;tnT9Be*qAatq7qVPmez9n96uixJ!bI?^gZz`nbnozG)CXq(*ovu_!Ad?KBYyU3}_Im2&J?h%;0c`W@T^11fu+4k{Ns2B)?Mn;T zb@7i+75OvwFTPo9NisdGQjq zqViI0A-}_wyXl$e>r}E;?>ORj)xHz$%?JdtDd@47tc{{<2o!yVGGqhNfke&pX3QUy zcU+ZH#?o2i_Js*i8g9y@O0X(K=wc+}%HL~-DJIP>LnrE$L`@J=ro_ip9B-B|@F@g- z@>nepG4dYGc_3iNaG!P&`D!2Z(#qt#?oHtndKPHeEbOHM26&x%Am=Krsiwtg4$%5B zn6%ArM)sp}+6`fOuIoOI1e|p@qr-ZApNVh?U5o^9UJ}(lEY~YuBlk!AZfi5o4L^Z* z$3*UrC6mZ&W^Y;;-{=j!Z2ryz;YntAZ8kQ_TbH`uZ5}3E=&Rsj|;j?e0u$eM%CV*!oH7xV{LW3IDYOu*T0{U`DOkl*ZHHv z8keEsn^87qB0MctDXrbg6CUiXJsqdtx|U?<>u;!%`}R`&R%+;DXQl0X8X!JzheJNY zYg*f`T2txulv8`vc@-!M92XzZ{B^~9?4ILGq}W?~v(bGfeL4T7rs)3qAt>nVw4wuj z4;oS~zx3~4x?YwAU*%L|4kBQ#7i%S3skT3N44HZtF|AFm4deJn0i%b-%A+5{-Q*IH zOf0e~Dl%klnVF8mq0qu=cBb{J0u+%^ll?To_=^fl-@IC~=$xDF4x>OPr@0Sb0JaF|(# zAAdzj#|KBmvZN6Ak5NGD1t;atU=yWFr93?tJ_Z#hx!R*pMY8k8Y}uXIT4X=p?@@r} z^Y!{m@6eXO(*%B8_nkz8TBimFKm&y4bIhBKe((4iyDaIw|0!=ad~z9T;Jgq3@%r$c z%b{W0AM`_e9L^5}Hah@Xpe3}jV&al>)4fxkYs=NB7o(<|AL=L946sIli~G zu8=wIy(s&50$~uZRdJxpBkQ%?a18C)==IyrQYm=k%4Iv30KVD{8#7r@ zvioRq_&^=t3cnM$>=PK1l#PM$4KOoG00r>@iCbeCk8@i1KIgh)N!0nEovsYmT&RBgAZ#7)zrMu^@S7~bC zHVj+6U_5KYah6!ZG(?xdpS#4Fgi-dXav@pzA<4hsIT{2Y((YgPXftBWO+y{rD(}Gm z&^*4;8JCkz?+*F)81Y?Bn0;@n!IuyiJ%^v~d-Rgec3xuYWhD5q+tq&W8#pWgl}?Pb zX(|f1_W4vFc{44(MYOf5Xt`+Z?-NzfQP)JtGpxO8yy|ehP*}HXJ*8w5d|x>0S(fLn zP;6zq_IsHY#?gOUb-Ra*xb3`rj%$n+MA(E(`Ck^mcYBl2@3MFH0~iD_cUesNctz%W zC{lNE!8^)cj@`7(yo3hkzVw&Ev7>8v>&$aZ-C}4ga`?~HS^%}(^f+8cf372)3Emg} zur$jcfe!p2+?`FJkCt)%_3mKg!1aTV0?&NdF7Qw+XTEJiPLwq ziU_o=pljVIo9!c;{qLWM^yX}uZ+fn-T(+*+?MSc*F8yVp+H#+b;M#&9#(^`Ve-d~$ z#qr4?exr*MU`F4&<=XbT+Kk(?b>IsHzzVx%J(YT6W;>4h++#B?X*cC$*%YZu1}e_b28y>=$NIj4B?W3i zzeF~?TP|<6oYNf3ciex5iU@am9~>@U`JQaftgBEVU5!0*s;s6PB_aUG-fiwojWi_Jz>|FWIB<2@%#V{xfc!sqF-i)MBPP^S0r-BBRn`%y2ioOc_a=)$-hc*I37>`0NI5B1c~VkT z!Q{1%mb4up*GJHP;=UHJ;&Ngx-^xYj;O$w&r+2EtjmO>0cJs}t_rr5y8!x9D zSm{;U`4Ijw#Yh=?Z+Zt;=(gJ7x4kU*vX??tLdP9;(REoY8I9j&0K{%CSe3};^zG z{pz_Xr-Hs?0=I&m7@)SQ`r~XgmrR(y!x@j?`{ZO-l&RxBAnIB!CVQUBPA%!!p6~J- zAo1GE^rd1Oom#cPrGM^~$=vTT`%6q&e;N6*Pw7qA%k@+%XO_XBXK&u#_r__){c9g? z|LJ1gC)?C;`ty~yHxl$G(1ezsF8So1Yn-TT*y;>*@Ez7--1t9^s=ggH_I?T=nd_P= z$snlWL5>=!Y@L;KNS!tniWqNHXwww_m~mKCGfCuB8UWuzfA>TxxxD~=kDu?;hvJ;c zf=JsGK!Kd)??SWOC2@I<$Q@VO8vtDp8o z%C8lKnK{Uv{Ut6uO@gM&*>A4b8U`tvikt?uIN*~dFEr)_Bw3bl@Je30G<-YMV>tn$ zq5tfmLNQX!FPF@z$88@vlXh^h@nl;@H?gq_jbQzbzsCdMIG3>@itL1Ui_l>z!G?a{ z)rmjLsdoJf?m9Wq;?k0*tq(p$Shv{rt-bz~3{uXS&29KP=_T}f7MCP=n0RZnDAU)t z?KdSE+Qd*K=n~H5GM{Zf`~00~4E|RvGH!KZZM!R`Lv2|JfLgxjBgL$qatubVUr*aY z;Wi$r4xmMBe@(7=ukM#ah0c37Q6_(%01cWZK3@OcbYe#Wa;WI?OP#R3O3J8Jr~zLU|E77(gBCu&`wdu@5xK z`QIznaTxWHjgF@|Jx<;eL!WfN7FaqBZ+G@1c_G?72GFW$=@{FNcYg@Je;b+`t_VEW zX^9IIeyaO9>6JWvfQ3ww$bcHDV;)g3?*}2jc^J7nG1qE(lA91EK8}b6M?(CdfWmZ^ z(>Il{&$I032i%Zo{hE|qjWav_yWnxQPL^333@OOc{@D#Je-#8p3<-Cs8*TB2o* z&SB8YcJ0bt`aThzWb%A5zwd7#nv5GVOZ8YCbtGkw`F0nxSqSJidU<7}b7w(?;v$}J zw-(U%{#uO;V(j%;wQr^!jUw`PJQDnL8MXA|aX+@Lb-#gAuMn*~<8R%nQldAwtsO-w z`u#xTuq_8YDcyDJj4KkFV(OBilsR5ODsb9u>d9|`a&2xtMmk9fk47hGrEneiM<=;8 zlX*;%Qt8rV4yCHMp(TH}qkO(5lLu)E=Bi=vMUwF0?5#1^{j$2~F1I+ZeydYa&PF_J z+AfG-x(FVu5lB&kPV*@e#C75{k4wdY9VMyfISty>_1G-ZKE5V>0Nbw)O#XQ-aG7UV z%Z})za{jWsD;SOdD+7@06Qna;Y?Yo&URhfr?%l~8Hp$aVy-J?|TN!McvSL9S_l*MJbw7bMDJ^4Fv9s-Tu;K=# zKDvFj#FUBwG%>mxc~Y0pX?NcbT51;;%-B_<*l#0#xb8$w@QWfLk>d_aRFErEN};Aj zP4tTo#ryZ<`MXq+(9B5r3)Njp-ePu7E!EqepDXez$Os(Tx2}lN%A0sklbQv~dE1UX zqIVBzv_|&dyyVZ)MTC1?6SPna_{{dW16617cUbmmS3L~q;;~u9Bl2a0`CSKdmy%YG zO=Ia-nDPiM_0UhWjSObe(6i%JOwBGl3)?PCx4Ra18PJQmpUDvmB4vUh5g1s_DvT7= zp+$#P-*n~|U?w%2=8z`N2-(m2^FW#k8-bI?YhUlDOCVsVN!wBL+j+w#ubcPLS`^H~ z>EpIy@5+936b{ASGDh24{4ZL|tbspz^C@euo&eA$+BmDpR-VIu?NtRvvxYHx%*_D z(vTGJ4TWC2t0x~#h%wR_q2NUdKrMqCB+~bK?yL}0(sJ{n-96&9_M0XeyoA6jy++&% zH+h-1-^<5~#yb~b^*fkRN<)1;F@>Z@q~nWs4mEfs2Z{SJ2h8H1HF=b{#=4(B#Q=8P zk8KLJ>l>Vx<-p!C?nC}&@fxIqY*w_fNt@g#O9%5_Fn^vo$IpUcWD9`M*Q4i1-}8y7 znpCJEdl(iak!AZyd~_zW{AoD_emf-%dwZ3UWd&wXF)8l1@-kJUbN4_|r+nIBvi<)ltO$CA+-}_C_ z@$q?j==lTr^eq=>2?w5Fz3FPZ^DWC>e`+8$69vEw1PcCS7YqOPq>=Wp=Q4;VE zI0ptst}4jVSzAxuSJO^TWohXRrB^4LOJ<{hdky zRwW}S`1najUM;ffdrf}%Q+(hE=KU&l<4h3K;8 z&6P^Ir-wx6#Y=w3ti9G}@ka&fA}=w;cIpqhiU_v042D_I?+v6!sE-7RZw?np z#U~29cU`XrggBp8e_9FPJYTw3L7T1`uVZ8sd7et$(I>!N`-ZfMWHz^}BH+v0s-xOI z%GbwY%k!`!n`h(wMAa+X#WF?g;9y62UXLU1n`6>Xto^muP)Um}sGXjB#mzcNF6dy? zuxo+6XCGIHo1KUB;@vR*R0)S^xf%B;+`(A)9PfR7fFJ+SpB#Oj@)4r0NmnoAbrl)k z*J>bo@i%|;`_b6Xpns#HY%Ed+3bjZS;S|F~H}|Di!qPM0D)U9Airy99{dAe?ieq#~<$lUPP_c<(>}%s-U1xa3NHJrg_dpWFnZIqftZZ zAA&)|QO|ZiIN-qg))NwL>&@gK7PiHT44&vGDa)pk8uhaCfXvL_$o~(j-YGh=?rZz5 z*tTtVY}>Zgv6GH%+qP{dosMmH+_9~) z3My)ffD!MF+;yTryPPOPnP8>mckOU;)cAEzAkQ2VwN` z4F;*oRaMXoK51!Yd!9XLemUQC1fJJ(zJG1z`Fz@uZdf10zCB-gZalVc`+gZFrBb29 z?d|0VnH@>Ukjef|NRg2?1Fad;^i-L%sj5aGP=Pi1ii+rMTN(j|5$qI!Q93RQg9*p~ zpc1%=LG#*jNR~`dmT6+>ea@4Gt%+Cx=%riFTXZ`eZg&-S;TN6Lg8te~C8FmmXIw3K zM1FUboI5Pr0VJQCwyOHeNiQrhLbpI$u#VmvfuWajLX;8CMnE3Zz$t#|%` zBoqCz-6d$-X>quADBF1(9ul{!s!oZ2j(R7WYqe#i^| z{`$Ab@oe7c%3iQyH{HXq7Z{VAO+-yJ@dfzveJ=PeT9R_N##lhPtIS7B#LU!VeVkU8jt_ z9r`b&51tGf%ub`P`}|)@s=Ga|v{3!-s}K+OH)JVvu6@MvOdbV=3OmPtLPZWrZSsmf z<#1V_Musx~fTy9tFRfH6sQ1h1pBEm@^?&(#w->Ad?(6EaGYemV=VQryKi5Cmeu6;h z>ulw4h6&BRS3fGF17b5b`Ce@D@N2qZy1nP&sU;DQMLt2;t3)<*Im2uXfCVM$69Zg!*a39=$pvi<9hx!-{m@#!5EumzR$sS?@aH0 zkLalFR(E(WepOjjQ71Q@s&gBCEyjtimyT*f?nYajeujG5WNmHR_vO4LT*sgkj$IGrXR`%2Fl7LE*P=OI0H$86aDAa z#K)u(1Nc5OZ*Ahbp*FOx#3nR_|13QWYxws%N0Q7Jjo*hcr~@fzxGMFa!t5_1*R%4v zjFX1i$Q@;CaasB@3yCNm7gN$Wgrine*od1abS`Hcl=Z%BJS(83-%&&SNP2HInOme5 z-!h#Cyd>4gS(J1tEnN~7k)1=75w~#<7MP6zE`^8os$7M0|aTt>$+}FZ8VTvP5jHbh_oqJr2 z6`sjlV(PmW?`&0f*~OU1uzf*?Q0|H$-`JIukSdL?At9mUd5(3VE#)VfpdN2$`lzQ# zqmKPcL55+DL5$|2(1X*5wu5Mzt$Fq584 zJ2B>ji&2Cd6PW8LU{3X#d*US{eZfw~kiDLl;#?Qes5scDNzo2I@(VDC5hv(mM~Xb! ze)4Nh<;dJ5OZkS=2kWlzVP@ePRgQjHF;Pzb=iKdAthD!ul?iXbu`AAxGgVT+G{omC z=)f>d4K2bsGQn&dY&k4c(d6b5CK?OF38}!EqaUs>4Vpixq>ywb+K|VtJXeP}N3t;| z*em9tKHj*Jv!14qHTjQ`alUW%XX5^GB`f(Zg z*-A<}SLZlro?oNU_kVw*u-mR%M59;6G|mqsn-OW!?YnHL zqrk<(1Cc;XLF>eijG)galQ+>R+h84fn2vC|%s6=AP9YfV9++G*U}Z)MuIMu1k(y5Th}JNxI{dvQNbc~%?Wp5Dq~BGdXem~fKYM45S_^k<70Dcv^B*Os>l z%K|T(>6;&|Z%P#--MalxYv-hA23|~>-jZDdMTq%2Sw$>LEbWvf_nd`_R0`BIj)L6{ zBc0)^HGKL+i#uAO%{7VQ)d0QXek*SE+(0i!@PbaA)jJ`q&EI*A@d(G#CIodS`q1MHf07jDQ0$vobplE20S z2L2^Ep4388-Xa&bmOVr+E`bKL=}a!f!VE=L1}Di7vi>ekX+lwH!aH)6XTA4ZE@7>d z*7uu^Bp+=kx7{R1h`)U>cl%vI?_5||L2m+`I2#O5N$0guUCck(2vJMkor|(6XXio9 zE$jdhWjKSZiTo(aLs~lckFA&gdpw)4_Hl~FFU^fSZA=}p3x1RzE8_!hgYUd!bo65FyOaZHKTX2RrsLH)8= zqpa~mlk76p;++&Cq8^&7rFA$w1UVoQTwyfubI{&N29u`nn|tCeHSYI?wX=1Vpg^(A z2$h=Ve*JdDD0^GV6iF2cl1y#4+Vl?GgqIQ1rvgxLp`ebREv4|ts(|0L2r7aeDNYU! zokT8seL-8?Ou-F1Wa_ZsJ;aP4K7j+x$%>z9qPLU%#T|C*D011bB2nb_36QY;F@U-h zAQA{d3IYPHq_Bo8?9i&xO0N=Y)Y?&@p=Qfhc#L~kK_Ojyd)(bjEt;)UNk{TpBF0|& zBa};@%@esk+F5SCfJRMZnESvJ1+DgJkDN{ZvPh26jC^^4E#zR$LJp#B^v>#d%uf}A zh{~Iyg{tkZnDJO@Pp~7%k%%RNq!6?PG7N7m0JLOh=;sj&1x#?w73zd|@^bQGypxF$J!p+W4|ALK+eh(@VYx?_mMcfQR)XA#Bq0g7e%1(_?Q|qOh@o5^ z79?LT0rbdWQA9+E8BH{O^P!3K)E8Bywi!{G#c_P&F*yQTWTbD>oHYnJb#>?XkCY60 zn7?KBNUD}1zuK`8CY#0>a{ob~+@pvEQKRYtzqc{l%|x4GBzpvk4H{CYF*_R@*Ve{JO-Sr?x2up7a}5=e0f0hNPxOO% zM$LhWg+C=XeVnY?DtZWRkNz2ciVBTy(y^g$S4_OPooEY?$OjP9$dd+6D<|93C|M06 zrsZ9h^7^8)<7;SSH%*Pk(*$s*ohv#cc$>6?+_Q#%G||$J zKd;7&r8WhKov`aWfJS#nJb$lTynpk3)=i1qyjxkPi%5hnXYlJJQA8z0qpEljXNhrh zFqm3PM;B#hDTJX6JfCznD~?B7IwGpOEf*!F|E6t^~#)QPC=U<@&gNXRcBB01*vk{raLmNqTYYz6)bO={8?=o4fU*^-@ z^0`rziy3rHazRrTUf|FV^5vbBwigTjJWe}YLny(s@(dM3qAg0u2xV!0;LEu<*~F}1 zsLGYnRWc|#0aZjuLTB`0-eRG7vO=w~jO%5b1w(;^RRD&_Me>-rcuyQYl&4mG{v)lq z3z?TiB95AVeYD7U+R;WByL!OQRqyk;QCeNx2UX?)itGaLy!_()In+l(mMKk(6p#8^ z#@<#s-kB`KM^Vddsfz%88<};?MUyCaKtj>QYk_VtJGv}OGeJnQa~+oQ1M561(?on- zsou-Ve%G`i3MjY7kfB);;pN2a)S44XWIJ0onPwZj^kP0v;#3j-yMNX`HFyY~gKyNW z%|en?LZppU1%5hN5+Ni;D#9497gr=jWsWpw4s{#WkWG>*B(xc1N^5|e^8SP9xk77f>^%h7$`5x_b(U&k%Z3|i%HNp) z<0pjmvdR(PW=M-=vd4TS9!+e-tFY1ZK3ue-8%B*NaY`sMdnp1!V={_zxQco2R5pL~ zFG>xNw)cV`KdD3m1 zwq~Qr(9&Mu#dGD!((}^WFVIA~U!a*QQ#m9x(tyqyVutv!zeHfc+^i*ozTA^wGzcJ{ zG(i!!qQ?zDJxp82c9Hj*pe|+kY(YN=JAK)dSXcaim=E5(2=|F^Q+`O=oI;KJW#aj3j>^ox{82V}v7oau6NQtbyOu|C zE}E=iA*zs+AOk$vQJzYq58nKUnohDW$JrB7nlx=<_Rk*^qiZ!zw4@1*3mT?sBb2}t zh=TYi$dJZ#aGPyyp%KZO7mfeZ0(85~gS2m_E`{b^$l^jVu6~PYH;<1vS{MTuQj_CR zW>Yhb?SAuC2%#z3xF2c%Xf#7Tv&LzCDy=VpuE!|>WU=!1aQyy@mkqYSsExavEBDw| zV-VhU9LQ=pz6l{EF{mPvjlj@hI^AqZgoh*K{;11;@~g7r3N>iiW$Rw`>?h~}&HVj< zL@(}W(>4AKbSh(|oDoymqP%31e9fCzo255=EBI*Cd}RThw8eI69LY&Ey6 z2mIF^-g39sp6MA#jvk&`d6C0=b7gdt!ot2n>QV}n3=Gqi84gag2TVEn}e_ zykMkkQH;o`8RXsk$*46cv|2p;a&9Y`rs=jxa3{S7>RxlWn{ zE&EgF4}}+3uj9?n$2hx(Jv?^Oy2osyy&f0WlGAl+0}`zuKwwctO&6`9fkeT66h>2B zUUaNQgdKe3Hlsax6cKF7aq05r5$K~Rowx#3V6Mi>8B0ov+E3-#hImgL?WkGW%FDBY?O4slsy`Ds=~OqZtW(|DF%GPqk+<0E1D9>hDDUN z>RSA5T)GCfHcbYf@FKzB)ku5^ylasn-$gb$Rc6qkhm_USp?@MD1DUd0l}U?xmuPZW zwvF_PaAW@&RHpwLU{36}J)W(XU84Zoh9#W$3S2s?Qtw*ClJflr!}KyMfY{Q$1qzPY zDUl*jNTgX{BxZuHqo}K~OD08KrLIQUY5)|OTM9F&G=*80EtU;Ts)UYgf?Z~z0s4-D zESOww3=Bq|O(cM#1e{X@vsE;;#3a#THo9f_kk;jWsODo1U*7ZQCpMve@8#fBFJKSw zi++0L?1Yg8-Rs#VM;wAr@Ml8pwg!fhsI!0YNFcn)Q-XJ4cvK`daheD&f#f9Nd?kXq zCfX#vERDITU80Z|!jzE3!2<_vQoMo)4e46&)LL%zBp`TAr?xAD**X!i^GDGbhX#`7 zZ}h+=0TW1RbiCNG;t@pAGaKffJWiz=Lh9CN7PCj;=jQd8()T>mS`MBd=vEfQvL6MM zipVJ?sW5cyLqRly+W7m}RN$XT+J6B;3zdFn7HR<7M{Mj+aT>f00!9#G6)4vPr$TRi z%VRrOkdkujbHmFAe^uwYRyCQ!&ad&4B0MVmM(OJ-RYN~k_iz)KdJV5U6^xNIjPX@6 zY3K-OVyRXgYKG=J&IQlnZ1z6<P)jeqNoq5s!p# zS0aZIc%pF?Cugzu%Fu7W@zMQ_#7P+1f{C=u|Nsdr(k_`u0Or9Ea)G6khgpGkKLj^Bj zb+g-b|7zhiz2=D(7}A%ulJT(Hwf{05&j}x8Y?#`(K@NlCWc@e9u{9nf=QR@|dFxTh ztqREAg=x0=ZIO-7YHbPFgkQU9qcWgp!!&hV#Kj6Gq?S*NfSuiiD{y`uKF7sXaa2Wy zr{uNWaQL%)!qV`0s@ZdUnx0@0++z=^{f;Dbem24Fq2HZ#U_+l>jPa5M`q$;`c?ief?Uriv3%5p#FcdFNbLm58Ap6yjRQ`6M6)vB9Md z57xjHv*q0U&dAj)+ua7N7&iIL{594215XoKVVce1u*FsB&|U|?WYC?js&fAQH&zmU z=ViiQ&}}6biTh!Rg=gZ?+N1G>6j@=YTN32^slP#0VvHzqdCpjSbZs=828LEC!NgkS zL)!&edP1bWEaSAId#Xhj&H1mzTzRRJGN$HNm;?}vKR+{{hcp{J6C;V5sZAS%?D>L` zlRxX`yEdaF{*jtH2J;$Sx?CKH)hDSGGWW%EDP z>syu7M@+J5>-mkcuE9AYEjb}CBDSQZo76C=Bky}?&3V{)*McN{KBac8N$yIjK3h}g zTtuG!R~{~X-%i6<=X@OZ1Y{_^7Zmf3L$u2AqEt`(Ic$l@t3>|P0q+Jr2h-dx?C+0( zp*)MJl0+TAwSMlq*?7<<8Z8*6bz1M(5PvT7=9DF{o*8i5AOZ;0{d`bMv*>0cr4%Mt z(x9lSDvpxT))-XI1Cdq>*=z07G6vD$RkIDj3w$Z@efrpx_NOeeDHG7q)^Pt2@P@Qe z2++1cSta1?11@%R|Lfksr2WU?dwvl$kM$~ngTQG6>*(d}Z=l8B*R3T0;MNL?Q=~q; z{V$`NvF$m3GG@dnY9o~`)`$(rY$4GIR( z7zlJNWBcjJGmQYAq_~I(@i=90Dg9fkUtLsqfYyHZMKZ-^^#uB$qs;J_&X2X*{{W6I zlTtegbI;dcto-$=sym?Ong7+{8z?H)W{jHQF`Fv&7dUJ(MFbjI;u+4oOCM-N>3biH z=vtfq@$gfxC6F|0ZneNF;Q-5L^K0Ef&pAMtPgm?Va0Mi=CIoLu?p>2#!LYb zh>Xi{5N!Vu`FuZ4Br$OsU}yNF%{(udfkLvjdGWCiQ&7}pm-c!ER`7RP(G7@56`hn+ zb_%%8bW8*-In>T9Rt1~jLseyZb+Sa2xe}9Xc&W75P!nI@!a4=aXpL}t4dQeK9By{j z=MtLc_cdBuj!#uf=8}K1>hF53VN%e(OC8A^5^$|2p3&4%q$Cf%Sj0KrYaMiPf*0?G zm{&dvp1@L)-RNcGblSP=&*u>&!MJ?a?V-|102^j>`u6=?^tB&442%8m8w(GqH8=y8 zHPP8(i6X~`DY;;(kA<++fD`o3jGa?pU&Yk%jDio{RvIvaUrw6vibELLH1oP~e( zeLw!uOTg+m_J!`rg%dy`b-XBsBc8S!+ldaxJPYu>r}0A7tiCtWG4|X?TE_Q%@Fb&w zyV|clZ4D!?nQj*H^LSJ-p$mMyZSv;*ddgQ6z}m%!*(i`~Uqr&^HHjVsUbm%Y^Ltq4 z^x%Kp+E(PBt-A!=qz8}cyA9>fbUxm!u+uCmh=WB#{GRfBWCviV4Vx$CcZ%9B*LURL2b9*im|NlUgcrL5`XE@C4R2QH| zh5KOl3OQMcdflY+drbI8r5~K?l>^nK&V;sH47Sqt$xK=JMMr5hQT^99GPA9@ZBo z`prWrJyWxdeb{f#$yjN$LJi>u%>L5udXz zksV|LIL5fzGPW*YL+VktfF$J3GVtYz7r!k7hsNcAn4qr+@E9 znO(78_6nyJJ$)imC*ehQOeuDuB(-05OW#jy?V^tBIN~DUW=&B)rmeciz(9Dt6H$Y- zkN}S|ndqc)8{4-hg$>>JLh5_q8Ms;i!!BhvD@Zjr2X^7pf=K%cG?3M(165KtD9aXS zE|_|8 zLK8==oAu`_jbH)5C+Uis1|r^^|60HoS=-t}LUjEN9ZugV<*c5ImAv`UoqGRt?z3w8 z(`6XahS^Jjyo7z{`XH8~0;2C`*4e6k?^C&Wbb0^1LB9b%$EM@wJ0oAUXf_8Y9~(m+ z##l*H3_M8YW_{Qmc)~>hYN8oGdeGWWL4#YNS*hf>LSB+EgMfnkeEx-m2=l5ovyy*&88^EeIy z90v%SoKH%r?zPr{nwr}C1Zf3jyjtY!O`ctIU@-6a*Axb`pP+>JWwdZF(^5$a0NB>S}4 zVpUBeX2&8r8WE4xsF(17v2&1q5SBI8_M%x+3yy#n5_4AcY1i}R!9%d7vId{ur#d>0 z&qydg?|`vmBU@_Rtjs6566P6COEotNCdGQpK+0zw8c# zA6fdEoa)`;30heLk{!C*mFOuUHx&3G8>Fw@W_gU3qBgn?>b}dp(EjkS$D^vCHMgVC zU4WiHNf99^V!w2`{ez2CHvBuS$@@^;)TF1aT~ep)-l}^PlIv%xf4_s9UpcXfXpHnL zbdT;9nU@ocx7~*Sa-rG6=jD{!LtfslltiJep++U$NYeKDnWXZ-1r?G44wW;{OOG)M zs2t0^O|CQOvCSlYn-n%xs1s=De)LW~0!Axo0vN#a&Tq?Yx)aWs=#c3eWV2nc| z4O;IRVA_+i(qs~=Nvqb*6x`>Oo?`BD11Co7Z$oxOh$E&_)i1`KgSr@gB|mm4_Bsv$ zxt-0UrRWo&1?>bqjIL2U5`Ncs7+~l9qZy1E+z;PHIjZpAJ=e%r7564IW{<;gPd?cbVqQLO-zX{=>`AF#!O z77(#<1R^$;+n$$e1nukgO5d48(^e=>l+WoY6IsH##&UWhU~u;>LOg$rUq)3a5UFoO zocK108AdFOo2&g_gB823ykp+_{=;|VdHBNu^VehEGl7u=$ix3PdhE9Gznj2Mix~|T z9Io52ZpEHGd(tRUR|9llGuq;(zL&=*9+}#(TiQe@dk5^i;^8zQ7V$Aru0&p8nx(U zq@Xdm!xH3BLFq$cz~PdDw2HQ-X;UN~v1Vy1XL6t)hZ4eNe>BB&N8%B2`*Ak;A#SD_p=+y=<3p{_kTC6>H zaCWnOXOn3eLJR6-}ftx9n`%6<*zjw2N1c2CeGvVNG@H@p+EWYn;MIA{1 z)MzV$Ko|uXL`_-4eFLHW(rd#reao#sDFQ&4dAqT#D2QZqm@u7O{4}lDuN4XXw+f2z z>*@rewu-iWr=;JiBYnvJ-YZhJ5f2s)RR~>xf;n-CvoHa93`UI9o}WvrIya?r_N~RU zw^d!8q_F-eg(qH{;|a4C#vXZk{;z>9Hu*B4jF=KSDXBb07CH>FT#&f^u)#Ln#GO8G zOYZHn^kN;CgwhJarRVGmm=7ro!SG+5&4yMohr#rb7?-?#z#?YK*F z(1X_era$}pyx|FYn%b^DJ9qtjcij+Xx9^uzY#8}XY~4bgw_o*#s4iM3S3ci?P!3i* zAB(;)ui0T+Iw6bwUoU>0ImpfanJOERLJ|vqkydi^wDDI@>?SQ+dQ4c-RVfiE8n>Gu zXsEnpobTg9oN4wP#JUxT*tn4{JF^{>Kq)DLO$&MNRCZKwAg&e!pR8!Nsyqvn1R z3Xz2e0zL@t(bLGmfHUB=-36L)zl{`~UO#t?juNmc@Md6VK{PDHU z)8chu(HBp#|AeAq3+;^2DF!M{CL7`GWP>pOG}j;2yvLFV@^ZBn^x9;QaOfTp_uzNE z6(m~dOBg^mGN;t||6@fmEeoRPd6L8IrcbN8*?jQ(vwh$H(L#10kT9fY>!qrm0`0$E zClveh6`ur{_Hl@OIgIlKpY+?KvGOd9{8(p+vS$4<>W#CA2~4`~nMUoKZ^QBkj@}Mi z`gdO+Hm@V44)0#|80!iB?k&mB}@ANClGRi0K5ahQJW_pUqXn0OFd}8lfnZ|Howy zw#ML{q;*uc)tUqkyK+F2mjHLoF+QQpc%q9^#$eM}j0k_UUg7{LQX-k#U=6Wklzld? zm7g_vO17aH3i;@P>t_%EdZm0KpqE%nLvvP!z&c|cAVVH+YK@UX$M0 zP9{uEl0-m8kN}aj>aqfW9YHK^_3LXd3@hTkvkZr8%s5CBx$yG1W z`wve#jow+>^J}s^iNkx;qQcl-Syl%`h@l@%z@OrxiE*mz;fRxpc9}hi+&PSs(q#T1 zO!LC)yR)K$p_FbP&nGmtSjM|Ct~avwVDCmUr8!n|o!kTfTImFxtBss|f8f!pr=`c@ zws8kM_kTRy&^hRKxN-;Na&8_L!coCrwtrQcdUWp(QrUiGD+&~;n~y+v2=bl06Un;Q z8+u3M^+0-vmT_pm|&oQbDN^?6e67v@05y=P$FvyD}Uw^=5573 zCIz616%?6Om^uM6?iC-uywof2+_OYWT6S#1V|U*7&kfV)v%hvEDFuc&1~{pE#LkSI zU}&>ySt-eXKKp$7KF>DN65Zf_Q0iW+vo&|p44;9W- zm2R5B+KkLn9c1&U2e>Fcyh<(>cIl^Mlb(%ZkWH2m!Y{T09KAZw(=nfu=kq8?v&B)L<+w0a{&Zl8V_A$P_ zwutAMqt&_ZmyESn%os7@5D>;zRn-{pbksvq=n+ZvbU?eT)#jphu^2k()9<4?+m20`gst9Y$lf31SUwu+$C6#}RGh#-^hJqH4 zjcd^&gd}UVay2IM!cxpm0;bKTPJ+0omWApvJ2QH}R-EZK(Q$Mz?>{&x)1>2mA8b)zwJu?F}<*=0# zTellzK;DcLG-N045`UiFys@xQ7@7gSG({MqR4aMJJN8wRws+)R?7RPINS?tAd~vjo zm`O2`r*}Lvj|uz&>WU3+@H_O6k;-%2B}fmuWnEH)dlLWml`R18>EBtQFu+-v?WC@n z|F9v>d9%*II&8WiX;NH6E=7s=gZ9VnVGrLMD3~J|=MR^}b886k5ZEYUF`Q;_aM28g zGo#{|VHT~C-l>$EBNLw=o2vc5*DL_|YCT)yYOk&Yz0vjU-RmidjY`ob5n6Dx6CaZi zYp#=(6*CQ5^CZ8W{(u0yJ)g}Nx}A?qYOby2+d-evZm~Un_j|L8>uLP^teNoMeLt|!cP17Zpz5PAm7xn zf5yh_7a&dUg~KD%&$wR&k6tlrHQ$!^n0)U$y88-8S!Z0PnIj! zfFKkQf(SlW^ZSnZM1~4f99k-~U-!jEU$oG-I!pNc`Rm{Lwe5H=CmyuXjEA5ItK?(Y z-&-F%R1vcv@@Y3H5P}5fI+*iDc0#qR&qpM~?+2HBd;RO)zf1>AoffxIsX@OD5x2@U z(-m-yDbOSRUfi^mC*0YWftE|(^X>OWQzcnZcZ_zr^&hpsLu`5w1xssH9V8I`{}F*7 z{9ryg^|^X(#Up`TyPYgIy--8*iDhX9y@NAb@n(zxUAxjSb|j`w;bASioElMd=M|~m ziZCf03xQ5ikhKSASd3Kqqn>R6zQp&V_Zq2zUJJK7p_TM#Gm-IakOyg4z8X^1RGB6a z$^w|RJnk|@%xV8Q4(XqzwYv86v2D8z7u;wDNl-Xr5sVn}>GXAK8LM`)@pI9kkM|1L z^?P~MyZY_o=JBy#C{i9ijK~m6YxBzm26OkjsiJRgt(Swa(^k*UTM&)c-ak0Azb0 zV)@7evGRHzn1H8)E%>P*m7V7Yjm{lty-Iufn66#5s8dpdjF=lGl4@CNJ8ew!LM1~@ z&5HW;SP0NWpxxqeL#WKvTaj z%=8jVQk3fUI6ISt@OOvxYpY(8^U?Lbuh+2Oen0)Y$N9otGy-^totHH9M>1M!(@jfH zP1M-5nnK)+S@TI)g-KI=FJ8JxnV(wL%z=5;tE*~iD(fmMDk9CF)znZ|(*%BKrl%f- zA`d=^IlyKLHXgUIrAlOjSs;+{#+sRMEKq2LLuQC#tj!-z68UkwZxVHT*gns3kGk6I zV*c$xri#UN+OJ3ie7#;&Tl)yNj7Xf%_MAq!@wWB9HkLp0oHT8`y&=aE11pGzh4oh_ ziLH;1@qGet11YRuEy~Y~0Px6RNqd(MLSE2cH>uw`$#VxNDJ{4vsy@Zho>hX@s;YBM zDrgtuoI4OVtEPXRFNzdjxqqc!KI6BQrhGi;-o|#)PQSVn2AE2I7oyi49&Me+FD>DJ z^Dk_)D)>K>m#Psq0a0Um_Teoee^29;QJ_B!Veh|`$8I+eAu*`9HH!t51HjhZ%fl|( z<}UY9P1j|MtA$GUXh&kSo8E3g5Gs&1O{}Mu@SOJ6>bRioWT&zV_HmpneX`DrtJMYJ z^8QvHz3OcCY8pOG_FM7>aeA|RcG&h0mVbYEd#JNn$|S%r_XPO+-U!zF-*Fe@c5^_A zX+q6jc-TbcrO&?ZslBhQ!Gb5MMlmP*y!8`Z`Amdj5qS=1d~*I=t+IIQCd%{O?DgNW zb^!~{2&HA+TY+l(x9Pq3=rz@O*#vYslT=y4)86 zFdKi>b3ER@LpG#=_jtK$v%P5lcCu}mUxEQ`N2CRn>*iOwm1fpg!tmGWqW+mZ)9>cMi#BPvw7Q@ArIw=%inG7IdKJ~o_k2|?3i*GJRqIu+)22az z8trX0X#xKckX|U_T_L2W)ck?LX{y9 zEq!l^j>=(ohi{vDobrEvy%*1dzeZ3A-e}3pc%yOa2gl;taZB`&l#1IdXg$C+os=rY z=d4_#tLieVA9I?+^mz@7WbV%I(t6qU8UD)E9z=0YNAK_3$(@Z z0X{<5>vt^nkBiq)eJ!WelSArLakzhJ@Zjynp9;d*i;*cY35j?zOG68jKi0v7jGFvG zK6+d|#qX}K6FtvDthHHs_7Si|(P^+9NkE$wJPA;Kx8*I-Opj}Q4CNGf-4C;x{WyvB z0GoSb7F+dPc{bgG{-fjCqw>iV+hA6XTTMtZI92cW@fxAZwDi6<0EpeJgcZ^k9c)o% zj&$%dXju=Do!NGH<`08E+iBds+dVV*eyHv)@ArF#tH+8~aiF5AW11kC>F`;2Vetkg z4W!>Mx{Su}uy(V3Us5?et}8eQXf2t}Z4mIE*@j?vG)O*S0 zkO7P`>q^uSU0x)_QcLX4g>`*%bHvf&%*kD6>$_EG$gYhxk_iONceMT1SB5xuTa&lBYz$-NEpZ>dfG!n(FekFoW#I`Qji ztU2`0{%x`3e@PV`Ufb2GKSJE36vetz`ZEM@q&k2>izlX823#{RD_1sH7rm(%MU|#E5qR4;< zaM6bKk^pKEaU7nuvMOhkBQbs9l@$#CcZ5mJNE77UFl_#km%TF$LQiqK#*@111 zpwc)jv~)ND?hm0#cv7X?U1)I1lnYd=$i&Xp>ez1zG4K*)5{4Wim?RWtD0<*RQ#|{B z9QAFAyfWUW$C*J)xDT4s_k$I<HdSjZk*lA6 zl!WY*BqCSJYjIFulP9iIXC-mN(R(^HVdob9E?`R?psEE$(gBsy%a;N}HHB#NLagMe zpt94&F>(R2Uc~UKSBraCb*dOE$rBUcnBSDhYlf5N}!~G7BkQ z?vd-qyUb`ICqHjO+ZcA2)dcS%Z3F-pOHhA4W| zi+Td8*}ltlipYh7stG_(O^R+>#;~&nb0`$ik0YE*n}6WimX3?z@)REvW;<}gyGS!O zlYB(WbU*AKwWmQWJjL(vy&QYnqB41>S?xiVwE{KO66Ax3(jRoA1$V99{-~7JcHd35 zN}CM26B~Rbi-(2IfEFXJ=Hd3uYeqaafEtT5JsAKrClsmNOVjq|#d1qL4mt9H}af6EB2lEMP&0^3}5`7&_IIFyOPAZ~xjOM>9&ZTzj98Q|Av7oo?<#wh=zFe24PWF6^o9jFW4T5Fvo#7l3jWkI zu#weT=PNQREJ_3n>=ynzr4q}-n)!b|{C|dL6RWNIRClw|*8s45C$u#iIVKL?qL(vs zqGgAqqWN;BI@p?|H8ErPLFO0;JIBKrw%d zDGNgs1#Pb>T|}|Z))_@pJYmQ3E2Eo=fzzWbRcI+U&=JE%Jvd+Ud#_x_pL$=rTy+L` zUijX+CV)9iP&@#rG({T8pN_&J(=J;-aB!w*p5eQKHl z9eq;QiVc$FBC#8lepgG4UgqTG&q8$N61m6QL;}gV5`>r z5kHVAd8>rtJeq4=@z1JZCAZ|EX)}p~n}bb&>zRi}DdQ9|SDoW!YM~G{#{^3Nk4hE0 z1#e_2);5%#?d!cd$Qa5OPTy1Nl8)@PaP2^O|9=3yKtsPYEMsW;P-_87Q6V)WHLV$? z%}7lO0W)mf^@W26%E_!$RVg_+x}`9|OgwmW>TqQrdK!sUbdkluQoOS6aO*;=O=94-?IYnZJ-Lyl`?1DK6nE|`IeHM+5>K=%V(r@%BR35HDvbfarvqR!oo z^z-%~DvqQk3#%IkNC;&(P?Rg9Mh(%pNkw^izO14;Dr3oj07qIo4GtqEw)4|QV1y)O zlvdN8d*$j0Se0F20`yu@fPZslRa^@h>%|gf@|rCZpd3>U03%|GhzP>2(-=9#X5CZC zT^sR8K4|_wx~#g>*6#~}%_5Z4_J`B3473VVfLMCW$g(hNwRoa5NWM_i0*|2MQCM%* z4~me7#uNd27&c!B07)|zNKFh*JxSB0M;Pu@Jw*@c1sH8=tHnjt8OZ=krAU$xBqAA= znNF%hmn5Wglh4}>q{mSZfmo3K8NjCSCRwVbwb-0BX!qSR!JH{?dlItu0v%6asZa)= zwGk-XI<4tbZI+10U_ehX2#^qh%q1`|OOJ`sHIyk0DVp;Rt!G83Wp*i9tuh8$f(*Nw zpp!yKNb|=Mcvhw`%M@(s1`F0xGOr9Lc)>G4Wkya2I3^J34gFRZAo(Hxvo{R@f7qEtog@&L}th~5xkTnalR7+-^%+noHG*rwL zK&D>j_$_o6eqD)zY0S26J7LmnsnBQxDOYO>>ads^ZQBj2D42~THY!SaDws&`t25?b z0D>BSsT4I&C^{}+2LP;g?vvT)?C(+tWP6cE=~Qr9XW&J5E1b{dlqCOpNQRb-%t@*# zn0&u_ymeedsS5go(dvG8^hhApxGzMn`wi#C+A+`u?6tV#&?0>+vkCNN^j zwY6Mb9h2Z(IhAYHWu>4IJE1v6#)#1mrES0jKj=AcLm@&3p%t8PijNY;4q2AHk#Vd= znwO|+W?jG!86L@i1Ve}CIDtqY5T#t^h2)|M;SI3Q?z~X*uORILBDX))P9uhZ3ePd76c?OKNz~MjMcM-~JWnaiN&9|} zNz;j5JCIN@<64b$nwB{V*ejTZ7FIb6lqT{z88W$0%9Y&3Y?PHK%o0p9Q{~_2#iy+H z3cV;S5epQ_*8fYyT4Cj>wD&>IpykcArsz@_7O=T%|CLfveJiJqlq3_G!b)y|0q>+m z>jq>djwLhldCKP@V^aGKl%|cw#lk{Odw8 zOgJJ52-3VvyC~TWo|WK==Sh9!kuo*3v#tO}0~l==!VHcc?TG00Vi089Nq~1eyT5lB_G@piux2Ht^Em+lenvi77NU{8wqV;a+Lv zBwApz$JAnhC8Uyx4#_%xRJRbyUE4e51T_vW<5YlE4lN+8w>7fyfG6gXpWVV=KcVQw z6M4Fb6OHN(1zmBA;`+b^^0zdpb!)Yug+m?1j;6+zcgz=z&R{vHKSYVCX**kp+dE{` z4;v+=des>i5uE+1UXr!6yc;cl5`9ZJzw6dXGUs368JY6Qd0Fe#ga3g7(b|P|8mV4# z?o+KRvOi(;BvHRq?1P?pQH1jHTv-{5DDNCN^-&=UV^GgB=PAnUj1j?JyC!Nx!D5&` z5wT{VGjq56Q6cDOM1(XLF_dWwGZK+r-{yP+dv| zvXhS4D1mIc!5S(vZ!)BL#n7it{fCGvyRd<8AIN{fVKjO)iz#bZ+Ite zkPE|Q*9W9{j23ua6r$y5Y6Bw3U0EFIHAjl{>Wh>RGQl&gPT=*|94ejIU~a$J1Fgfw zt}v&C+~?G!T4b9+%S32ro$_;P(@<(Bvojj}AU%hWWHNd~5VQmYQ767R;=7^(vhi(* z#F&y&A;M;@ijXiL>H@f6^4eGQs7BaPhOv&6%hQ)n;fSSvcxIK6i=4`lkvXFi?Bq(; z>rzsI6<=ef+FdmcAr>U^K9bZnSx777932ydy*A|S#ww+5s$MAwoZet!ul*Lxn_t5& z^g^gJ-qok3!rD^3DzKA38>;N*R%v3S{5-#E(z;E(3Y41Ls`bHEpZ|1n5(5ZHBJg|p zdR#FebIAw#_-X-f>Oe2MfubC8l~H*)s;W>?Nx3o>IkU%rlC64Dz|J`Wh?S!@6=UVk zD7V^SpzuAbWTYr3z%*L0m5aI~_9QTKP?_kY{5+ms6d+owC}tq7 zSV@Rh`^SeZft8Hpu`qAO8QsZ~i_W+=8(@5FFb55D@P!N|u-&NW;W^X^QW{z^Y0UWD zuWx*lw|n0gdluku)-XWQ#Dhsg_Qtd7p!b#-;T1RMH~=QN+J`nv1aU~&j?ouc;Uj<4 zHzuX_ZX&6U)xXO6$i-~w=E;NL6(d!*f9hhmi#t<?dWhIvHF(qd*eyjCsD<)X@}ii!%ZD35cw1l**ERo7-` zvI&rJ+z9nVcfg7~*JU_2Oq-Sk`)gGCj{u~-XGi+Q*zzwT=STJTL>t~3?kKl(ogN8a z8OTV%;Ak68kYIozt-K|Nwz}h{EGegHno?ij#weY9l(YS9^d4P(C=0`(C^dPsSURIJ zMk;wdaNhH*`mIUHmOQLV;7L{oOi(z(nG$xA*|WpU%De*6U$fi1$%S#TqcW!fFeF1r z)lAM3-GkX?a0U13vD~1W1RZ`CMg_laJDRl?(nYHiJqK11T*uz0~1;>6~G; zrQsvJVpLMG`XtBB`Z8fvy;@Gb5*wx43Sy!rGB{^_x*q+dK1cR8EA<0CpM}$Zq ziny|IT-Btetc;^b3UvmfV0|^9jU2VIDGZyjOA=ZwjY7l4lfgc7_jfq5m0V^cR)Wlo za_t!sDham|slriNf@3pprCSwcr6!RsrD7Dx=+V9eHBI`>dt+d047Gq@cIZ~L;$SwR z1H>e?Daf&bR+R}ZQVx^H4Yd+r(MUjU8<`6QQ#u#YXSsR3FEu3vX{KEB z+SMI2TWu2Rh^f#!7^HsC2Vf;R}_4m-u(?H|g6bJYOk=aG6>iJ3?K*xHq9&ubjgkKbXt@|r<-X?-g>5wbd1FL_xC zNo`t%rHY0OExeReKxHer^sgirGgH6;d>AsH|BpASek(1he^9L{wf@ zR$eYED&z8UDFlm1Qs8p&bZbt|DTZ6U&+vs;G-BUIZAy0`e6# z0?e6eN~e*^QjpfBCMz4Y^tM~~tuvOqWi$J4mV8Qjs}iph{j=hWh=>J9s##<H%@{YmuD^oA^!8J&!W!@=p{^)oebMEC#7?Mg$25^bwyrYSy0ZVb_ zipxq`#(231!pbYFQyGe3Q2Owi5L&Wi>5W*5PE)Qt&QKS!r)XL(B1E+}fjk_i3Eq;p zA*irNo+_p`;#$d{(3H%K_JOIFu<^RE2@xepq-SL)sp8Cv0-Ets!C7l+N!M0r>Sax* zg!?;HBnzlu9RK42sXh%BTuLm_)GOpo$$VZ)ot%ZqBFO}zGdMyEb(s+a6EVSt%;-}; z1fmEP<)X4OS6RvBl`_gfos?mNHkgg_PNWuQDD;JqnQSmOnnJi643HjmZxRQ+GIPO1 z+_~*#0Xp;>wUk1D0o7(FAF-Lz*!(8arG>4dp!^}rn0=)?=s;N1dy?S!`WgF|;sM@K zK^zv+l_UT&+YPi(OuP!rBe)9u4u(VMqs)CzOQQraW^%C7rV4rA5>40#Rw}!pG3Zby z6$Ptw{^Do>oyHfpNhzD^86`TK0IALn8pu6-TGFAAd@PCEHx0 zgGo5q^f%O^GCNR6#uTW!l;p}d^@0%e+pji*k~5m7)RQ`LW_CEM20P1=&$GF5wp>hO z%fo9~F1quq6DAxnykTXnLn6T>Br!

    x7sgkSjw)1sYV!%JOQEx>b<@b6lCK*t-b=Sau!55%>)Qq#Ds7Mn+e*l|*VIP|6U{uOGO468qOIlYsf0rFTWKylGN5OVotp&w z!hHa$4mov0O^sJdox&qbln?-Bl2B*2k~)mtw*%76Xs4MM4n)w0XLE{PJquaoq|gHK z-P<8GrN3o$R?!^02i`TFMUo}#(51=dKT>CYYJDs$$E1}ob;Xoh@HTRB&CI6~_kG&b z;gI7N{k+V7(z#um^T&+bf43dmw`{Sly84}YU)=h)DKES=$LqW?%}QZO={#0;o1aQ9 zhKf+iVo(p%`nNtfoIJ^@?mt3{!%a}1=ZHUdF`YxMMxLQwMiD6W5d4RBM7=N zK&DA!NdI0ZA2bxe?!CI-^Zbn3e7p%T06;E^YF~N;K-K=oY^beGy*Hz8z}vI$cCX%a zDFXw~xctp|U!*Ja5;bjDHSd8N+O=r*n+va>{@&b;0@YL9iZ01pRMjDPGj00JhlCti z{n6IT41y4X%ga$wkt-{Yqnxy|$9g0~rNP9?CmR^LL$60BoYrs3a7zFHAOJ~3K~$z$ zlbU?KJeSk;gM5sue~0$#`N#z)1v&LQ_Hz01l;QY0d5%#JE-!XQfAL_`_i3n`1;ZKd z%6oCHs@JKw39>CwCPn+u*Ds}H54%%a$Q^N4KSivbQ@enwm41?`yJwV1W3O25WX8I| z_S6v8hrSXt%Vs^?dOW{c^h3k&rq-H#zWo+0nl@|@m{Z_A`}X?B#LF5tr~>fgFUwmr zZoKc#{r26t-$i#nH1UzAlYQA}&Y3lX>c{}&an{>X!cCPLe1_6t3E2o|&utw99EH=u z=u`!O*IP+Lc-@kRO0kTWEMKW12ii1mmQj()8OtThSJ;P{IZH~VGEN_YqPr#%;@DMh zxrCiHDU_BDo`=czzx;OIg73R+)$W;DZ`a0gYU){nFHU)N%{8(*bdVxJx1M%1fQP5Q z{^qA&1Tbf%NhcoBu0^xIPJg`~60vSN&rZcU%$^qRwAQR_rq@b@<+K}A9RN-QKnj5< zLN15ON>o%J${`Z0ZXIM0N$rgkWb|=K09XVO>;QoA!+-n7Q;#B|o1UIpRZ%wXz@Z2x zh|N#qhY$VZDPxG}rpeQ)%FD(bI7D~EYN<|R2uYF|Zd;+1it3MaYb3^VWIlEw)HhJt% za?uaVSFN$_HK?e3{POb~H>i4i#=p+I_1>RWtjtBxgt4QpKJmz_Pde)9*WUbc(PBkr z?rhNd$wgm|`CSc_yuhOyHedyhI-rpgnwM-%tUKlFi^J z3uiW@1y6?hV>*>6%)rtWt9l-HZn`t6IttUA)ivMFbWs36e?1LdGOxl9HqZOMQvFK9kJ(9|7#yXS+o|{W9eIYtOs) zF}DMPRe-Cy+*My?v}d30i+=uP$c2;6yZ?y*e9h((JvWTOwI)r~P)nl*B=w1jV<0vc z-%C$3P;5dl1iPPJ43T6=$*Q2fGl6Yeo|HA;DJ254eVbNH9g9$N~u=AR-70 zqyg0~@n(|{gJMt~h&`P6012-no|d3L5)|uCsmiv+kJku=-`qkPX^xNqztL&ZO0?tY zAgQk})2mZhNU+B#?a@TOC!zOW^TV4M;Q09+C}>Po(u9!zmh<4HCcwAs9I!>f)P4dBX$ zC;#}1Gu$(Qt0*hG_v{l0IP=bjm#tn?5_pM^p2l9HY+6ayP=qwt`;sxSlHpbA`Xn=o zM1qLR%BiBFth_vqa#Ec>qp#vKOLhzhW~r{P7o7B%xb*a_caFd5zE$hiCqPX5S|`tX z_xM{LSiNpTW^Kx%Tr$|QMNo6oiSqQ*u4jI@6eu^=PmgD z&o8`u&vVnIRNEm~Yf{YHZrSGCk^2wn*R#VG&1>@ckG@&-z)Q0poIWc7^LdB<_J$Ki zU-aPQ$#1@Q-7$ym(W_gd%8Gf5e!S_KX^+10?{ps}^Z0}I8F%2`o!hipx^mTHue^1| zqtC9dt~Po)0rqe$qr7{T$^VZN>xgN+?I5M>>l3s!D+YwVag(Hfamon?{pOmJk6N_! z=ON=SS-A9PzkyiFCtsfR`iGz9Ww4g>&b-g}*|E>oZCfW`G4z^%!_%*oxAXPqmaSUd z`oJSEI%@QB!-j6vy5-`Ze|c!?%h&$(@3nCp3@cId#tkn#a?~Mv4A{C&tLoa?55D~7 z?kO)mHvP3E8eVy7*{U_IN1lAqnBm9mx7Su%v{<}s`9m+ge(j@EYGVnK?0m=?D}Z*R zxHD@MiCJ~+@NvV2Y}Kme;-8m4^y16cKKxW|>}yxNX4>NoD=S)! zINo0%y!7Z%SDkRgtxr9F*6j}z9K-(+si>K?c~fCa%d|)U_S?Dd)ax(uAJ2Sm?$GnE z&ZuwZF$_S&_NK3ki2?$$>xI&JJe1O0;QUwF`d zU$T5<+tH^cYQE~&(Jh-a`fTA3w>~|!&Td^g_TU~J+CTr+`%k?3W}TV;+mdp4z;FxW z^S5#^$0$?64Y?fWax%)Hs*)=!@==Z<%-wMu#wuFN%q(l^X(r)xet`LjmuJI`zN$hJ zVjUmhY+HK#wYRb)z0*>?hKycCFe)&ENJmwu97LWJWNq^qd?@L!Z$$=}QJ%}ac=b7Z z_w4~-<=XWCcHFk}j%S{*|1SLwx%7ruI(=?X&uyk&b6%sW%2n&ufBD1GHqDw2+J4(X z+iyE`hn`1Hx;MQL(X3H}S(7eY{L6|NAI$5qRofl9ba>?4-?wbs=(gu(nvMWKK9*;W z7<$9;qrY3aY|V!14qLRCFnU%Lk=7%3OT7}6jtD|}2#sJo=+hA$Qz>|ncDTc9YPCDwaeFo2X z_rpe2mBR<^din83^y<=a^koy(yij@Cv}pFmT@$;sZwuh36{{LIs2tp<=ioj)2lnc5 z+Aa5_Yrp3B-yOF1?la!|xKUNr@B#fVKl;#Kowgi(#cjs&R_Ak=xSLS7Qj^TeM>~Yq z{C><~d+$DD&WDYvDu)l;NLGVLPjLp=J&;&beE^*Kr-y3e7`CFUj%?p)s|kl6 zw0ix9Q*ZlAy}DT}1%{m#E1Oi0_awAOVLO#$ikJkEKv@};=R{eVtf=5zF81~StDD-w z8X0zD1aypxw^qrnplg)%UzTuN4NQ49Mqnn();!MN#pbP-K=CPJ6^EjOKfR?58x~6j z3Y|e?=FEeK?%lV?55KHD;<`Iu`)D3m4(-4F;}@NN(10CJ8UC9;Jv&WNI1wH=_ryk3 zmH+kdGZUYBvAQ+}Fmho3$1gm2%wD@bG~ z*kGp~+w?wq{Mrp00QBg%)to=yGHS1ZgZpg%`bVEwFm4%tLYMY!-~Zz4F<0C)f5AdQ z;^_VMzVCw5#~m{4x!G?|d;5LA-%T43lmgHPLyI$1p%F=*#! zt~l3YugQw^xSw#o^8EMc(0i~CGr}-E*P=K%!c8Ymqv}tqJNO8I( z&67MyU>(h#OWNEz8#1OKrhxsVYCdwv008IQ`}k`gf2R656gA+x~y?k zGxCmFOSSmP)y-#Ll*OM`D?LB#laXo_N*JDg^TsL@6xvzoNB&g zLAh&>t_SSeZ_WA*?|=F2*N@yI0d%#K=WNP@%4Kcx{^gn?pqvmzBv}8CR6a@?1X3 zDVvL>bfScqg+2JigcMj$rUA%lV-(h`C>=)4}E=~ zUXfv7{=y#tG;h?v!fiY8-j@sfK1r5yzgxU@>y~YrH3MMt^A1Iq zwyo^0L|wTMD*Q+9%}7VFr4oS{k%!4rlC_i4VlSPM3*^bPN;hjFPP(WF_V{|3kqdM( zH?IJSKyuB7ny(fwiHJJ1*<$#hU55|a_3}SIcEtmaYsqTFhf?2_|Dm!xcl+5V0hsvM zv#ZuuL*z)1x``7qCg`(ryqhJGtjtP_kH7xb$I|=-ivYAWM`{4**rruQS=q8xt3UZ> zf$Fk){_6W5pE2s7ZMJOZ^^r}T-@z<`gE0R)RcBMhR|pK^2hKTuz;@eYBK4emAA8~7 zA0!llkH7g2X6`XCf5GhueLTdH9u*`#8I-`xUXvev`q(f=FiY^A=XDhl$m*Bw?tl>|Wy zt}HJDuwu=6osU3FwQ)TAlh4EBzXd>TTQoaz=)i5ZY+F%YuAcVn*d9QpQoLqE7&^qb z?BQqbe&N**zFL@2npUn`=jl4UV(mHrmE~p1Q>wvI-L)FD#ewC3g%VpdWoltr7&EoI zBK20qvQnK31KHG){URe9LvPVh+?y>}Sh0Go?xU%1`IvUZ!G(eUkxJl?gHmRPZmDa@SHrq;iR*&L!l<+90?%rC= zWObu7uDE9X2EPV9Mp3j8!n#34#X$r519<<7Z;zdH*H0@~0oZ4UUVr<;nY;GrdiJPc z*FXN8&3xyX$2YF3{KG>}DKT8fvR?^{f<8Z@IxH;_awspO@-h+;sf~zi z7?71T@O&*~479-FGQ-LC>Lq2v*ehW}xPt{S)}fV_?|FICGR^bio3%8GOg$DB?^1G4 zLbKgvs3f9t(8vVASz}Z!a|)vw>;9i|z|b2`KB7TI1}E}rD5loE|J8!`zgpnN(pfR= z9SP+58Pt(Ox*G)OZI{}pRf||e#ys*V#~Vub)6WpvQ5nRPQe8Ll#s^Nel?1YQ*;F+a zAV#=cYD=i;!C*-`K-$ov8Bm7REeMdHs3y)&eDs+PZCZ~zbl6EF_IvgHPmHEx$ca%= zR`%c}<45l`;LAln9D4D@+I$QVX;noC0zm+|9HeSG_Wb#tNYTS*!S*57U%ZZT>PsO+ zIl*t-kl`vQ*c>iT`(8Xr5UC(LHaj#7;c;SahbG+QFtyvY+1N>c|5J}GgE1+5I|xlLtx+0QFikGb~tm220jhcn-wd%-=A z-GAOmV~6a1{o_;A!PO*yVC z<47=+H4<0``e1!eqi8Go?sCm~HREf=z4{Nz13$oKQy6^iOCm&jL)OZZU+u zt0F^0YJD?u&!k|M%&`$FIx^N%@b$sa&Z(_rCj%szV$*>14)9Q`L=GVg?$^2F9cLVq zkK^NR`tvih-d(A5XMwX0{_QO%9u9R>DI26XxY-S@KUm4Jj3Hx{AH<}h|CuSydk1}y z=ir68cGw2m#D;Wq1{1sF<1sN?thwnY`&)*Y4cP>FQuN2^hu%h0t92!6hLy^hQZUt= zZY7I7k!gry5J6}fRVUg=w(6T;K;NLEHmXt%%u{B+JMPe7eY$qm?ohjdfzhmCgJ-Ut zut&e1pDkFt?-`dZUACM=q{*HkS*TOxI41y*ltScX9J7p}Ohz&iQ3w{sp-nj;*5bRsqP&&Ngn@uYrN!lE>^BRuGDmP8_^ZSBsNX$%2pz zAB-&3#X}k=AEXmy^Z>wCty%zhYu*=DA_4&OOYeRNpj(G_cCUegF&9Pi9tc8_+tul| zEgUivbi^&=rQe4c{N_s*$Kf3h0CP?Vk)nl=(G-H)>k_LeEv?)RWwnitQGdz0Op!HE zj>_2sB!nW#J=HnLU=iMXU{Pi$n1}?qhV2Ac9emm?bl_8>_m^DKqHnt7`x>)hpKS zwF=N*UtL{qlmKd3S}IvBbhNfHn+nlSmR267+I$|U@I1NKLFUHcQ=()>FFbO>-YK%7u|O97-DsB z4>zu=1n|QzEA*8_q+|5A>(JioTc~#wBii7khJo8}>nk~fdvyo!&5ujr4%3mw#VXZF zknYwci+SM4VZg%?(pW_*Y)bs@r5_%>^=T6EfI}? zVU{do#4*Vj%pd`ZAaWd)AyG|_*zDj5HkN>@P=nde@?|;ZZ6|qN&{uDMOBqhsON@c}LJx?7I@aA28bgV@`Ed$WIb4O2r zQ18xL1Ni>uU;N2$AzQP41Axkk@?hAKvxWhzS-&1e#D=3>G-c#U6v>zFt}4qMGz``}(?h0?3`^$sMpH^1hAj$s8s~ieHGti=+qPwsMqYPl z#K4^ZeE8LO*0@==aF>qEJZ&Sg6~HIPHz` zlNDn|V!$}0JY`y4+Z#j1@K1mX=au#^X(sM}3|yWVW~goRl8vA;L}dD)Z$u^tVnM9J z;_cj)49OI$quR8&FNM%@(efb1Bhz08aPvuH25!F%u@uaE_v!wp(~bu4z|>dC2>1`b zSqR{u-TIZO_!lC8M()1TkUrZfEa~Gy3_*t&On)q9v7x5+g5Mp`t5XME=b&9q8~z&r zQ{H$NGKP%7lB6UV6UPdx$%_1qUP+|7F>{x8C1hk!j2%}E1U-A%N=Q^ZZzci2Dm1=F zBP4YzYcsj1=O<8VmO0@}eGH%BS3dmY<8Kyj)vCqc{%}V7Et-K4<)YIM+3)m2_5<*j zsW0nVnEQ9@{Q94+*>Z~(cTS!<;=*g!Rc~yBblVoPWB$y(O$~affxpK}` zaIS)LA`M`SNqOY2Oxr zATeghz^jfs48WbwP0z+?X0qMPcvZOX|M{eYPB`a1D{5kE@3!YZA^k_6)vfszLui2u z$sgW#gS~}dizZC~OgL=#$p`GCp6q$vmESM>MHT$;?uiX6D^#UhG-(Xr!rvWu%CI3i z=LOd;UgjOU=fmZFVg0}1?8Y>J1cU^HTO1`o5TriD{EtsPzyGc~?A5pD>o;DuV$C`L z%^EcT@a*h4_rCB7t9V7CC;#=2RwnbabWzv zniNs1$Qmgj2vVPDFC`y(`Au)!cGW?<^*`{5{!4yY(XwgdvM2&@`{b$rd~=SG4cNKI zHccBgsHx2l8?fU6yYG}};iIp<9X{bYKtf6hC^re97o_!_ju9jg>}hn&oN_>=lADZY z-+uqDJ-h9&ZI}6v-nDf3$|en~l#BANXQ#gO_WSkP3uwrL0YFM6jwON2`TjxPdRmGT zAA9!D!MpbDy7f1Y-?{LopPM#ppnSa7KmN=Yi+<3Z3Xc?@_}DXpuG{Y7BS)Sw@&LQX z?&^pCcE{uwQk9pQ)1(s760nfcifmdcITGacTd&-9%XaE}MOhBO;NCrc{QJG?$<>cc zzT??x8!bKlH07n6PC4?)%g(s-%;WQM4B#JczIWoy_u34{-+0e!H~(ReK0Utp>n%U8 zT-~s$qN=gtgMLt2NMB|9J`xzLiBRlH|3SHOqe{EfSNy2+mRsd+P-aKr)SH? zjaoL=_IOz?rzZ)}wOyN{IU`d$8E6fZ)>%qfw?C;TMCMQ)6N6)QIsr(o$=Ck&{438G zdBBnT?$K?lb^zvl@y-2HU%B`BmldM}2_mYguG#Z~>#jQb(1Qo;IDYs(OINI(`N5~h z-Tc5-Tll-Rik{kTa7w8Oc+=C<;#i(?z}{_}H(m7eFOR+Q<`sW^O0qdxi8bKnB1h9x zH!P&@3nc%&KjBpk?0)(XxCaHmPnGa`6TYItl@v=^EGe5Kryo)(1BG9paVTSUr>Ntr zMT>hJd)8$~jXGq|&h1+^U%P(8oG-q)^Vw;W|MeC~?Wkp2NqJeWQ@hqkrJq->(jlFc z7Z4nSNr0Ilq==wG#}F||eY`tZ2g0b7%OM}LlwrTfor4H0`DMjUzdz@~BS#&w$8KA< zX}zJQ=HH)we)p8APt157NuPwpK>D$X<}%)q*h4OM$3eySWrMZB(GSr zcED+uTzb^V5d(Mb(0YsN+S=K3KfCkU7ayBB%lU8Ya4`dT{>^tsTyp&-M~>{-se?Lr z3_v5TNeATh{G0ELxa8VPjvSqpGlVDIR*;g9JXJqa#1ud<+3i}XY2*B7n? zbudpiTDudXb>|+88 zBg;}FWe9k8gCa4F3ywfiaIpESPpH=2kuhXG>3=q}zz9ISROa7xW#bsboikor1<8gB z{PZQBUzoD9*PT29@Mg6BlF3SnM|s$_ZB-+=fG>i-GC=w*MWpuIh)692NK5nj!VQL$ zkOrUrZW&vT2R%RpL4qK1vaA9`h$2LhUg}m#knu?pvw&3gB1s#e8k@cs>Sih0K=@Ft zHoJg0``jG6LqaKhdXCs71(vMt*ir<JB{Zvk*K*D7FN~P0q)Wcy1?5hS*PL&x|n0evm4fY^V^NhM5Jktd7P) z*y@?Gv1-Sqe%0CwxotOdhD*8`PDYN{^E~RHS4$k;b%V^T-Ib2Z+uRxB9P}z98Aw9m z?X13FXOBHxN_WRd8^x8BTm($C3`h%h&9j8syhtE(L9Oc%A%>BflKn-zBxf&SU>s_l zS>tqEBGQM%YH?}c2+`v6xn8^}oR;ZXQA|@#Q-%(}$BVrcD&`_|e zy*R0ryrd4Cu7l+@|2w^}nYlW3W;e*+HExGQL37M(7Fi~#a)a&b2z;D%chi`Ej)~_?kBV=| z4VA3)MWaUPWG6oW08+K3CY=&Ks$p{@amEZxF?SAV*H}nwBrto%4=Fj}3t?TtT+ZdaPY*Z_!L*&)Wik8r@=^kNmf!o)iNDUzGLG{CxZT0 zpKA)YVV8vjpp8X@T0aMRBmiOvNCL6U#{_}^BGwmD2u7K<*$|nPI^&klfdxTCI>1;O z3zZqjZ<6G&nn@7qs=k^-EBx>^we3~eiw<+FiH9uS>aXJ`vlEeFU5sKE7jKS4PLdY~ zyEH{s`wV=V+%$PpI0XuGvff|?CV(JQJx))7k^nGVcGJ^lXC4_1*i`?PJn(Yfn3hhO zPF|dVm;=o}K@R@juf#C=&K&FKR7}abLyh`QLa_F` zvU3EvX0@MEvr&#&2z#`$J~_tMF(O|C;abjXTBhix-wD8njJoG@`ZMp`4I z;7igfLZT;|kEjFfJDl1Hm{8Z8Oq(_?te66m%Z2m7oA0cTD%IN)$*a?M_!kC%y?DDa3AK@h>7FHC@PU8e1u%%;7bmza{uyTXQq6f9(&3q^IJB-NOmO0Evo z$&EA$>MN8TPb#TehZpuAWQeA08z|L$vf+|rZEUj!4u7&MZ(e~eCF=im1=7YPr{brv zQ3zg!!6z5Zw=v-88grWK8FpBhW}HThFv2%8m$qT;@lgy0k%V4fVSTU-IpQF%x;i^* zSr7Zb`@JxIaUw+H(=OX75WOoPN#DO}u%lKbwFT%8f$9{&MucjIs&H*t=9o3!PRJMU zsk#P>q*C6KwUJRj5_Q=5YxsbNv1~l1b&ynz_2pZk7%tX$0!~;Ss_;`_&ilwqD_99t zxe)MdbT5A9^a1F(VaIFE*z0IXhrvK7|wylZP@@E{46s0(yvS&sajTItq@Y z3RJO-z}=eRf?teEAH*AJS;jEuIcoLW1}1o4tN>>X7rDOa)ePenGQqNdU?N0K_Kp1PH|$g^Qy>!Xf1GO|6qkW3(%k zL_)LTP*!ErN;nrbiy}tpA8B2RQ@Kf-{^XOJA~H1`W<(RsC1*3)=ia2?^i5=H(A8F3SE-Lft#jy8ex05L*ah5; zp35GPg_9pOg1{8^N3|5*QoxL6KSSZ-nR7Dns)&pOC|APZ7EcAlsFDrd8#CyvB!+gV zvUXi2`Vz1&)r3dR<{u*_EmvVDCN1-UnHqZ4NFC*6=L@q>KNfgh0jmr6tgWU3b8MSR z;z%oC0RV#a!Fkzyp>#|VplugG?Mw{z;cD8G4Da>>rFL5~WV4jZR-a0$PAT}jHRB-H zrV`3#O9dlAij_%q+^fWh18w>X(x#!_Sp;GMAz2Dmi_IP#`k*+v@?5UWDv(90Wi&;b z#zoJ7I*-&q=&^8uKQBzwnmQ& zQo32sx=ZkmDn4Qi0L{F}>RLpIq9~UWQ7$48$8lVnm-)O|Z`QyI5wTU)3<&}zXe^k| z|CzKY;`did^#jS@ykFdQDV#%76s1*hSF!#fVNZNfMVy~XyNnF?vWk`0GNlzB7d&D& z8oT39+54+OHHYa)XxdV-GfLVB>;HsdQVdAMM1l>2Gro;VMyO^>#Ka`*vCd8d&}E5?BhK(yqZ5GG#8HBbldd=jZbdX1cU1~i6(NqyY^nUd z&g1D+jyb2ms-y7$5OPQ}<6;V0Dl$i_ld{;1>q4mi&0@3H9DDYnR)rae&3WVMKvb5H zu`$0a7}6Ec){?C>txg-IFi>ntVC7bPhT<^PaoGFU%b7Kky+Tfadte%MFaRKID)91U z1MP}r0FY4k)9Ow-X9#abmf|287E`ap0i-2vZ*X!^7ZOpfESD?GiKw==7LsK?P9Vo| z!0`A5OU)@d`HxAgx|l}M_t|JF`n0Gnrir8o_AMFZf_5DC$om~YV*^-|$+E80p?iK6 zBv~7XYD0t`enHCPXDUL*+)7l-MtipRb!ca)77`4wiJ{OmCfIr}l+02RQ8JM}{LysH z^USHu`;tfqB4S}gw?&p}UB@W0Wh;6coQ?-4ctck>h11ws39y%jm=mShM8O&BTW$Pe z4m@&3%OGu(n^L|HCZqWT@)OxMi`H3kCFK3Xp_%COTMGU$`F*H;R>H2ZHLRU>6$1=O zEST8HMIs20_JXq8%SfIYPL2c&$*FN6MyxKDGTMn*P&A4T5h*t~`WkKswKRk!G|2_HK-0y=dbW&)E4$3Ho3yz3fLq zDDRCVX~KcDBTHBgtK$Hau#ICEh+*7YW`WYQ!pu?~Lr#pWW&X{jr6n{3BYiXZrjm%H zx~mNiBQr{+8jXqn=0wFe4!L|@{*WER1S_Q}D`4GP(P6Et=^-Z}07xle(UCC1NH<~5 zQjp9-2cRnFH~A`u!#}$PA~Q|cP_+dqTa)>fQo;tdIz-A~-Prp7`^m{qb=$AMO3E@W zEDcG>IL_w*NQ(0L+Bl8_|GD}rB>)jcWo2a|ioje`T_d$zOc4M7rGm-FQ7+?YCUFo! z5i%w61=CqS_xJtlx~-rhwZO$Jj6y2mY*PUcQLJb~xx|ABsJMf(Dakt;BOwqN>@EMP zq!tL(+O-#AXKYOgCXiGivfAAxh^4g*j1!EADbmpS+LK;EGP|~=wih`At!YZ7j5j{E zNw1oEeYXaL@dqjos`b}ul{MB|!pW%%ZcWR|0K3P75iW_i99eiy^@UQeikvlHIC&*4 z4Fpo({Pb<50!pi|V`_EKNJstLhtMoD!`y~OLI-3Dy^RmVAPIZmi-J*om`G|}%JUz@ zfQr}>x^5c~A=#6YtdEg!^Th&Ry1ra`$|6jM8K2m)$WHZMWaUO=Rm3dy0L2oXhP zxhRU5new%;beEXBo0z<*W@9nZPRp$J{F$3VMja+rQEuZ^XpkN(n1v;ax1`JEGQt*o zF5^tsaQ*}$w7`UM64dU{@E~^#-GxemC5$i$C!4WsECHEt(171&FlP>$h4p&rEao^m zE43}3H9XGt1}fsz?&~LnioZP(Pn|Faz5gWPN-80dC#}4mnD68f5t*x!?KAQ?zD0`A zOJZi00Bp8zhqKoU$4E|V|3?Dpb@ncsY!WHU%w^+Ww}X&b)YYC8a%2jduBH0xkd~@V z?GRNyR0yRi5UGo&B|t36(v2k;(zC{lg7(1My|l2N2HhC~*c>BeLFW)vzY1?JP^l)6 za2KP`-ziui37lKLl947LUxo#u%j9%8K=M__5B7=_?OENk&lD)kOj4N*a zB^G5}R&U)}N@k8h(!B9PY|Nk-G@5%cJpWHx&G-+bdhxo9;*|UXcw8$hd0Z>Vl%Wum z#EM1uld~I6uKXK;p(PU~J|4?9-zfo*=W?`=>oM0MD{K!n%><179-9ybAB5DgtzH*( zve+a+BhWOhzs*vRDD_EaD>#1S6(lntellmz zl8OvcfQjJxO#Q{)rfDZwLbuAIi4;;xO;n_;Q8EGrC~z>Q%d~IV;;i3|@Bp;AIiwI+ zsxa9Y;9Yul8$NJXdy^^~UhTABt>3UE82}`NTIZp}G7q#w^n4JWKi}Ll3aJm>_GyO6 zr+|=_vT;=afr)8YU_#qgijGJ@Zfe@FcnWJ_`#%F{*RuJUBM%5GHgi98p*oJ@Rk%x! zZHMo^OIZ|YCgQMCG6@#!M>chDzLcyvyCpqkg&S@q7ag}z_tY}XK^_LRZ1KdB<9wXY z=i_{yV|_)ML(wJ*DlfI)qWM`gU1M})P1o(%PA0Y|wlT3LwllFcF(JH7(n=UMN^OUey(@Tk#~5wfpmas@T0aG2q=VVW!GbW{h%2aZmG zHHKE?kE!@%ks+H?Y?8uKPhkcorWnS>rK+tQ64e(kY*N&jggHV+9O+H;lD5k~bXw+! z3Ktd@1b~yKcrbA0DVx)nZQJzrW|Uf4CV!#@1wWW=6rKW zOy#@!r*qA7pzhi4_xWom%eIo46JtZ3&SUJ-&jQO~u~M5#c)y3(O^B(VspG@Mk|xC4 zvqle^tS+}%x`Rp&PEX87U=7W1mljo*R5g~=HJqzjZR3&xc#NKGeph^F>b*%K@Ach( z)EOq!<2Oe;nJJYGrPauJJIS@@HeB+}gsbr^PQc8A)$0JWWSCpg@uw~jz|#IOepq8J z3)0R0(ZF7ZTp^xM4LVy>YUplTw;-4rKiI4&d1 zPA0(Kd)g+J(~EFaGm!xza{o%zn4N{on(W_e$Rr;KqmcsscBKDZACr$aC=MmoQ}7pN zz?S_blg=+-NcPPKER)W^21JYMc3K-0eOmT;IpuKU|A@uC@&yPCLg7E@;$OamWMsH9 zXrFIdzp;ouk^QIz^}f!NKSiRBKF)^dHI0z*ych&DX9>Eqy~BmWXqjU@REuYPDG*E!rQ4k)#s;IJ7BYwBx^?<|nn;EV9affbbY zL$`+(`=u#1qeYIA_4_uS?`hd=_|17w)9RwXUdw5e#ZII$Awvu4EYT3_42I^Gj$it0 zMh#$_!R2#sC`7<(k$PagxOsEl1Zw1*wK3rzZPL_`PqkHJ+PLB6g5NkT4Bq{^Q|jC9 zPqA#%AkVxN5Tqv(%TFD6L<~Vs^?zcp@$l|aXoGi_L?n9XK^V_ps z6e?idFDP?;bp}-U^8FHZX+BAJD9+|4_0O}*C;#OIm8?9pf^h06kYJ@3ef}ZH3Y|$V zr)HkbG@^6FC8y7XuH`3m_6+M2!4qF2OlLq9@>hy)IkA5d+K;o9Q5cr&hloF!TDTtR z-SEl_4Bf;y6VJIn`Qxg~nL2}Wd`gv`eA{&>6X5V?#Qd;6pXST}I z7Xgk%3lDanLJ}-xHb&oV$l`^Ikw#I;m$sh3pAKb-79U1~jyhxSdd~51dIu(TIQ|h^ z6Ma{*WkaTfQMhNZ=5wR`AIB^mG0$piW`ToarLu>JZKKhkR>QtK1s6i0b9++Z(CY!0 zapaW`0#q`|db%dO(B}M_Y)@72dm0dvPX^tF`Ie*Ymz`b-(Dx|q%-*2gRWG5h3v9XZ z>aljy6AJ=Dq4&93L8vvkEe0ac)Bfo``KZ-y@gB(c>Ez{5S;yBhB7g!#I)5$)mXaU>zVDe+?=K~CD~g*Ag>KH z+dHRQMSBz;hESBS1Eg+-?Zt%3k^8>@wRRe$HxrlRLNuOyz9~V-B#j6j&eR3zfpSW2 zb@Uh#G;Wj!Mz31!iMiy|(0hYPPj+(S*$Mv=XsTJXX^QkHa#e!^(lGLV-Xw{%=nri- z4I)WcxWOo#QH&$fI}lfhMOvC(IwK@%1EVIVXvBd0{y(CJ=kp)EwHEDq*Np_M%6V!g zW7J=?7m1W~>ggH3ajMbBR_`SKo^{@wS?WkuXNS}fk-<80Kh1{v1D>={>X0m*JjTq2 z-ESERgwtD;=Rat(ZLva`^U@SCh8~IYI97`3moZ1DAQR&W%bMK>m}1K$u&~I2eG8H@ zT2}O>k53IVj<`#jCa?L}p0Gb;&?S)N@mS<*cHH#DT*;v?jF1d~jBnNwI8!N1>Wam~ z7a)xEh$bVo6W9|2fN-hfnYq5uTyDT<4bPY}ZK`a~-<>IwU%VH|Cs)3xa&lL1rjoIz zTh$X)u}9Gz-m?|W)(`-KM2+gXYV$0>_Ksz3&&wEgMXPI$4iT&M<+~BKzKULEuKR4f zUaQqnc12kVpdbl?jiv^T#=lRfylz# zel}BatOX^$#12q>8O^9rW?3}tzJChTn_QV*^f=Ilr(tJY%ctZzG8K8t7#kqU*mIK{ zD>#=PMf5gTv0xj^JCd@({8AIqFzA{=L56tQ71O{I*=MQo$$(n&Rbd@|>q0e-6PXxt zwdIyMRk>81>+oc7T4m^vd!fK@(OW#Bk>$MR6MV~VJ%0^yM&l9`dUj&CWBTK$gtL)k z)V6^{rF!gFnO8}iKik8=Mv{}L4v_k@rhB^fPL8Gp-s2Era9n1K*66=0Ut~VhgNYhg z(F)f^aJ96Lp2MgGQH%lwvVUaPR=OsG>T=?>7)<`N^uf$r_>G)Mnw|Y{BtPP+?DdVE zyXtH!%dY8?b1^(+++0gQhnhs*D`G=DnuP6D+ZE2I3rkfS%kx!A1C0{M ziJ%KQ83@L(-9-tx_X_2>(xYwMKOKRP+#^U|Nb~%%xb>WqFYlRrIX)-rGXsp==Y5HG z?Y$-r4bNsbnAdl4q^}?|bUWD$uY;-j$cjr`9_g2_x=8XlH|Dw(bOV{4{QeEOG$Aea z)@b!s`d^c^Qbz2IPqa4G&b%$>cbY!`q%h+c_rr7u$U{8! z<_gvXE+avxZagxsoa9)w=oE}9(ch9y?Oc#RQl>*cNSOFF7B%p+!iIftPrAJ#gCp85 zr$snTpYMY)3=5OxRGURb5p=x=YDIFdTf5p@5r9hWyax|<$Sg8Ofpm%`22LR69``f_ zq3-1fFF$n{ji>kUMh>R?@-I>7v!RQG_Jn18!|RiqEX(8V14RE~OtRf4g1}Q%1$ti< zD)j1DEWHOhvh$aD6ozPIGeh?!`+a0Cbu`0xqm%ewx<86TBNMYSN03qVQ!GQzQ3ehr zNl`?rCW0d*tXL3~Yy=D&l$ZNTqT^`c$d*?_Pzq+eDAc7`E$fXhG{$Y zYIMN~X7Tsh=Ua_#NU;pPr!u=zJK?fd8M3vG5{*OdpRo;OmE zRx}fThs{F<12Uh>`?b#qA$ODW+9Ig1?|q)kRpY*YgPrT)lN$<^K1JI%I(Yf(3s6Uok*w0-?r7pZR#onWhLJ& zR9$C&-&*MPbPYy7?PhyE9a5 z6po6#xB*Mu7UM_BrbD^G*#xoo>slmrJxL1sAO#!76u)q*^Zf)w= z&N$sP7!YMV-Zq0U0hzHbvQd(Z0_NvEUeLzuA6NZ2gx)qzQSvxz4bpql-+cYfRHi9M zXcP%JTmK&mkjyCX>L$Qz_wbH?#m{p0u+L}TZLN590gwZ6k)9<5d5d*vAuAqO{`Wj~ zc6D+;L;F*Q5*b8Y7ro#16mpq#*SkgE2wP6xr;fIcv-VF05xd!zlNM9>;VKJFaz_%! zu3-TgTvqNoX`;xuU2BWB+GZbDoa_3Y39K*GVZXh<}Ey}^;IZAy*i%QA4O z*8O-4gyizg*+N-6>baBuiTQ4I6T22gm|9cka#w;KE3ogs;d=hB!_>vr_mT_Y($DD7 zK;N5VvS7lwoei0g(>3?U249o;p$9_G*Bt`W*4;F2&PTW;Bc2fG6W{U&72=jHP{)83 z*ZZ+>E0~8aVd@zx3m;^_Qy3Zy&m$@VW9J9!$E=p19s>3;6Zi_(F8$cNqIE+v~>-=*RWP`!(X< z8r$FyUiMrM9kTdpYBk!epCACI#azKk-lhP|!zIt}ksjmPjujfIre8m2X6}0`=NnZ< zRFH|Fw}ESyHIvsJINFr{^*%>27{f9D9qHvFE^KsdXy(Sav zX=7H!-A%#)omxsnLj#D2c`S&tg-7$azUuwp7)r=#vJDcIwF5m`?>_ldVrTc-DV^9J zZ*;_^O6w?fsyL9q4037IGD=^1>qaVv#E;b;l~9muVU2$4=X~ZBV@{*W+9KeP>Agpj zsvt+ljob9u7ckZJ@d=^hBMQD0)!RPqA@ z&uk4!A)#s8A&#v!yU$+CSx1vK#CB>n;@6xwhzR3 zIPIhqs@Cf5`ESJ_3$+<6$-f!6H`@zUSJr6lMvF5>XmeWbXFS%`xvZ%-+V^(&OdQq` zRGGJe33MW@B+`b@B76tC$s^G2O?>6YixN$VyQ zp${*Va4E~kiBzeu)IX39;obZ^Qgg9J#A?wxV&FTu$YwT50#NATr8Cemb`^vLAklqC zUNdeL++)mmyAUxGbnlB%(EUAZ?{@Bd-KR%2{n~2U)*35R?=$hO*6;mfX6ehZKcN_a zOvt}oi=8dtdaSR|%lVe>H_4e@FcFKN8Cf7%+RJ;H(y3mphj87ZWBU?&_GR7oxS_yr zxV4t+I~7p%dAR5P@cO_ofd`>k?;5Sl*~fw-764}mMjJ;?LM9AVfBs@1hOvZU%69X1tCwOxWQXA?1dicwdc$wX6QIGojK5pX*-|xH)B2@5c@ojGN zBdkcBjfnfJ3B;iVQQ-FnsdLL~%1y6F`#S}FPdto6E?@pNr5bo1`Jj@pe5Q0N^d8vx zgEs!#I3^%lg4mor4bwYFdQUzq$ldNyXKvGX8ipx5DDRCrODiREs^g*`)W70f5n^`Z zrow);jMQJvdPyr&(<(SQ@~W)R*;HR zjDkBgkR&DHj^#c+p~>k#>}V#tV^l)+)ex5ifO|-U6~V~v(6s!+x1&qvi4DZ&RZqV; z9l2YJ;niA6fI(S(NuQWD6Mq)jX!vWGkD>$)Y8g|f@>J8U!0n~yf&{j~+mh?NRHWpE zh_l{#bVlq`0L;BU=SalN^qfa1jexTuX=Igj!``1+#a zpTCy9rUA4O)qc+!0-0`bvN2>*Q#|IV;$m>$6EIa710vuf^dBl{(jfBu!P=#i!_lE2 zlW4xfeg{uLqd01^NfW#Z9p4aW>^%0_{DPTqOh2h{IGry~JXKv7EG3GGh671KB@Iw3 zNRCp5a2v1^7d9Q|d~iWmEVjbJ3ZyNnooWs6_*!l9ukvFb36+mpIhPIky>Cm^bE7lo zeNP9b0=nK5znq35?N%ClmnN>x-}mbFxS!VN5BH1$p|^bR0+56}uMg2T7CI~^VM0DT zu1NeDC-HqgbMv`4$~Kxk3frx@Ds0%)YdDZ5PfcaNUdKB9Da>aJUb`hP>6DmVE^7I% zJRZ6sM&y}?JDM%nAJQc~Tdf7nCx<=G{8W?qS1(dHn=1(goNJCoXDaNL5#%U z|En`pk_Ea#vP}WPnH_If0UvyuWw*magTJk3Ap7pIw#JW1dIUp*+Lo8h8J1nQQ7*q; zZ##cpF=)c)$-98VwK=)oq0_kC zMu(3i+}b4o%$Zj5#`f6DBW~OZAE&_V@*<3g|61xlUjzfakF>9SlzU-CGB1av11*E?L{0Zw&$In-MX;C9m&v}rR{{ol zS}OOl=!TuGZuRY}L90SqYnssMM*idk#H%`!#_$}ILnbg#=D_gqO_qQf6CTXH#$Z|@ z$Ghm~1)f?B-9m@_Lwzh#+Se(YJPl?<^iL@ndHKmyT@pW$&#wA#IC&d-lts#opdvX4 z`Kw)wM1!zVth30!&ZP%rtv}uQqaF6gD0R$&6s^3&CdB{-u-H2#!g4hC<4ruNwYmqA zejlGBxhlQ-NZW@YE#^3sOIgn+anU}x8>%)#JLRC z9C2=GM2`e?Ud{@LyrnW0m>2|kKF}`W5;6d6PpSWu>w9am2QxelQfL>0tlKR$fQik9 z-R{X;gNzn#GO0Njp8?tuvX+mc;M5nGbpLj;Nfi$ik>^i5glKa4!3j;F`$8#ji!Ap& zY?A^4M+Tb_(j_!#OJYp)X>m!> zIiIJ^o;{yxSJf|-vzCvV=?(Bj`z@$E-TDHuCa|jC@gk%nJWj8`9hFjXEvFw%j&JgS zC2YF!C;@!XECK(TJh9+7`yBS~Pk!>bUGO=n($Vp!1@HhJdp0_%@2=4THwoN!WHM+D zPRe01(HpX8)r8ArfPt~rg}iKwI!Jpi;_$;G!&yD<9&f~wgJ=Ll!}B!*H!vE50-9D0 z98GP{!-6YLhBu?g^&7gp?Vj5CBok>X3D#XZ6ZY^~J8?W$H#Y!wZ4uIy%Te%zMof;N zN{v{(`P-u=&uenqG7bwi4uo-WBqkom_U1hh2v!@b#&&S|$dKDzD%sqyWMtUosIFQS0p`mSv-dmP#mHs$*1w#F&8luLv%A z{wH@1CYJFM7A*lWzSryDp)F(r)?B|%7kvL)%E*_dyjKc05Y89Flkbrh<{h}9q&Sv-X;Lu@T^zy)X^bvQ( zdvC_d8($V>S3F-~Q>xGab#QT)PYE$!o=YJ8-zcrZERo$rkOhBk(*&3^>fZ7TU3j6B zzWmmd0L0|-wHkg5UovEFc&T*8s|dmTYqX_vU_(1)1TPW6nKI}Z91Vso8f=%<08k7L zi#W(eL`Fl!Wl)MG<%#4(WSyc4ok^#q7rC!>cZC0)g&p8rji9{Y7!ir-M+DIYd?k%AtA7w`m~r} z{Ha6V+XZCJoo$lMtxQ-F$PS9U`&;{?x<+6Fmr8vmZi^#^Muu;@)FzUk^VsbYh{Cdp z2A`j&e&T~KH+b3iYHad&T=M(7K3Gi?++0bh(Ftr8PMppCz8`tcM>&v|@%~IK=lkT| zucirgme{bsamrfOq^8Y33QbJ7qqyRCyp>yB0CvGi)|B+JyD8;&(L&f+`e|gEsi@nJ zI?)J-!78cK(+GyNJJN^noZx2A#qa-6q9`CuI)DIggJawZPE$VAZ6omw;Xd+w4|Ap3 zkgh=X9g2V$URQ+OkIN&~m6<^8`R313WH7m(tsd|A9hz=UM>=75kB_Sw#c<-%=R=>+ z`4%K_cyYRz^|E^{q4r(S_voT_GOds`*6+QaUpjnRA)}t0`I9*`yogFlN-pebJ*c&( zckApbm*0&j$koLf=zS9o8prP|d9);ySt?uZcU}fA_>t_xZ^yaBmf_H2cd4{Yq`(kf0g_bOqRKpyc^z|{{X~Sb8Ia<9s9>=H)k*^8b zf24+8iv~7)czu$QJ*S%uTD_U8u^EpZ$|BxJB_NKG=1cYH$dUi;6FRQ-{*OX&NYFuC zqnDlWBQEZjH?pxx?`H_hk&usP9R-z5VBQ3 z9i7x>(dbX?oi~?J%AohceT1}D0}0tbA~O;_j|KRPSXW#G{vv^PwoiwFK8d?~L1RMltMOCn1oKIX51fW5oJjjOj`!~1wB-t-MP9@eY5nv zdzgZ~T1qK^vn(XNax3vDUail9CN5!&Ei44)Z&3fdZn5$Dgv@?+XA}$d{^0O1>j;>V znVFfU{-}-oS#N`f!H-nJ>a=H8CCkFyvq_ytVm@Ed@ZHG@4FF(-`lsWY+b2X;^=-Y_zcj9_V7ZJ2JRT?GXOZ7(JO&<;Yw1?wAScWg6tr}5HrE91RzjX4PH2~Lde2?nyR$?Kql!<5D0!Iq!b#aI$&Tw^oE;VqMr=}IfW#3dPqIhfkD2hpdp4oJyL%2kPy zrh?T(M#*sz2s(o76le=_39yl~0a@9${r7WJdrSps1(Ev>Do>~$Up(^!q=ki;{yPkc3Uo=G8s5( zWPk}STPVePRX9l+JA(d3eW4bV@dl964;hxaW-}^LrbL&Hl zY{)v3F)FAsHJ4n83%J*=l@v=yN*pst%NF7epGn&Ja8;fY+)iJy+CQbl!Y5%H7GYr_ z9dQhA_-phH8AA%^EMeA(0dtOxJEkin*f)XCM+Suy?Wb;+&HTsHZ~K)h#hxxeN$s=5 z9VVY&Pf<|i5u-l_YW@3IIH1PNEbKAdG-v<-zb_5ud|w<0MC;6N|8WFAp>iCBOvvqc z+ZVovz}aT+E$DSW06~1=>(!bv`K@XT*3nkLKAX7FI!uBQZipkUXj+>R8}bmG9vJjC z5AtK43AZ+YCf-W3Kq1_Q=D+bN@n9qd$^|e>FNukOB2yD|X8;+DUIwROUlW!!HPgp8 zyOadRSt2F)wyg5a;dG7wfd74z+^DfB5ECB*g5=zDTE-NSD~X0EU&Z8Oz~LRp0{}Ti ztfO*-mBJ+0mbjNIvPsfX@Z^IubaZD{p3kQX{NZqb*%~tv@vxce1q{+0@mCUj{-bK7zEf5gylwWEKch4QORPI`p`47Av@fY{7%TAx@%2k8y-*x z#}peL(ll2(st0hTdTOLduUQJ1`*3)Q)??9C9rOYR$j6;(Btrt#toVO~lM67AV+i-` zQ)HIbztfHZW@jNZJ$m+wDsfM8vNYIO5vhZeIlH`P?}Bnu)k*9lSQ_+G@_Y0qN9DpI zCsVU5LK23DhS{rB1t*Z~*L(QtGI^wbu_ItNv{H(z^GQuY`rV#F{$lsZ4308!u*m$6|^b=MpK$vreYNFAt+@jpe1c@au@DV$jRM zLguQ}Z}uI6XPi0Os%l}g7UQZ^*McVW57SnyL^S-G!6=Xq0eM}adR!co?Pl$)R93eX z)G17A1)BZf0AVr40|n{J#RBP6v*>ieb2NbOW+RGsZz>gFYAGyCd%mpUIN5we=+jW2 zD7t`NNP(gxBGN(6*R3UBb**^4NLFJGjAD2Qn(QbRqjZj~5&qz3xu>4vA5?(wSw=G8 z98D7(Vy|HL_@ois7dJ(vSk4lvTZHf``7FX2kHF=!J)84t6(Y~Ec^v9a+e_BYei5f{ z+Up^tNabj{F(q5GQb!A^9x1Y2f!HCVMp&Lb1=q=1Pd= zyCW9Ac(Vn%Od*~5GVsY%r&Q!@Zc_*5>{|-TBqpsYkjH;Gu;E7p^{>K=<8H_H=V>jW zz^`-BkB?+o@G-&LyOFIYa0~rzbN~;w(_mA>WYYg;zzS)z*)6o)yj$i+Sq}I8gWZlh zD?K?m{lC{(D}_60i@XvGqg*7q+wYUp1^bpya6{k#gas(1&AW!?n*qXtVYoQov#!@(?#GUHg9*TqsuyKgWNR$R8hesY`4f z7jDxKgk(bPKDn1w<2?dfkR7SEU;wTJyx`mYG1cIb-xwT-z?#Nhwhr9ax*xWmF!LAJWdHd`AW=fW8V!kAGi%4|*|WU{D# z+2?t5DYIo?K{|);wEebN#_4dr(dR6c_!z;kYuSx7R0zM}NfGX_b`8|!WTNCnB>_rg z9?o5iWcBH&-pW+Q&2rUnmK*|pcsRILS6rga?d%)>y5qP8-ODL2^E=@k>sjv)Su^>i}yZHtU}{kAAtW^1nyG1v`>jx@6F1`(M&DZN0tz!$K`}V zDw7t0|A1!gBZEOtFPHy~fiEQ;rw+7<)@`~M+VLBb*>51$39`ByXJ&4wsi|1V4vP8UMDlwos7-mfPX75T z3%Q#gZ;Mx?1eINBwI;%L_Kzp_TK!$^756}?A0Qc(t->ORR6ZLYObGO^&}^&m{*VysW08-Lp~O+SSXSPm3E3y-Y4JX5*pOQ^>7(VK$zIA_qoL z2q`3-Kb{~q-4!gip1L{B9+sE17b|+ahDShAfRwz{_8)IzCT(7qm+w4DD=g4Mt%!){ z+zu8mu{yl$Wp}T6z9>B}g0V=4fqxr=2ef<)e2*$y^}7m96YVDPiTS)*K#!E@lgnj= zE4Nm2048BfV4eT7P3q74^iwB(-|`AVAQ}DryNymQmA`-=kzUVdefn-!n$p~1kB}b}M4%BSIs^f<6F>w~HoMf( zfYHP2+9$X7dA}_m#VmLLpwqS!3T7Xj%DmgdwP_&WX)>X`;Hr>o7(271lIjyVs%|FS zAnE+}M|8q(eKr5b#S+XW+w}z;`tP|r@u%+3&r=qr)+#NRr=H^@L$LYM1*e_(BKnlG+Cv%e%ocHm$ z?F-a*DqsGkfltWiYOwvzBQar+U%T%7Y*Oe>4ZE08x5v}vF$1aBoAotzkNS>6x~J&{ z+xf`1NbK_%(s1-GA@IZPKHT|86j|sETDIrQayKEF>bmfV@npHq^-OzVF@~t$Sh4-c z*5HTh|6>6jCmw|4->oPEX4_sSwtVZZu)jQhzZX75YQ1k9f?at->S$~@UQdJE`V+<8 z!!rm^ByXk--Ee5Z0!-nhkiZwZUEyWhGw*U zKBz4XgYj_H7CJJg4Q9YIRoN?%$4{lYeg7txs~$7aklxomfyqjZv)QT}P_Sm_`wA6H zJe(*oot}$3h3BnP3d(fdEl~Av{N1V)rIrV8%ZO)j+win!U=1cP2X={T89nvu*ndyS z@O+*>!L3}3PUDm%IHWjRce{7b{-Gc^*Qiq(;v$R1=)QBC{Lp)m)n&7=Z@LvUpe2`! zD8F~eu-f1?jp622t5N?B%3_ulo7)IokL*SZb-lb~sT|q*aiPI#?Odx6%lp>*)q;Gx z*zE36m^}15;JkCYo%rrKSM%z=DC>{c1GU>jt^0w+HOZc@bG_^eeGQRp|HNPP_e4T& z`JcvxIX#WWOH?l7n6wTYGj%kZ7Lr0Ivx!ROlzcUG173$l{%(e!k(7%uw#at%TU}RX+M0kLho$ zE>*ht)RW<+YYCk%f6N3F&-Ln8XNj8}w~Hf`FnaF|k(Ixseq7I;+b=;iG3b4#gvY8< z?V#{S`9_ZrEJ6a$cBs5;EROd48VnC+oYTsWHI^M2m2>E@nT=L)X)7U5VV8G3agYNFFME&D^##nT^_TXFHKGf>k{9|c4!{B7t?TLW z=}^$WNL?NXJN>VjTKR^nLaN7uAGm;$#`2Y>R_&+o(EUmqZh zv^`D0^*g5RDbi4+Fc00hz>`F4i<&Ff&|lCr*6h_MJn-!TB8bom>36xjg4hmtAZAa@ zvCK||gq`RExbnE(9+TZo!KN892LQr(5?!bBMg8mX)1W}kX1T=}2z+Vm(V~V^$G0$1 zEiffTBqvg(;P`^bwg(jqTIcy`b=dX8Ry~kmPj6mr@*!6Wo`!@NwAfss<)HL9+k~*qaZk5rS@IZ#ruAZD zsSp~ta`NAyRzyI}@{)osT*7=%!i_MH5U;zPGf&h+g<#J;LyY?KV6}$Vcb~i^R+q?5 zn~3&FVycD8Pj-nwm8-00Jf48jT0BvKRmeO<0p_`r{5&-JYeVXWu)lZTkte2m9%Zc8 z9lxeBCV)JZjT^g$mq`3Q37b_`NH83lTp=aQ0(%-#I!p@k&VhIn>O}i~m7C%PPI~_Z zyGeBtO@e$4D;ZF6H=0PfWovbFtZUn zb`v=nqnL`!gCuyVWe=H0PS%_HN8c`|aufJHR=6fZ`6ougR5?3C0jmq;(1xqyF4|;d znRYLpWw+*Y3RuVHyhKhp%6COk9laW$xB}#B>>b<`fsJt`5V=={XUyds($Km#?!PfG z5P3O1<&I>iS90G8#p*c+XJ^jiuYA>jQXq+`)pnoDks)G9wBX~D$wpuq&r6;8W0(Fs z$?q$2w#quVO06bwsb%zpT-sxKCUk1wkj6SdKjh?7UtrFp_j(%ov%eT|x$SQ$5@$~K zA8!Q5kZEZd$nq#QhY@(3#NphO&=4`zus~1X0zz{TE!TNqf7hU9U?nbJ_=KHqeT<<5 zn8oAJc35tTV!Mxa6&6(HTsi({7>q)cqt=`pA(UV zuxymn7#uP;WlY{4Rl~l^?VYFHvG;acw>g>G`13ZLR1cU&xK<_9;7ff|dOhzq8kJP^ znk}YJf^j{0GNy@aid7*^<$8pDZBR19`-`{U)_U;)O#R6TFUy?4*3|LXUzy*A{$94UZry8>B7Asya?Vnt>nPIhZj7&lHeiFC|&@u$%B_n`QxSqRmkVmq_VI&YqmEf}^D+P+N_qyuo zOx@_1HrH1nNbTe$Y4J2tvXQsPi|Qku(NISdL&!@7oJx%X3!??3lpXl|BbeN9_Ny!E zRx0u64$FUNjEyRd9u)+pAvle>&}K0rvuF@0ITiCOf&;gGbPHshDCq*JaRJAIR#H*? z(0+F@8NP$}Qs|?mKqF)!#AvU10_NdnWYb6OQ^eYspvX*WrvV~LMSLYgz<4rE%h4Um z()+tkCFwLQ2?VBsyP9q|UjE5zi*gu3Bi8q%gGqo#U#6l{a-SPc8o6Ci61Rp>Q8ocP zY6{nwgMlWIxeD?!H$oYU@~oZfvS#v@F70jc66UzZj>BC}@H3p?ucYQuvA}_<=(HG> z8uuB2+@99MCBo_)cQk*jGOE(be76kxQDw{z=y3TKUz-`%Aav#|O{lvA9-gOO{0xAt@#~;W0IDCuAh-&U+ku5(dhX(__Wm**Hx4Aqxte<42@MCuz?W2A~KJdzo`F67vF2EjWTh_-+K> z?EWhn3o|#KM$rMSWp{uF5N#|aXij1Z6@LZMU(|#=pxg`+JM}34kMV}#IQkGpKl6Tx zF3{NbP2Yk4mxJ)TFu{nC9KkzjNC>XD$$C32!`LxpdSNlPi_MPdPa$ZP2AWBE#CRT- zW|BI|30bCwHM3j9`j5qbR!E4lH8qBh@Q#}CQty0>#=imY;e6>Ke; zhe#EWx>-T9t%mC}uUU2fD=VwXs@o?hCZXM#ON`2u8y8pRpOCFZt3Ve5r>BE}&aA}s z6|Rn`aBhMVjv`|^__qWdsT|f8E9Y<7YEO#{T-wPiqM0421#d_{7j$TY^L`@$1A;mC z<2Vn}9#K38V>-agsihunmzc-R)nigDY93o!+VH4AjCIEVDbb1aLM_E5e*BQ zkcuXrwyzaqhvx4PtQZWTedRBZV^s-?mM)HXDTywjzCpP&LlsZo<3=`)5v7N%@d5Aj(a8NEg)h>5#~h({wv+r*E9w%hsjbLGmcGDE%KxZM+T$Y zir4f?!cF6osDM^@ek-k}}bhZHHQ(NUO`(nIl<$U{m6h+#@?GM%qIynh1xo`gR zji{pNoHzf_;>YB}h;M729z^Ym$*`?#`{D^E?rkPWAQbN8s?|qDQ84Q;;p)*Ygxh~l z|4De9+@eJ2p0c&Yr#qRbIzj`LbSB6GN|&MvU`g3zD3vQ$$Vku+XpTx0XfiY>PYw-n zifS`BD#BHVmrKijQwDUq-YUFOeRoBG!g8{1j|lSVj-Jc*rJr%;F^0oA@GVxE&J zgx|#`dKhmtRH728DLT9bxTfO60C^LhswRTF3l4J_qfiVvj>El4#E9QlOv=xr$4hk3 z3Gpu?UZ4Am6s+dj6A?ogL?D+@7P&4_7~w3zo;=G`S|??yxCOAvPHNT09w4X?TVFAT z;IUT=UiLbMg$*V#Noc?~z9djWok8LRwb>=lb`kTN2F8{NrWg-Q zN(avY5l4bBFg}9$zXdj-`XB9>56h#Y!XN`6fxaNZ^E?WuW-9@ZM&SNA;KWSRp9!J2 zO^tr0l&v7;M7k~cv=S7pR`dKn5{t&c;NANluQr6N|2)R^)W ze<=-RQS)C22}(q8h;RKcc8QQYSU|!cRB8eoxGo&PWzt>d`1EisP{~Ff4`Psri>&RM zpnD}G3HjtbW=~SH$-%t{_D*zFg-<&&%INyCpZex&=6e!cA}8ruravD|AXr@{&6Oxx zzTgx|G%C3W$z{k_Fq`?|zsM}N$}iLZ2NyDw7^ba*2wa9K2ac@*av^9)L=kHvC`%}J zj4`!Q&8x-1W(Se_XdZ?l3{{UJ6_q>MbwzC8ugRF44^B>s<+ipc`E%VVrQ=5CPT9gB zqnU%t%cn75S@MS?&H#f0pIs$Sobqc#fl8Ff8zD=V3g^lUC07qMzVxx;AxrG}9M@~^n5@fA4*t&zKqQBLi%(=|E} zQge1(C3o}~kYa?9!~N>M?Z4iZuB{ob7!91;o;;Cjv$l0Iy^blw3+KuvU20=W7ZOb> ziNYt5qYNHzlVtoOYtfdfF(s8$Fy;%B(?rNh2aY&X4l;BNw(4ZWN^rxJG3lex8=3{= z#*r&h^0_V;gQKQB?1QOnBns8pVUAc*Ww38x3mPva0Syvm;urz1N=Mq_u^bHyz)v5K zsZ*hxzkUEU`aksBfrC+ab(B~6Q&OJ1yKDE>&8{z2o4a`K8uRudF#j+| zp52$0%}!2;FMM0?Q|B+J@*&6B_UZeTuPgQD=ktbtFj?eWI@7#c?()_29S09hUH;AZ zFPHGETt#91B~mvujsYneqsYZ<1e+3v>d-->x7nGAP+B3=)6ICCgJebz>W6`*r))?} zT<>csQyG*-LH-=_=tS{bg~UKQd>Cn=Ys_T}9Ge#~b2Pk^%o~UpG8&DHJzU-z2oFQ{ zRTB;WWD|L?XZ`<55xm9}-1|UU^*s!tIHNMpNNHM((bf;&1w_GZszaH))f?Q@pQB)bI$5MPEQ5M$zK8`DDzi8^mPii?PvJY3St z?-b^kkqIHk0dV@lMMGeSl$jOIF-=+fw+iRWyJ7sB(*>rx8@r& z<~;SmWJDUbAjL1TD#!rzy{S#*>q?!ycF;_P`&Muqa_tzW5p{YvFKHmY~) z(=UZdx(KpYGlQbge3DO+ZMJgJ*IiQ(=FU=NqCrFj-`|{B0gEsUhBhdE7!G;Tr`#|j zvprw5ybsbcnUsr+0S+93>j?LW&pT{PSYHgGp{l4Bh`1Yx>9O22HF$APgNSQS+ETUF8GDta!_CaPL0U_5W zg=OffbHJGweAA0dfD2;$s8r@Ka+r>a(n>Hh9|#N(!DZqYR>p|msUQqZ-Ae`r7LvgU z{Ax&-+%T8YmS>4~&4KYlkplzNeOM;;{G?=R91H-z^1J0DPj5f?M*u!e{vsQ)-|Ac{ zz4Pz`G3eN4&B9;Gqy>_jl?re(0d#y}B>_?uT{1Y&QW6Y%+4v8b)kP=!Jeg z0lYeW*4ay!JT+G8`yjvhFD@pgf5-OYA0Kpc!@7NMYBPE1N|{A)`JhA~dDNfZhBJOD z4rd9CY!jzQwYVmRk7YZl4H+bv05ehV*H5FSNRaZw=Ves9pa89u6NKmy?=8Yt9W*8;AcfHPS~p~^9g0hIcp;m(U4B63 zUq;y9mZUIXdI_COUTq~Imkhj<3JSH5Zt9>`pcAs~YRY7X(Q zYvN~j^81V3usGsWvI?d)a+pmsxrrqtuN^k)&7uBdAu^jXp^yV0?7EhOW4US0P6=_b zceH8>pzo-+w;w#jEB|QW(hnCb1<8Hz90=TtF0|2IZ!2I1L4}E5r4Clq)d4$UUI4MqJCla$*E-aX{R?OCjx`bVuQkDt! zG#5=fj4{XIANz)F>09y74sZPmWX%&8Gw&5=k;ph#bz*6(1y#BBLyQX}YzHHw4MPIBQ{aUZ~tz-tFkuk6* z?&?M>7e3wdj*6v9%z5G8C+AF0TQd8n58mzFu9cLa1frSG4y9$YCk*))@x?zu$IM~u z$gC-}a$(1Yb&1Fjhf%By(I@7xON-~w%0-3p=aq7i!0_BXchj0BqlXOSt*ASkYE>xr z`Abjjoi#CI^_Q1c&fYqC%u~I)rzFG+1|bYM0#St$#XflSfnEO{leTEu`7bB0eP=}f zn_4pfI%bI9Fz2?aQTf}q{&RW3q*F6LnEmV{Hxw;+d!t(JqRA77^k?KUA|?iz70H)x z^uRv5C%%=wVA6%TAFm(%QvaLVF((F22rQ(J%aUB|k*=N2Etv7k#IfZ|6gN1yAgX#P0-k9C1;UkW7vqXwi;KUR22Q*-gXFt5|pjQ-QCz z1HWe`#8?O{27=Tzr3pkT@(VzzW*{IEMuU`#ynen<+9qbmnj?&bjdMMICI|s2_8}n$ zBOlOybd5g<&}?!k((^z^r8&8=9vqP!;{4?+v7u0l8dax1^TfDE2XSF0EL~ZB{*>f(W8b);MDZ0rZQXh3 zaGmnyru}>9kglB-LO)vaHGrONS|r59njLOkyGHQ>sVC20_2l2*%Dy(}-sSJUl#~!>sLyWm>Xm+)@Y=vm z?Te=7+jHbtdS+Jh>Xj!A8#L|dM+7K>dfZzY)?V@EbFFGtiI0svcj@v?^=htt`}u+? z$>8ib946Q07q^xvQuwE_BZk~|;|;}&oV#=-~sjUO^)_pg2-hv0mj0aG$WXUH#nlxhSXA3rbU%7Otl7;k%#_v5eutdQE zYk&Q%Y@hp!-q|PR);sQa>D9E1jNa{9cWKr{BSF-;;k|ha9~?anK*drepZsXjh$%A` zZ1}$Nb)`xcDyZswchG=x#fxp(v#(0OK}EXuO1|Ze{%?%V3Wo>Z-sz?W_4K5Wy5vK* z-}?Gzvuh6=(sR_Cbq7B7^u$jAjO^b#Pf{Y!xN^%cdygK=mz>nKS!1ns0lnI_0`SE* zYqDHB21L1jlxx)TO7nP7W6pTA3;tIYA<&EW^@<6FrhmP<(5=0%zw`c*UHet)_2BP+ z{Mn>>r3X59FiTE)a&Ssw!V90yDstz58Uvp!+GD^SFTax+4)dGF!- zVnU%M-~Uv!>wV>WKa{WYJ@3w0{CKxpcplev`K3ri?t2gRDp4^1+TV7Sz5l7AeI8Hg zKIo2D-cQTO?A@kG*Jcfv<1i=0#3Tn8!mfMqN*V`=FPnMUf_@Z~^oSEcF(C(l>$?4K zZnx^4QQIev|K{D14|nYp6AE#2(@ge+G1{}5(m#r(=HEEst=9(j%OTgWwDQO)Ph#Rz zy}AQ<`omA%9C$cyZ`SC6P8}{^O@DXRd>hOFhdAR07-@p?F<))^Xt7A1!cW^NXvumd+_*Bf@6FjG+;`1AA`07uX8zi0WwV`t9-D3Y3w z|ICw^*s)%j379MU;!H@x}98~}H=YVH9})_K;d^9-*uKmVB+7uT&t699c* zd28n%hXA;)J9*j4@e7s!=-I9n_rM4Y0RZ+NJO0kBFQuyxZ_b=|@c79*iHVJ?RFq0N zP5f#Ffc`hNlNe%gv9Y|N=_^-9!=|Nr8`hz9?I{5A%s#!OLR79qF#vB&pL5~z6#!st z_n$}GKK5LL0mBxp|3OhnLR{?7ag%QzKJukcXQroTf&gN3*ZnYg`L_Vt*R3I2q8epO zl`CHKN_zUeuZ}%);Q~Nz*nMNhJdR8d!430Ip7_{~^=ks?_4)?~j-BM}b+v1IzBIR8B-fLSw8MF11F(3M}88+_t9l-TPi$v%`K$jdx(ARZE3&+RCp1yGLw}XF3a2Oc-_LtuP zR47rx(lZGFe%iH1ObilKyY0Y107ZqMC4m0Bd}U@h+^$Z|(uE80IoYvcz0{PHeMgUN z-0{2Cj0_N!O02b}h%8L?C^*BxVUrTe?tzkmDRVefIFl)25og zapyh&Wr`Le?LiW!$TF~Rw*GeOGov1S=Y#W?(*lvg6@1Id#|(yJj4)qQY+9{K%OOuC zcIb9}kNZYVn@K>&hV}02*q)RTkiA?Cuqn82HYODE0>=z^%&L6y*TenFmn>eXbji|1 z3IWIrX9a@<0H|KJOsyNr*1Dl=;rw}%;^S-HaDDyC6@s+V0F#8t7!ccW7XbsBPil2O zP>&Fn75Sx$KdbT9nxrfkbI(2!4;ZgI1Aw{gu~=8@Hy$p8<3*)GcG0uKx&?p6>p3* zpQomz0Eml?@fNVWj=_nq7@fOxS@2ihcZZ$3d>KGOd>nHe^@|!V`lZ>elI(y$60jbmZqf`&VuL2alh8ZsOEJ`SK3zeDhtcn@?P_+~>%T zo-E<#k_*6fU0*hhtDu1~B&~880RRf$*5}lPi^U71?)&_sc6DpDs9AL_-{7Ikij>-^ z=ef(58Bn57!MoZte`P@5PyhW`MrP*ctJVg9?ENjB^Nh*&k(sCh)MvZ+O&;AH(sXMJ zKv|U37A1c&xpssp>yb&uZ{pq=B~^&Xbsg|X31-Geb0NoAggul>1PXy9>sFO>*)KXP zg(Z{!%PufD_7M3UAgCGtw^y#FkDM~| z)oHVhZeh^vH@`KwU*u>JGX9!MhTik6bBZ@EfW)}icD1WTsS$9%T!1k~j9hyksE-x{ z_@r+*3vUtTqU2l2mzTRyfdp3IJBd1P}o;5!yA%5ijeV*#oJwPbhV7o-hIJJ(C@t!I1 z7ZQ;#z{3NE$HOV#D`}#U#w2x_LL&R-J&#;6C5@DdeyRx|E)rF$t$~J7CyZmpB%F}0 zR7Yx?Ol(VY0CGTbhoR6OTv@pWzz2`YV9o{GFk%MamO%Y0DW`lt*D2TaU0ZkPZ-e~r zsYwq{jO)6{%5pO^DLow-ncS^FPAJPh>I>xh7;BEw-lNCL-!mW>0DpCn>(|RBIw@fz z)yqhc;(7w8maX{%;On2Z?mu?ohT_GVRjX3EaKWVb_|3cb{(ksRrW8c*ZU1C#bLK`Q z%g!)ja++GQTLq8c)2~)eUb6D~Vnu6~FI%}xsSXY5w5wP1m4Eg9?ZBZ0>wn-t*RD`@ z+~WhY!r}g}y+3c=kLT0UxWnhsJ8pS*;5{auu4ZHa$e)r-uDElDfx$t3>01{WV)i7H;@qFJc2 z$+E)8%A(B7aAt;`pF8dirOAq}3TQPWD-%G0JSkSAdPyTU0#@ctOHT)oFF8r1Z@}2U{M&dSbrYYX;k=phr zIT&STWdTTtkJAl-664|&W(Yj&frt@5gZ;qq;|tbrd}GF(8;3qOX7)k=-C8z*kZI`B zyb)uVwtV%cOIBUDbQxj+!`0WvN?x-6=rI6Q%9JXYF9mSHh;KY?UbC`9fmkEX2xo~g zVlqUD@$H%ZeexwItFaCu8;T8utmX__N=wgx zwZbY=YMvATSFWamd5J)x&+KIc`jgEaI(cgH(iH$k^zZ4*Y!L`g;jjxJJ~mcDZUXM( zm2z{HIyGKc9*$bl^LAXFedd#hHXKZC4-h5}nG7=kGZw3p10nuOB2ouI7_|sWlr@s< z1t}6!#d+QKVyATfkmHc!sE8G^089>ia#sec9{nTxWNz2-0nSg#A`e3Uj}jrG zpp94{w;8a_bfD1uDfSz2YoG}N9 z0qoF;Q(@OlO-ZR)t}K&7z(9Et6Uvt;UaUZBK))gmvVTVT96&N zAh&hRY5?{eIZ9k|doHF>6VtyPn}lEjVbZb{S>bTAYE|l2EbkJ1zIvUpnJGlfA*KX^ z)on(A3&$nLB}ek^!zWJxs8P0zF*#AA-1PwdJaw8F$N@2==1u9|x>=W&jfLoP2+Sq8 zKkwNKplE@7!e$_rCovJg(Nkv_pZ_i&5vp=sN!?M#7-PTgKe+Gcv84F;DbGAsFn#iShAfrnYrz0@(S-VL5D; zL>zU0pDW8|ADR7WgUS_bs$l>-c>KiGjEn+#^VGbdtXXHfdbI%TICvn8z7eKCVlMx4mq&ySM zk^piTIUykz9f!v{7;7bpBwWp%l$;}%ff!sSHv7A>6(u`)kuV{P1LQJ?oEUOqMWD6T zgJl?SaHxn3)ls|x;Ps2>AU$x*90G+SM~;(L7-VRhMU#Lz61;%cd?Jb7z%G(#5p2r9b`zV9HaES1MhK=c`kp{Q9wP?Vj>+_ZH2r0S9U68FSZe05I*} zPgE>bk_e8&`gLeG__j^}K3la~bTXGJ2-l~MojJSk`yXrHP_|;J605fUqPB&|KElHx zJmg09w?!L&0PyMq{jMuogg@@xuJx@=8oESFzW-6>b%~}tGj#4t&pv-|&xAN`R-!_w z62tE924LI%KUB-V>^%sebMpqVF)>0^xYWIQ!?v}nO9=H=ry=i8%nFBZX;lB%>?wPu zet2%dw4rz2{>hTB4G0ND7t_*~Zu%L(r%w#7RH_8u?pEi9GV9)aZr6vecW+u>YVNA< zU|@4zc(PNYdV@OOG`vR_^5mycK?h?hfbW#mz>O(^j`aH_U=EADxl6?y8PsXN$)@U;E4Xc z|K0n}qo>a%CBzrWpPw-tId$fpne!o?EMI)Hc398bYm_VV%ak#THf&;yHLOyhN|{na z$4{R8^uu~4GX`Qye%#t__=_X%>Cv!qh15JLD>nc9^v6?gYEVZ4C}M^{?vQbl>Q#8T zR=MkTeE7zRa~DD(r(m8G084({I&tYLkZZ(<6M=)CIFtTK zS>dd{qu&1NjS+XWYSyhq(_?4O7RZ~zM|0}(Z$4kO#y?(J;c(b>`Cf~R%q)8(MH)8# zlg3pm*SewX_D?6AJa-{aQUb5@)#wNbWYPu^x05QWHF6r#m&nG71W1RT!Y;0F`e0^W zCYT|d5ciGAOT*Qv_oQp&fH4cTP}ht*0(yWiSUPa{WdN?3-HUFLC#^?hiN=tsz62&_ zU?5^ue@Sc_`b1P{|0gL@&2l`*JK(aM>^1Wg0Du^X?N$topSR>tTmljjA*~i!$TO)F zXB98Wv-S=E*mv|;od+L%rq^Aa8r3gVxX^{mSJwZwee$vulb5Xwhr`haBS4{I0I}m| z&(|OH*wa1l=-Rw#nW9CmW@LQ7bJqt8zxw>!HQvlxi;g<##AzJ>J9PX6fU6l9bJu;R z5NCFiOGSbrTrojNHbPR~oV#?n$-~2*>vQ+*%^H_3QaC*$WBs=6+}^XHMzR<7xD zW9t$9dr6@vGN>agu4ZKH`19z@Z`Qs2#g|vqDyfMPPcmbRlmkyZVM&C5=5uKK=$nVgO zp8T>+&sh^k5@}|qqtt2(JcB9cZb9(>ha@4*8JxBnRiTocJ~2)xCN?%UD>0ek6JlaQ z>EC{(^WAt`a0@=KsiC_m4bJ?>+Ip2VNb?;ca%H%-^cu;TM@EGPc&1^^WHgtDVR;QxN1v`BpkZc4T|ZxLk;kzK zFgTFn+&&ke#jiepOQZTvO!)8Hv*v5YYOz{oNkO?vB;7-Rn?>Y`YFz?|xuW}OmqoxJ z$!;?F+E%A@|NSNH=azEk!Gc}T#I_%x2(3jM@0956qYEwc)vH!>&%65)0FWGvtk@eFot!*-hbsbIs+yd@}mPV61L((&g$HU#OEtr=owy^e}TBLpnc&d}B(V<1SIP0%}Sg<%3n* zVi{v0ehUZVmx{wBQuEQ(!c*2G=Z8jSgc0=6f~9#_wLx(Moj;OLG(x3(9=7*5WjPdF(8~2AOBeQ&bKtGA9md@*KZU8Ot2NDp-OQ` zS||!}sDv#5ets3#pv8X#@aTDhf3LOFmGxKoovk%e;scQNUxRRPh}_j>DV~h{$Ddq}d`u z*#pt1tR+_{g$$NCCtQnM6LtBV^!8WPCA3dd&?wqrLf~mSQuTB4cBG!i`hJ9|C2pq_} zjY;v%h=az0_ChzUR^|F)MbBQk^wsy9wNJ<#B$AZEz^jEt`xPbT1!@!uj*@tj|rFzW3O1i7|o{X%ZCvzw+?7 zT&|K3nW}rt9#Jh_l|xT=-O^i0iYg|L_KJv>oF(S@*OTaG8Hl3o&s zpoU>7?%u@F!o<)h8y(Vj$TzwxTY(v`6g_wv4QT0_SxjQua9DNJ>V-!Vlm4Iasi8TilwLeo+gf>L8Vv-+h-96{zB(otl%DD02PaS_zKc5L z7Z8|Ot0gWSrF_-G+uIi=>I4HE;(NZCmrnk&L?nyLWIMt>R%5Ah+M5-n29^6-lTU^I zn^PpckReLPV#tYc{=fFFTvyU1DaV&pb-Ks90t601R~Unbi-d%@#yA)}!MqIf2D}GC z7$6LAu7QC8FMxOi1VUn%JAF=NV8ouwUrTqxAe~hAsjC0aB{DMBj9f04lQ@VkA84qIJcHWZ?YFQT9ZwNSD>nBi@-{f6AqMGv1a5pBKpyXm*4tE zBU}IZ^Z)+mfBDxx|I5Grn}7T#K+N^43#ExJ{iLf#Y>PEiP-HsZ*oxUgMPanmAD$l4 zfTvBQl9`Vzj9Sy}l>2bcq(l8Rldu^83&0217POM8VPbbU#8WX#u@QPx2So{w$T*G6 ze>Z(&)Vl;}Co)Kj-b%avx`7Cs+WCArU(QT)eQTZjm56%ZoCUE}5CaqCd5dxFTcp)+ zI`Y%pMX_~PHm&XehL$Tn6l^7t`ir78iOrz#!+`)W0Sty2ouC`6v`jfDIJ{9o;?^sB zOm&jZtBT`up#ZjJM`PweC3mbBR}yv1anPXC&D@*Cl%-o$zyF8r@aPb7QD~T&h{rZRk~jXfT_$Moh|NId$#Ej9I3mv79pxHFzv7 z*kFW;OV>6l(LL5La30A5DilV#SSgf=~MPF53}8Se3js0};xQbgMC#(B@5fm8vXd%DIpre7P? zx-1TyF6Yb3%jtY3Q1AWi?Rvdl`}Jzu3Pmsp4zaD%_Qfkn8)Hgm!JWw>dc!J`Ow1k~ zC}Tu1Lrcvp&o~dmJ2K(W3BG&iF(JXh0Fgv3n+zU$@4d?%HF`jU6nEUFc6`}vNlsKQ z!>7@V^`=?Y-p?->@;}9CH`1z}Ut*}B000wUNklM$G2PUd(5u%mRV3wY^ ziWG7!2y znIc4(rJ{XVAw$t>h4tO!zT3 zJ!+111!gRy8PT2XP-%0h#NOdH)`YlH-=hYd`^}yJG1Z|!`J&yNnhZ&f#B3r6j=|Hm zA?hcc#A?;#=`tc>>Hu^07a7gx)x@AKdz&X))WnnbY~|m2cU6dIp|l;iD&!7VP~h1W8#jqllQ1aM(4SJ$B6ra?K*$7t+&* z7Hfx%+~DC^9Rs|pB;17Lta%_mmqt2>+$Uk(i_O&mM2sfv$mo+i97!thu}wvw9Hg<+ zrZi9Qrc<~IC~0(v_Qy?Lnc*vF89$*4NhhnJ2MbBa#1g+8xfjqj3H{WEeD*Gjc-lp%$;rtzUM#* zK2C0?2K7B-|8eTjIpQ;DkUjWcns?sQdwNd~r@?a&XT38M_tr(S>Lj^%N!P9-S3|s^ zPIaa6XL9we(ymW9^c>J)3QGN2CgOfD|7{viz3=HYhvUL_t(eaBH1(m8j}$O%m$jaQ zIQu#`urxbeBF#5mb9NSoLk^x$0AEQi@1s8l^DnP)1hONYD2v@^hG}9+Ky_%;JA4_Jx zqdbU5@b8G#f3T3M4ziE*6GLC?!7d=&39_Q{X00}bV7&RLS+6d^Y_2@n;?Am zAMbkcJ-w%|o__Z2kN@o3-%Af>SwKWKuNWd%7aI%DQkjrU0&I@1-IXR7M%m>0p=gZ| z-E-7zUaqy#O<5QE(z4|K@glpv9Yrwob`iH8B5wuC7KtUziRh9&gs%p#`qK+9f~F}Z zB}$R<4QmCpe%#KiTw$=H;Mp}a4Rux&m9B2nZd%os{LYGgSCiFO+vJRhDeKgQg$*#1 z&=YB;fE9~>@JFYQA1^O2Z|BohR?V@TR3y{)29fN{#+B$gR?drW%Z5iNK0o-scl?)N z1a@NwNH$pqHuJahn804v4Aby&=3bz+6IyEkbMLZ?*`nMj$iZ4u-q)%1gni1gT9`~4 z#))ndpsn%wOwF2LS)SO7ZxKjXiop8CNZMfbUZy2K{$xnQLuZ$Tn45x%5_|<)HM;wEWddYi+LekD531S4S&;mZF5^)hxwKa^Cc6Jd;CrNrYtBopgL?7 zxQHn_Be=7n-Yr-*r4Vta{wCK<$=(cTC{}OUn@|=cxxwrX;m>J~p^oOYaQWCZ3B$s2 zze>%hUmt~YMUl6Nj)-<=tq|x;KmRYfzMifh`^OJ_ITO$|b}i>8$wIc~6|S0lj?Eq@ zwcUw$XR=j9oDO|(xyznm7_FizN+J6-%exQ}@LEMs#I8rk>O?RRhP`?rGC^raUj~EC zdbY)GVy=*^ya-1jV%S7Xz3Vot2DV8l1JCo#=$$cOCTc>3?|e4wT7{@O^4Nme(AEZ? z8%Y2Pf8a^VS*?P{Kn_cKK4xsbm7!K+OCY0V-;>vg(9sAQy=z?=Ma-ill#bge{B^ff zI+O+Gx)l6`(cud>Cj8CM>{P5FaF>YCluc?o&6fHtIO^vJ_QIx7MUoZs%#XKKVJi;u?67UTyBZ!G(C z!F4**>n8@i5?vb@M5jhL>1>Q9HKItwUl7E$(mVaP>3Ftvo}<^t#p5lgC`5x&J|$ew zcOW+@*9lJHAF~jRzihaZ3Ss8nJEsM|ta=&gkcHVjND?s~Yop20BxdSyms_;X$!iUD z5pdn;yJv~5Ah4AV8B`Z`c@pnV2ELcL%kGb%hRk1g)b}OqXRB#tBp;hSG4nagXS zCi`go91|#cxS;l1$cv3UHCH)g`*Qk4M9A{}zH~ez(9R>6tEZ_^JHz;2`^QnyG5lixeI>euiXwa$W;84$z5s-~$0MFIkQfE-1U zi%kk;#WnZKlGWHOYDrTCDoYX~76_@$_*$7o-M|6c&mAZCCR4n?SuhJ?P^mShVFmWM zQp3-0OZ8VS3wC2-<}Mo1=eHFSI51&FZUoP|hqp62Lxym9Gs*>;-LI!UJb<5@L(2lM^`_jisdr zli7{(W8%9b7dRKG;u#cX=|R)dE5B}ul2qk%l(spAp>^a*DwwX3Qd!vJB(Ns_V&v!a zMMEqOZkD^#KqSZ=P&3-)Jk+>9B!r!ty9>vnj{h{DJs@n2$K`u2b-4FUbV!afK|au= z`NUp2D1`O0k*HlV+_cxT*6EJutO2E(G=I(n?(7qWkRx@dH$tB#bub|6*|a5f&Yy$g zm@RYA0;Nemb^=D_83%Ps)2dZo3MdslQq}i;>xY{`T5` zz-w#$a_-H?{v@Uk+y6x!Avg=<`^4p=RQ1T%StZ*!*dhvR&FRMQ$ia)O*=FN`&pE$I z;k2RN9qce$)is~VgAztmsSelV0|)8K0dCYKvWSKzXMlk_Cl(!g2N28YbFP&O=xcKl zN#AgJ41rS?3B*WpVR=*A2gvbqk3IMI6yeeg_pLeow7G69%eA9a$6%q?k3qb{`ksNO zK@!RUcyNx%?pgA_t0i02QtHzLMSOfYSmEB3u(4X#UNc2%KSMMA|sos07t93yj-?2)s0+Hw#t*r(NBS} zV1_+|{7Ppj$hToZp++gluQqLHrg;E9K`&eAJ+zr08KTy*b5G`tbk>AIBtQ%fJQvXb z5D-yD8Bn&BbyA6WoFmr~QFMF2slk-bYaufCd>*ibdFD|F(uU1~W(OKv9cea_eO^#f z5HvPD)I5T1=pJpj5l+$k48IeDh?u%S0+KmYiJ*aK;Mr}OIXVAY_wX z9fcMK2Q%AoBgEwlUPVy4(aCG@zxKtg9JxYOUm*n;1D-g@O)JTGgE9+s6zsde~Aa&A?Vf(XFo#V1g00Xw|07!JNlqD2&nnRn{mH)wB!7$CYT7pxMGY*Pb?%# z$1y1@DBqfSa49cUZwz;|O@2 zse{1O?XVIs>uOO#f!*1DiuldB_T!r zu3JSs98Cg~t_l)74#shAS`K7S(+>AZ<*|#4N0Uw`qJkwJWpWfBS>6UBer1+O%8tl= zzR}SR^A|~cI#mGd$ysM0#nUg7oZ}7=oNZS>~@VwR1!XQUC87be85>oSm3MD z1_rbw{EsRrLx+^b)*1P_gx0{!z4O&B013KDm(MSC-tc_;aL%*QtYfZm5$Hj=Q4b$v zPS4NA93s((d#AV8{>#%3XbkG@1!zn*Ss}h$7*al=C{yt387d5;1D{YU0ICSOe+Kn- z#=EQfKS)R%J&EAW0LmY24l&ttAwXV+pMCeH_4*lj%Qi zGzny4;eR_F+juza#has42x!oD+bc6C_>L<5Ur7TLUl{-ux14_ciYAu^_Z*FXGdYUu z>87UFvIZrp@iYI=ZVsu>fU*u@*AL@nAK9ZJ=KABH=R8j27AJ#fAwMGHrd|^qDF=M< zl6Jt%<^!>C=Qi>GXGvptXJGVF8HSu`7~qv^hW`CNLghGfp?w5*A}$Jubu{K3w|OpQpl zi~=s^q8(9dU41gZJUb!+HRv=>7Ylc$<%Ln@k5z1`J}&mSUSUMct#M~SCkS+>LRRE<5;gbNBuw2~fhWp6GHpWvB0NUoP@HjxUm zAXAktqe97;R5VMU)W@pojdjDvh*7vg_MB7va$p%~b%7BqjKRU86gZhW3F~&J7S8+VLC(fE!bp)jm%CD45dQvjY8v+$< zjQs4%6R;>9AZB8;Q!TnB3=`%yZ&4>8peNa2&YwOp@QH}dz~x2D`kW~nVQ*TU#eN1UA9oT~P@R|_ zIk_s*sOq5SUh?LY_sv@Ng}89nR65ZR@F$drq0|taf43z5;f|*p>^V>*C5BG&J%i82(KaL zSuHB69vE9LAJ(h;(nyw7LAw>Rcz9P6_h`f&MJG+T)CAiK2PbC|(3I4V&kTW z!a+p`2(TQc5hsO}>3h{sQld!2kdN07*qoM6N<$f}?*dCIA2c literal 0 HcmV?d00001 diff --git a/media/glances-iowait.png b/media/glances-iowait.png new file mode 100644 index 0000000000000000000000000000000000000000..2a3a4bf439daeec4686f74e09521fd2a55f17239 GIT binary patch literal 71188 zcmdp-WlSDn)TRe_x8hLTTeSEK6nA$h?(Y6lpcJRLySuv;cXu!D?z()*_x;)IZg!K+ z{@6R2Ofr-CG4q^fa?ZK#6QUp|j)F*l2mkVD>&eq5Xr4g#-p0-Ok4grXnkzp<-7x8LV8x~#OHla73*Wi+Q8VmW{16Nnl)OK;vE z=Vx;=-5VtW`~QEYe}c%znYf#F;7OOabuVyf^*1_Z^$U5V85!?KHcU&@fPQ4x#y#VX z3C6-yO+Hvye4>#KtY7!mrTt#9THOc4P(AOc*836FpS2#m9a7&b{$1=&NTf{oF=q84 zXt&yT+!cHe8{#T4r&C#4`nOs+1`mvwN;XyTus9r5kmxh1u;nb<9PMm z7qNuixa4iXt9F^umpN{S_^|TgKJ1!wPn$#gRz$t6xy5XM+=mOR&ySm>Snl{y^~pg;b1smtq@>7yv&6Lxah2U*%O#_vGES1chh z<-GfNZq;d+p!hzgu5Xg4s=71q%l7@R)+M3j!vgeM!=&g!BeCa<;cP$EnUvrA8vds@ z82i;mnh?>ir9?}losKIpWVm9L<|B)D8!>yQQl*N7PW4wTQBwKQrh9|V2Qyp5sd@iw7AFj!`uZqj*Z9`+xGgDWL z+Z?O39h+WxnYrfAdwdyyEIGJZ#2xL5`?mp+eah~-`&PS9p^w()Zh4+EWfPxzZEJkY zjRqaFDv}|k7M6ifToPUU6bdDet)wc1Rga+5S^1v)Y&U%+T?)MmBWd9GaBC|mHB;=a zUy^q?+_kHG$1lNHf*rRn@Q_bTxQek)PuoIod|Xp{?h%jE{72lcF4}dPk@sCC*EN~47mhM*3GWyQy`@Dv`@Q@E ztxaY~kYuxKrld#_a^pJW>1VtSWcug_j<81UewoCNv4?X74^ z&tr1V#yc|ovS}hnS5%^+9r3_xF;jwb5!OR+vWyQ2FIi#J!T==rqx8oEsqoYg8KfO! zKL;$_&DcosmYuk;i+`3|xh`g&U5Ou_GLSnKI<62ii-Qlu5nXaHP{(bd%Q=&NQQ3qw zIQ~RfT-^i}i6e33oPQE|ydG-qu*HmKQe~6)3&}!qT(MHj(iw_s^l~wsx&TK0z8vxQ zI9=sVd;8{g(QHx|O0f@9`b%#ch02QTBF+_Op^SoR%q6S+jD(fuLZ$KZc4VrZ(=hZ; zR=xh#V46anDl5scn%gjRB@-dRud!{&?_Z`7$6ekI6VL0r8^`bkZI8NT_w{fCtmWqN z9F?c(;ZdNVmimdfB2n8i)y2{kIdMj+}#zjnBtH!qak<<4iUamth? zeAB5kS!qLey}PLHYJ@bQT4F(L@4wl9_290NY25BTeajdIKzL$l8=Y?NK}9*9`zzVfA?33_VH+VB?Grr0EVzCL8npj|D} zGv;KQ#Zd;4EVtfYlpB9F{~Nps<#m6ycK_TXg9zwea$a<;`xKIx`Ee$e%wIP~mzMh3 zTl|e`et+=sIDT7SL(u@T|FL@~MQo}{biMJ@WU6YRXn7xPQW`x{3k6h-K1ZHaB)>fj zPw~S+#&WdCtU9==x_Pig2PQ03XzwQ?vokmO-Ki-2v~0IB?j9 zpvvxiy&bNioem0qEPI8;`ocbHy; zdy+gUiBnWLQ%Bgyi1;r9CO1E>#`|bIjv6R9%ZcZHnum5}mVQK3nYNCYkuMtm-f?!a zGK3WEJS_AdJ}(zsTp-6 zhuNF(F-AsS#x`Biu$lXt9iT?B_}ljEm!&||)UgDVuR;H$m#exCJJ>{JkTO{s-WDBa z*-+*{n8JQn5s0Dm?ffI*Fb$6H$cTgHaA<}djW1CCU62R-WoO56SlTx@oVUMfw zn8jIB)4ikJEepRS$eFz9QWq=jRHW)saFygjW>9aHp#Ye|Tf6UZn?v46m{-zG9jpeL z?^ik!VTSi;>~RU7#U+ayil@<~DBfsuDe<2@eM%5-Bc%vu4I)<(pubYV>z@}ev@@tn z9vUrNs9xtIW=2YB&WB|pSvU-@FEM27_MN4495qMd7M`7~SEn!cfy4h;xP z7TZ$v)m%rRPyc+bB}_gx_+f4;0c3^g2lD;7(RFYiD0!R_^Ww&*=eTwbq2%Y56>eZZ zotpp5bun8$%{kt#b&S3>S|@`LH`<|1nxdu@6Ppl+PI{|t$1K5QGp2M%-@L8EBCB!RvI4s}Kuki}qZJMjnYIK_XOl2WtMuI&BfUaX>udJdtsp#(Q`VdR6 zal$%JO(7fVbK5b=eO(SuMi39z+$HJy*t@>oXn50g6j8EJP<{P(I(1$zDJ&%Ye9Siw zkJ38Tnz5UJYf?x}<=s?UM*){t5UJL~L_Sc^9`N}uYldg6{0uwO?~7V9ENkVFdD7Od zg2XCH?j0#(y3(=muAR1>i%p6V*wmVot^Hm_B}0t5EUC#nOgn{O(aQHWT$;^q&-_D! zj~6?`>o6owvyF~gPuL}!YXK{6`leh0;kI>wRQPljn3FGCm;?%&oMRkSLo7j7=jJ`I zD}M!rK{M>Su1+cBVVfzM1hr(ytprKTis!AnCUWzs&-;zz2YH%}Vp94D*?D<`qZh0% zxe^RW>3(+GaSJv)-|C$X7JasO&fjQ!GyIqzQ=651VaMd9nJ7Ko4rel+_Zq=wd$qXk zt_xy95@J*qU#&JeBr6afqwbh^-zaqtYBm=qm?=x;L>P+7N?4Rb-?k!mYbhxuA=zaW z*#VXJg*x#Vr{b&cdRPm)&Ccfv-m7ejr{D0Rrzlvm zxpeyJQ^k~h#Wg3Gi{V0DIZQO_eElI(7-YTf$jPJLd_KGuyBwW&0yFc#$MO>(lk9YQ zu>L+K_PvFXuRXz+vprDsYwDA$C&y*sIX^$2=S^x|!+TbPV8g9I;=*7mE;gR}bYRP` zWixp?pUZkGYNi5?q8<}8T$j@q=jp&~A3nYol#D~p$&uC4wX&5fGsjNkk}sL!Q+Wky zCKo59ERH&U+EPEacCUAwmm(4_5@!PmQeKqce*(P@erFw5avDwpZG|w{2QLiDI;$cy zQN*(=J-H+I*R5zr6DSrANvWDl*vozZ*WyKngO|b1`f&E zY;*hBIEC z%Oh{OtfZxIXcA}b@m%iiU2mEizt<8c&m&Ew-)+Uu2Iqr?31e|#){*hrM7l6~k7w#z zD`X7G<t<>da18Yi*aV{>+*}&iW(PF~0&Z zLCeaij4raQmroh_3-{pJRC}s_51^>^Q|^7?AQTfNrruyK2g90xAXVurQ>|08yb;DCk_tiN){Vkdkcoe1f;Xhwdti?Gs3%535Nhkzpu`hBSp|5i4oeB z1NFAZH-+0fQ5hUYmGAf#OPCIGBV0Ij{z4leSWgZQ zXVUw1`+$C{m11^}{4vcpM~T-8CW&ZjsMiL3Y{ht%NJcb?B0-3FV&}WF{tP`mUea~q z1dEe@6^QIgsO&8E`{*v=h0WgWbH2sdQ5$*jMLd3X{W(%fN|q6o zI6O_QMUyaiA{41xDE(cNqv!;3+iIsgzGs#f5t|G&jVuI~GbeCd_NxuOVWqFW8V%C= z@D>i!4HZNHVnVL#dI(DyrrJ*X<8>oN6b!qngDo^((Gs$<8&}I{aM4vaEfx5*=_&qq z#d;Qfdk3?UUodPe*yLudKl&l3B(yE5_83*bZkk#g=9>JtvSXAU2VQDgFYWsL`Oq|} zzj0>vr^%$#)Q~s=49?HtobZKgUa`80TKv7;VOJNiVHCk!cCKx5ZQ+gG1O%!$YqoIV zjew;X`B)X*Ov*K^ZVtk>z3#BtEqWmjAt{y3k`5+#@Lb9Jvf##!>hBWw%f|atw4vD9 zwUX><-@U`%Wvm#YQ*~daH{{MV#QGeLrV5LxAPp=`cOGpZrn*yfc>s{Po3`hztX@!3 zj`>Hen{x9BO>`vNYCM?glK#6Pgy8;bK<#m`6u;7LVpU139mriuF+VBC7?OeKIRiOD zW|Xc1J7oCU@SG&+q-eSB-mvytnUs>fY2Y4>OMvz5TEXOluzz5VMaj+RmkJ_cYG=>K zR|ghqswjOb%&S^G-Hoeu6Pv%s7)?UobQ`FDA9sjK-u>-B1iDzSw482LU7NFF@Z7u> zqBtXXu{jmG=TZ&M##uiL5sbAk6kXR4pf|lGepcO-FLKrVJi8pRg8M06O@$6q700Zt z!^P0yJb@CFg8X`WwcU6KV*;tD>Y&w|AOET~r^Fmop^eqM6?nS##u+RL3;U}eJ1e_b zXAMkuzZ%O}5QO2|FxrfPOjZY%If#C3C&yu!Ci+fnj?D9iiWxQ8cDM~4_Lm?2M@u63 zF~oq2CH-~VQ>Np0PDze>o!zi4!moFMynh!=iIvu`>(Lf1?=a{o?dm#BuI{14PV=-- zJ)Nk+c9Zj7cGE~BK{+K`bwyUG9gT+6QJ?+~^`=^tzL);)q}kZ%{PAz>!4o#W*YUMH z{{4QyEW0Zwn7Jr8m9lg*c+m+lVAqojj}!FhV6YHL+;UaGLl2W}eVZP2j&_Etg?;{-zTrmPk;)AHkr|%% zd)~WMf3?jP#-SEn{pN8Hh4+XFSoc&I^`pAD)qR=VQ88}!alX8mitY{VA4gaFa>i{k z9=P7XwAdFC^|si~@=Y)0`_!z{k<2;C9V|Vz;P&kr7;50WaD?|bUV-(T!*n!@`L5vU z2wIS7Z#-F~ki--om^Pms?@_j~%sdC-!7`E5vT2PccjsB?XI{Q8FKg7#n+R^OJMN|* zT|0yZMO&^#@X3Y{|u+`Lhi1%ro=u9ZZydrJQrVJEY`P0D` z>|$F^Js8>SU_5Yc@OZUr!uyo5%9j^ZHc)s~`O4}mAFkmU1uSNgjJo!xaHP~h)K#Xi@H$9!JH_U|DqSm%amb!^;%_6`qYFOUktg3&IOpBoIg zpf5h?(2i7>&+$b~2?iy)T4X8*kYcx_CgdP;Je)5-e#M)Pf&ucFH)qhmbb-ox!pR!;+@;K zld)9ho|}#ZF(g66%<1hK$xE&P2UCm$%am~~ONGbB&6z45>*}~nLK7WFxOOFN?lmT} zEzyrtu(&Aj0v|h+``H7w|B$R-=Ff!DCRxXeG1m?l_y8tlRJP!+Wc5@_nwo zKl?^-ab#bqsxGsH15;M2I?94eKMT&wBwT*+dl#CGA9J$34F5H%-DD{=brYWrgHjsU zc0wp6d~l~*WtsN&T8_k-XL)<4d$O;8)Ve9GWyBOgdvwt)GR-z);UIYnaWgD8qxS6T z-fA~@vkxQX+Ozl8wj9i5W2K?#vhv4;i_-T*fu%M&R&orpGFrhkt;M3-?U;8Pdc|^fxmhiW%epOtj(+Tq zB~tdTfL)k=aQHQxx~)7;QEJ_}LH+=hA%g|*Be|u;o&+|Sx7l^R)j1#ENX7?YxJ#)E zK!@_~LjMAzH{#0#qXfnU6aRpC@H^F=hJfipCj-lXD3AM3{P6($O5Vg0$~zX0px-mLQh7#3HbzuAB1oO2#SCYzVrmfjD}MI`eZRuO!hct z$^R|SGbZawCkn2e^5&ZUE?G2~Zuy#1I2G^cWRM!6)BXlGzqZjx6vaT!5ph#$$;F7H zNRFmi8r%Zg=A-a*uJGFqQCrO!dck`$W@`PcygBGxILcb^=F73wb~QVKL+@Wvj2b~h zHg+D^2Upv|H#0SaS>4X#Y|Lu6_pwGQcGf%n6W5(!h{(eAPV`>bG7UQEOXfdD8z#wN zu|gnW9#vPn=Wc@BGm&cl5r0x0niEs?%g2luU9HaBw+AqL<;@b-i`cofkX#Q#Z|;ONb@nSKM~35(z6`jD#?(VU zf1|_pm?q<_3O>~QL66*8?BcHm3cUtkiug0~r_bQ>hTeXUESyif$nZMNGwF>bc)81%pKvysYo9>RP-h)$Vi{O=Ou& zYHFIQ+RiBAcByHo=j#iWaGA$b5d3KZ^vx7N>r)%No{YyEkDJ%Lb0{#nH=h~T%@o{f z!FhqE2hs=u5P~T45vyN4-phpvK#niRG#rA{@j=Olhd3auBgxYB)~9BTnr^*Na#cyW z5!O&soIFZuwP0!n30eA&%uz#i(phzlhG|5S9!k6U`*$S787wTT?$qk?;P=_swsyzU zkPAmZBGT(IiyFh?WLfjrrmK&(-lsj?r2=-Y(p=V4N;Q>SfK9wf^C$?%_{Yd`i3CZM7^n*eH{s6M2-d7fAfP&sc(}3XA zr>gj*0aNAA58y2V5&@Z5AVDy61wlDlrF}7~1?Dawlc5i9C2&)W|5wum4MPYymB< z_=k#-{>3{qc9Y)WP*^W}RZ5gVL%Zb4a6{UNZ91QHz0irVOuH6@*Xb9V{bQl883qoz zF}}4_Ra9kB`>{ZSSR*tPQH8wnAhsaZW@=HEi~+9fjUSpki;gkd zn1Ts#*#;JKN}uipG@s(h&U`+PmW|;MsE2q$+kOf8*<6nwv)(7!is*3F`b|ihVI(SF zi~w!Lo&LwZd#e1nuBls!%axYGW*^oHE{a>U?zmxW-FL>4d7%&qO2sd=?2j4_2U`yh z!ccI$<$D^WpV?R3YI5`iJ=G`+RX=0juH4&C(?F|kc*;evpB&7V@Lf%fTzUGPoLHh0 zUh)W1)6XrBJsxLfPM!$3-5Q7GVM!Orr8F`Kd-WoAl9yZRwVCc$5G*9h5*_jjMxXI| zS;JMVmH}P>2wnjmpal#Gn=m6_)n9})!1y4D=}QqxGKg@0DG7a=cBD*Q{<`zn z0|6zGG&qSyubqGi02Nu41nBFSvRhv_1MhlTCVk%K=EV!AQt_w0pXNHqcBW(H%PEyQ z@1tJX4VmFa?8YTsWKrU96D@A91f6WJzvNzF3e0kFNPvh)tE`Oz=W=HJ7Xm7YQwzMD z#tNbfhRXvf)BcDZvRFM z_OX(%PNX(f?e`Z}iyTfjr3N?H=vN7P#M@`^>@Z9a_49>46dtUC)- z^kwA}n(;_)U#Na2_PR23B7E|r9Jm7(&f zy!+&8qx4s~vLlKDS@z7$OVDMNL*%dQ$Plt~^2af*AGhb$Rvq?G3cG$LRRjo0IzP*FH)1ldM7e5rFHUY91-+5XnXsbu$Vw*A-?Ib3LSYWK^4!Kj3e3wb*Z+JF6b6e zsqlK-DnxO63hq~Gwy4-16lh|Ul#~;}$=+n}lKcK!$KxmnJh=QNl;I*ZE6zZp0no3;-EXL59;Sp0j(E~clMLh%QJh!<)2Ha zw5YZwb=Zoz%_S_R4N{%9Gu4pLTelgrinr#A{V_B`-5wLCZ_&SxXILavC57}L^c70q z?Y>hTVQBbbrW8QGytMt?l0r~$dlAZq9=$;CVePgGkRMadN zD_M=9Qfct))@&ZTJ3f9DS-s?lN6>Vh$rB4m7*7a98CGlPeZm`IEw zfc6D8988;)Ykfd>Ds>9rMgtfAd|k*2u`c}^xRH>AhKjHAxC84WGqiN>K8CqroX|ow z7gwVhT?edWmk)~1XQ_Ovvdnq21VX<%@`PXPrW9VjJQ2#<&!R0@4_?*xh!!T=cIciC zLA2y0p^3=OwbiD2+d)}Bqgrm_U0bP{Yu#xz8I;_OslFw~9*usi^WFA5^Law`ePX*o z{XShU!hV8G>o_dXBHU0XaTz9^RZ-lJwsP-RAW6D2dnOWI=X2 zOD=t%PVuC@#`h!y33|DzI-g~u1SE#9j?8hhPfuzMd{YNyrRCb_Dz%*h)fypejUVO* zu1vR50-Gp#^Pwdo-xW&yytk7&5hdayc?nb6zs3O}eE4dI=B`yw0oHE6e}*$E=DBn}?1YbK&;h71m z#Ij^Fk^QR|J+J#(IL-8}!@f5SE`j9p?$%hQi8M4a`3xU*o3phUqXqsc|sw7`k~Jm||Lq&X5m3k|02Jro{VPqcN>H zo-0S;2|2j7#35%`=R(F4Cn^-o^oz-RVyRjY8Yvp;lt43bps3cU`Q*@sDyYPG{FCzG zo}T$oZK$QoPM~RFG9fN+$I4dYd!N}WmBr$~NcEP3!~@qX=}$@oVM)#6`5gpx5qW)m zY03G!Nt38X`Ak-ur<=o>Lix<<%^mHKFI!oa=YR1sE0U`t#=-}cNGj*~$cyvxD=Q19 zCWo=It){h9M;SIhlEc|qY|ujZy?JN>LSI2RY9Ji~eqOd@Ifs1==Kca$=*p~l zEj}h%I$GM|&trTosRT)O(OEMr42u0!Nc8;r#MQt z((gI`@E?#D8S8ME)TL*mr`OKUZOy%+5kyZJw{3V?Ni~ylv1>VB|KjZIr1Dgfx?{YT z6`w45n`+X?$t5IbI<8(X!+rq^OrlM~0tcLX+A8pqV4N&?dq5kUP+sdxhe?J{<}U|; zv8(P)z zQrwrSRg2NlH`jjZ z(_iBc>pZ+SV&MRpbL;rCi@%XnSG73K(;n`J_NZGzp@E9I!8xmr{dInCI?3XCb`~g( z#}Vb9NvYYIY9H+_b2~%h8MmiT`&Yq#Cmz@X&nXN`tb=6RK6hj7 zXyycJJ<|~;+|##v?s#?-BnN${Ir(j%4`|3Y6CC;ZoE_18Hmoqo%Gy{}HK|T6fy2+H zSzW~lJCV*YJX0RvLr6GqMuGR>X=(C{zjDsfDb0+S-{l1_iU5wFC5KF8p1IHrM|IlS zL&#H12nMBL>>{%e<@j)VyuYCQ`5ws+-!|HHd+%85O)#ZBkx0;Gu~1o-iag@^`QdGH zp}yUQ&}%`+>1AN$>I^zK5z2Y$c<}qQ$BnbRm(i=5+8VXYg~Eh4##9po5%TR3+HAtjw(4q{)BSEW*eO(Lw8B+`N8qo#n(~F zaCN_1F|@461K0^#-g<{ljaIx*JeuT;a9`PrylCJEQ}0NOUVZOWe7#;9oZYZ3R*hz( z&xlWKh+3oW^uG>ou02Xm)m!5Bu0y_Yce|Z<`55gZ* z_fPi#=@%$hC@;V(3(=j53xQArrVJtuz}P;wFy-PwFp53O}i9ViC=}9go+OST7{dW>y~<$_}QKK4YA?0OrX9IK0ptO z2R<`scDv=-LpD1sbKRTzjK|YuQWZjaTE*lRvxXqeIoooUTPnf1}-$tAES2^{~z6J&~v6toiU3 z|NPOrS#wv29rp7xTRDn74+J#!Y;Avq9*GHbx|GWa?doZMbJ(y7i8NC8LczKFz1u3T z^8Pt=^{c5xRU3lpzt-5&M#p^_jb=Yg&9sY$uHn~dMI)g>I|daq8Ilge4P=uR_UqH0 z^pVJpXkHFc0@owMin6~cRkj<@hg{CP?Q;~Id>9bG!c=LL(9sd@W?8AAwIi2c+ zBrmE=46d{mex;6E-u>#7CqZb@pnNz_stP@i`!n*a^1jk;^Cio88K1X+ zT1C2qx@y&^xa=XXkn*3REh=%iij`03igHj{N-X8NJ?R3z-A@5LI*JaNsV#0e6OCU!FFu}dUeQlY2AD{c)>;T2YoXQCVPeZR@t_yf{>206&`(}ZV~j1>=u z_;|V>{^?rwa3J<Plk%-j|_6sfj)>6LI$Nr8+<4co&299g%YaUxPr$L`^Saadu?AYP*X83W9^~;1%3Z zarrlg;bldhli`=VL561-g~OA*!6*BN+y!3U7kVB|o21kLVRuHLVLOi)j@l>gw4n2T z9uH+bli9P%DE_VtU)h(pWQ<-mtfj^FKK`cCHhI`TqD!I+V-jHXpY5;MKz09M4@eTw z%)_1n+@BVBa{fx}=|OLz*aM$n4amrWYE(9A}vHOD@|@=4R;M68QLV2 z7Gx;6y6jv9kO5veq9{{HU9X4YG)Yj!^*hT<9;zAnpEdFL`PP3Q+sZOiMY)zwUnYOG zeI?hG^Dvbe?6=vsiWr1ntKeVG`*mUynQnlL{O(7tqKlWoL+eueh$d`)r|03ifL8t< z8~Kj>&aFY6>zby!)T+s83jr*u2@>*uUwOT z9YBq+Hhn9lhJ=EG5~=+{XkUE(?ABGe@njA6>m4VlBJN{`;2+W#=-K1v4kC%tb1&Hc z9sPPT;2qFy(hbN6rQM z(Cl%)zd}sDQE=>L@>u?wbRpnAd)AXv`?Va}{nAurHGrz?q3qL5@PCI}Hn`D!x=&*@ z6SiByJ=y9N_d8j~BVv)wF+bvVDR4vcg2D;SynM3l^54Fn*-cjxr%k>mU^7*~^HTP4 z`I(99v_G1yjK&5HSg>2}|0{Mel$Z$;3L7{HPpFMbWj{S;>(JLGES+yT*-sU#Xj5*_ zPG&!1TXFkNBWX)564IAHv9xu-RsT zvJ>y@qE^m9`Zg}yrMd8!(^|7AbG^-%maBiT=k@ogRcP9OZFjz{B*HbC`trd?&gEP` za4W+)oA)tEBX!o;-9IikstUguam9RZKD|j#75mh&&fzMl07V`pxR*cWns+{Gkgi>d zP-A3Ev~=mE(eeGsCz!OrZ)0w}KPO)5j?}4uIPBS-L_~BpD65*6`UXMI_4V4Ga05|k z#i4fx0g6ZakO2{CMsI_!hM%k?@VNRarn40iG_y6_ebX4lOv3HUQ2Y~iP>sTkD4v)I z9#EMN@`#P1dq`X7lh~i3R*7+S9k1KgY+p!A{EyqDXsFO#7Kcat9^r+t$*8ULg4{<( zZ>Q>prSize^~v7u$G>qA1_~xxlT=?{=s%vyl(%~>n)4IX>beJ0WFhZBnt>NU;+tk* zz&wjc0tV9G4UBg|fsU942_VCYLH_L`McJQ#MV;sQh7SIegoX_P==f)UG?Sq!pzZ;# zAF%dBO*E|;&}x8Z7ZC{A9C8IfMMphJ&^1D0EcQCEC8&b5kK>oHK?Db7iZ(wY3pY;m z`gd<;QV5bHPJ^_28&X}Jp9j_I&zU6!_^tNNLmbb9EZuJIlKHA)lX1lrqA&O^2H(PJ zT3+vGy`py zUH(%&&XKxzqE7t;)q>}=xI!u|)bz2(36>M?WHpIT9x_SQ&H+k?H)~VzDsqFBwVzEC zP2k6Doz(87eWwQv+VXNRYbYQ|JJ0LQ-PcHaVW#}ySd6jbrj~7jWm0Qgg_dSj8wsM! zB@b>ck{9Ve_S)rTDXf%+ub7JIWXrA4bZpV#@QWb}Yt8yU|@tWRFRwKFj=Rc=G2jRbjomt620BVw%Ur z!~*uiEDzzv^Pj5QH|KV`RphFrjpv4f?@Ajmc+-@?w_!vR2e*murjf~4OG5`L^J~!$ z)gtYq!gACcBO&5}HQTeY$NUTxqciKz!xXE^@^tR0!pJy|Ej`EV=zRJ z4YRtq{NqDLb#pu|b32rx5ITBij`Pn4Ly*BffXRO#wk5o3A?5*00B;xM#rtw=9uy*& z90VkTCFUcRpx6LR+K)OY1Qc`v=#^^?A%IY5<3y=z{{$IXLD2$AFcpx~5X@OB24i@2<^JiA7B4H7nov&s^rKxLhr z85N_PywuD0x#F6%JXTHC|D;i+G@-rw==ABH-$HWd=Xqi>|JPWN@f{z*C9#-|iNv~j z+H(f;R36%h&dQQ5Hoh-tmv!iO0tr-F@4Y%{2dO>`G*QdCQEOu1+%82m<|K@~+?f|- z!ebN0&AyP>K@Oh5r9ePSDhwsZ0K$6UUvMVuvDjHs+q)V$3K{p?ZEVzi1>>lUd?hfg zB(HV5J~z=9gL9{ZTrB0Nm7vI8N=Egy+Vh)UbczZ9o~$a#IxJb;>Ftf;6w{Pb!e1Pw z`mCjpl#!%?)t_v`|5BK-a~f|YAD9RQa$FsO;|P&3S{T=|gJKpdK0Q7ybK*F-M%R_~ z{Xb)hG;83hzCF7fx$ZvmDfN&AY-X8^2eDf9T3n1t~ zF+=!(FF}Go1VIofAn8r@P2wtI1&A7BinIm*<~xKOm<}Bdkbq5qNa%7TBi5ieb~EzF z0U#KGWe5n6^GvU4vdg(`5;~D04WxvK%^z@LLT@Zp-O;)n%jLYyqr+cKF||EJ$wU@G zx#8SsxBH`9QcqWo1sc)|6QPpS#)23A=$h>YoHV!=QzC74kN%_M9FnjXv6Q#;!fVI) zCR&Ca)hS@4cll@RrGOg2*3a>%h}~i>Ekf^_3^99b9L?^W?uo*02o;!#%sV*4}BZ9CpV@Nk%^%O#`q4rt&IjEkRE;Scm5wTMeSC00tN%&(x{CgwgK<-EQ{iD1;Q?wu+ z-`~)b;I9e@@DQ?H02zc42xb$K4-C5qCRRY^gM#lmOAS>)5*`^}&!Q#It`3Tv*lf5y z%6;dot8UtindLekj!0i)Qjx4;w_f8tG7b`-we3i$FL;rSCYTGQ8)|bniTYi)dUJpz z{nFGRgk3<*F#N;%rZOT`|jE=S{ zoJT>|)o2iC!f4j$7uoZ`!n<1?EcRNUj=!LRpC%#NXtqe-cjm_-o6`&kN!}X za%W@>t%oc10RzR=P&>bSGt8}t^nsfzo8<4`bop2MV!O-D+#JPKM-go{IbS&de~U*Z>rUS6*8U|l$vwXTKXAM(O_zTtkfTg(Vwczv`#!c6|BY+>=QIg z=6w)_uyFk~_-t4)`?eRR5=qzDZ>45NRm4>fv4h0f*QjxnpCPin!f2JlO!hJL#|Ywo zPwsZ^#W!F@N6ugIoWnQT4|Hzf^R+Ys^V?otrX3OBA)V8?`Z#ZN4)!&@9fzipTA;{; z%h&RDXTmdWHL=rlXS}LT3rW{l+o%vg5B6&pw^5c_3Iug|IkYVLy?9cu(B=SRPlo`T z&eb^M21&*M=Vj7PtF^_ym)*Zg3!frawyqhx=&%6Qi~Se`FTDzs7yi~f0G?%%(QCJ-j6;8V8z0=oTlfv-rPA@}D^6&Ak z{LL(8RFD66olIZJ5-G$h#D||+ukVRSs|p`ezUOH}PuZoMRH5J}zWL%faIzjmrl0&w z95^#mT|tKqB1OO$Bdl-JKIMQw{$u){j|_!}#2=M@^DBmH{fAfmFckMNm3cgAkgW$nX$#PqlzG6v> z3s%-2LYA=!*NFKHwdg7ce^qy?8_bNVIfI9j#V$^!8%hRQ~eQ8OM^H!97RPWwf&>uMH?86VS;xv9-{+BZ&&9yO}Ae)+q zeQi)woZ{vhdu{`^*$_f`*&?7@V)9~I{i6E3NB=$|=`uJj%*)TR4yj@n^0TMUJ8WdUi=mady>dm_MKdIA6N(Z{XOramOkhb0{R5TkbscOxahq*F zR`I==>K~m-Za_tdIZDZHO85_mza3jwF*+ee{(OSs4)swlqg-s2 zLPsNgyng=aoC<=sKN6G0Y-=afd$!*;15coBu^7{0QYoRj7z4=x6a3$pd&{6W|8PyS8}|Ug36kLM?gR<$?!n!iKtr(L z?(P!Y-QC^Y-QBkTJLk-vnmKd!OwG>j{ysHSb@8EJ`mOiAuIGMOS=q=PGfdbXqT(#M z2YucmccDAxeCv3r$jt5kihG{7dRZUQ zqQ!8Hnrhqk>^`mYJ@1?ozwOgox%9=N(?Z|QQ5PI z0!DTb=}mV&4I;}7qJR&&aLvppawx%uwMO;7foxYLm$r*>XrvOTlEad_1IOcYlQYT~ zS2rPfF5EizZZEeFl8RmMDi4_r;l;e1rXM?Bd{@yEB>(2k38yQmq^T)hK;ZuiTzgzh zL|Z=B)!|fV!B0PY3T7nx`uo)6r=T$VkxU{f=`N*H6`P?zI3^^5YW@C?_9RNE%RLB= z+pz64l6IwW)d@(4Wx1vET>GoUvaeJ`;SBX5^%2w>3hMIIsqLub17wDIWo!@qq0}H_ z3(LMS_k>A|4QjhEO?)^d^i<9G-u$Mce3=%EtbgcQ@YH!a+r?_MVV+8#HVW(Iw5{uki(Omj~1Al^;)eWMrI8YGFnjL2s?RxLN91rg2O%r?*{1aS3=mxzzS8lwBhBD*; zMLU6K6H)Aoqu@zan|VEU(sjs2l5crC1)H*r6t_wBuqk)0$3gBewB53bj2%?r%K-zq8pu zy)_bTnwZ=@BUMDCl*%j&+A%@lU%jP@)6@4P2pLDh$blNh18>fQ(Ml&GGYz*lMX7=o z=D6B0IyYWIwfL;!6qJM^KUeP$c86<7m+v^{P2UGx4p0HV4UNE`4$`cde|0%-q^Utk z?xZSgR&ia`<`r!ir?g+bb@z@&(orcYfLN0I*CosryK8`)ttTQ&X#`)8+{0111S+16 z_8Hm4#hRy*+Tc;cMTd#2%bEPcmtxhCO2!!_g-U9vg!PVF&?%F-g&qxLdDBQQ)$iIE zhK<4J)xKl=PM$3A{e2O}3K}m}XXFL}6|molvZ>aIQUsGhE!_?9^PK}R3&JJNRi#C5!@0>Z!5Qmlj6K)4`qo)P7-*i#2# z=!FH5{LF)V-u}>LK*89pY;{ZJLFz2mdR;0PldcFsPt4!SVC))xnJ-y2#=}!?(&p%I z72|!Oip6_7iR#(4+Sd^W-PP6hZ>QPa`BW*t zKsQa-ZIHFD-{>aD)xcb`?+ALmHvRgf0pX(>vwuVV>L^t?{}&gi#iwFf3Q54zGnU0t@>C`S_RZbY?L9!guwQa*!LnTYIQ>7yYK(Joc!vpJOmsqVt`< z(Tq6M#zu!2?}W!@IAw}Eti!zZy&16jv<)NI^p@ z_tNjgD}8&0^}JU1Pexba)?LdiuZ6D|1u_gH9$qeI5iCoYYs}yv1*8Ci>;yW1Mib6I zaB(2j0ZzoooKz=I82aB1a=O$_z+jE55*7#L5E5FD^%4L&H8Up!LuCNGJVLOMm>7eR zrO}fhf7Yj3;3DV`7_31^17F!fNfqrrw$rIto)?4oJQX+6*=DeeB>{dr$4g3QeZH#a zhj4mdwCm7j`o|y5IfE3&`;D0r(82&XKw3-F;W~Mcd1ZGj+Z@tiV%yJaa*Rs9_OQa z#EV9PYEng9{B*PS=o{+a_NQ!Hyf^#7B~8Q@(Nxg;*MxoMD zo8QqNuTCBf@*kh&b*P}Bq5CNGq0CsF+aLxlj=8}<|7T9$2a>K-*Rb86Cq9==OS2B6JZJ0BR%Uk1a zHdJ#8VTE5AU9){oT6cjdLGM~IRr_=S-;q%^xc4R7YHDJ|(~g6Or5xt#pk%9qk>2iD z0~=t>?e<>2!{wSx8Y^Azw2e=wi_0b@S*x?xmta|=ZqAr@k(2sRGM$4z>*ygF8>cDoW0&RYU?Y-i9s$j52W#(tdVHI*AuV(qn z1zBK6_OUs$f;t2se(2S})V_YMGwO^p2aOv!asK`^dcqy)>x92CNvG>k3|lb9 zm#p>hUh<|!lqqiWmNoams|lvzKzZOgq&Ub_&{Q8q5I`yqG=fm*l95S{QO%_`5Nu~VUa9*fewelJc)rh-yQJ<}I_EpFh*Qkf zE<&0r-B7b}hb8SdxHM7f+bh$<3y&=ckY@GF5R7ni7;(PPCwG*P+xEY!38x5An7+Ak zpy>Paeka&@ZjK{&@)!AbjA7fmJ6S?q@cVbn^7`8=B!r* z(W6bEk^R!!xy3%z6y^n6`sGQ8YpC)DK4XQChSun~j<zS{&b8R|~ z8|*}Sh(rS56+Goy>1ZkHc#zV$jmKUcIyMC`MQih-^BEWdGe?H8gXjLjJU>HMpu&vu zB+~(L_H%{jf5~+`uk2s$Dy9@LH8f+&YLaptER^#w+%-w4V#Y-Q218nSAl^;}s!nBN z7d#f$Wz1yYP=(i=8}Z*vD$@>hn};sSY$s3D{j#?-~2v$Qk`fUHE41yQdp2gDWuF!^{5dE%ed;tMZpu z_HxIHFnFB?p5ioXvxOetQlTsifW_zgv32{7z+!`AW^(;=ZcN{e{g=Hw(vRtW+{h)# zbT5vVl639&kur1xiHIN4Jk^T=DMBFm6ZV~fs_sko7s5G+yh=`S>G}0F+(Vxz12&H_ ztJ0Mdj^5qbgtk&d+P`y#=ljO#>x3Klw~i*^f#w72s?W6Bb*#*2YomS1?kwEpp;BsZ zN~W4{iXU>>5VX)p05oDi7=UFn`E-GK6FCdE7S^rvdg7NPdlnQ95Go3CcDR{|r;{iP z{AkV32wxP(wK*3fB?~wfL?b3JsE-XWtO2W2#p7y_O8~@8h`LUmO#(r%HjNJeV9Uc? z`$}%^RI1Aeb3EXfWO~?)h}&CR5(UvOJ``aAekhn{{A9!8Qzdv)_==!$pujV()) z-_OOzKpjrz35`0cB{P%tmI#KUac4b8iyhbI>Vu+ty)wblRClR5mmVzZNZ!u`j^__+ zrTwl`<)3}$Ji(vGNPn32v*qrPjnp zc@c6nQHK5v^t+RGlcTeFONrKZ1GFi|WB{iRLr?w=W;jG0y z7^60^L0xyTpEm&2#eBN;Q|0OLJyZ^^_J?UrJgMmGc4WV;6Qb*?P}&Sx9m{@KFiWXt3U179FmT5wO~BFU;+U!}3}1~=xFgauF+{7X3=#EvLv4ex z3F%0H**DGvRcrsD3g)~-ix|E9uGMAXV&ix-;mwKpZz)5U$k9O!a&cOTYSoqO;?E;S zM|D-#8QfiAxNhyK4{om{wCt$G}lXIo*@v#XjV1@>pG1hGItwo z1!646t9_N*Q)Lt~0Wvwb&dyA31RsBiuj~uzN@or_1hSVbU4j`H-Zs%Yh8%tVEZl3> zSsey#>ZItjIQ~?X#$z+l#W-Sj^r8qT;|DGR0Y8nI#1T{BRjK3eFVZ4vSwsn{C%F?$@kV?)Br&wEsXOPf`E zeGRfY5i^@od#j?tEUmU4g9vDd1#{hMEoZ>p*eB5iKw zTbn)Rrkt1n!cyX~<_Bz&7hUChh^qeNX2@FY-6PUf-)4>0;5ORr&#K)+ISA$E@mrmG zoC+fY6IfX|KCQf#R)v!QIjE8>QrYq50s$M2Y^CiTjhLWNlml0+*`CGC)I1D@*K{CYmqRoElMo} z$qEECjjig#(*oIn2_V!T&%Dv8z9>Zyq{IL~+>l>IF+dbN6owE7X#oPyB6#hANH(WcWuaatz;`48<-k6d3Lr%+UiJE z-kR+Y6aVUmP{$6VH(YyEdOb&?T}3BOpSi(hJkV|E%o5kEh?Q`Kh%ijuOAHr<%n#Qy z_^XTgAtsp2;14o|p#L*RtePxaQ;WNSlkTs~zRFardUp|gJiyji9m)J!$tO=iKMXaj z1MFD@e?=Z3I$&*(u5*LyV{kZg=Nh-*7ddRXx+bfwaqTQ?;8F9Vo4f!fL=?t*RqsJA zpIeG-gGOmTr6}}8h9>)Jh0WT7@e0VCLg7zu1E&6TSzNop}_Yo8cw=k zdo0kyjNGvPA{r*W^jCF{>5#i9&lXX}25C+&6nuPkwy{cP;S4xd?03TAUgZ)x3d@F%~j%prJ3JDFm! z%?Vd7j@j7OA~<(q6+!5N8PdDnP$}A&1Uc{#1h0?83&TB9kTG4ZjCaU`i3)fEab?k; zgnj5HNg@SX;Lqzw+>d=;nif!siGf-+DCL8_91oz$$O8b(3Tz1PMHfgilsTS@@0F-~ zJ3=c~;;To4%C%W??kA^Z5{iYPV}HZ?`!Lgv z)B5V<@tciCc+93dC7y5NT)XzB{gpd_@@_Gvm%5R-PI=H!1eTJ=O93|lo_GHh8OE)4|_-UD(dvVFb9%>cyo6Si4y{`E?o z&+hDz?DSlZuenhM{;G0vYMQGFD~ylAxO9IgIOJT32So-^?M_z`B(J3QJ4-n`{|=VaeaiCf;)knOX(*=V z7%&Q>{XmNK_I42}p)69dX+9osp)WpnKgj-wB=GT8|W@qQ#D;}EGAWvU0eUAhNE~r&--sT8_IZ^$C zF2Sy9rR~wa<%PgAh>gsBNpbz!7#5S%eW-YkoBb?r<9VWf!!Z0*FJL@VrUk^^z(_`YxpqXQ4 z{6kc7aD4@&LID6I6>EAmH65E(+R-25pn$SER?p_-GRzYlNeil_R;;-mRvSxVuh@hY zNl0CVr5EnIVR}kiDrAk6N6Prhi>W$|8zz9D^Y&3uH@^T9%SS5gSWMbL3i0J*b183B_)XaMkq0^%B{^b|C*B=P!IJ|8x9B$xB(dZ71%I<|RITjYuiWeEc7}v%mT& z6^H~5h7$r77}%;7r${9=`>}WlBTFSGmG8!k`-BgWllcs5TP!JfQe9Bm#Kt~3Eetn( z2#%izAF-0qGJ7dxddvWFWPCojcKDiIt87hYx||0`kw=_(|J4O}(k*y}eTWeSXgEA< z^C`Fz`8?eB2kwvWkT)F}t+vL#WgE_(c98NivvyXs$4vg;f|>`6b1rs~|4M2?G5$kR zlbI{(Tw%d$wbm7!Ik4h&=swtb!W4<~i(Kx=+Sq8Hb$mjJ;i)?xgDGX<8!pmGgiG&C zBZE_zYz)35WAmcDM^uNWct)}@?7{`PoIQt)a`sRw%>j{PP{i5zR{+ewpx?j_ZqXE+ zu?`F2M7MGwG@?w3CO#tgb#M=<`Z76hMnG~q0uYdsHv?;nYU8N(cw67VSaZDS_~?{* zo&uFU)iw9i^UhR7{BjAC>>Wz(?#UowB?z46;0D zwjU-g+a2Mk=69`nhPgyBgR}zH1GRuO0S_GzP#~^K$Vbdd$P(W|gjhz9zCK$P(xk6( zr-dLSv9A;e3J1Xok{kl?69^A3i9m&L7X;VsA;key!QEI;R*>~TPv9S`p@lE%h|*x~ z3rZbw^wm~eiptH|*z!lO)K@@rKxrwORuAW9;kh#v>BR(XQte5y`apIIfq48@okNh? z8be)Vy*op=YHb#^7cN?L0NV(K*@Ka$#PJ!QP)mMIfA?ahYVp%cgnHeGUI6WgyS?K} zNM#U0Vu6`h#2T$Kr&DHKi&vi7V2R~d-II%1Fyibo1PQrFm&&-B2WE`8%2vmDC;USa z60oFHxjMkjxJgTfcU)G=Sb2Q>Sk)gzKc!+ywiPiW(O3c<>y&Zk`fM}AY*%q`_22{(P%-e8&(G$qd)oT7! zOW%&W&OM`pyInhy$Q*ckT#ii;ua_9hd2-wAY*F)ub&fMuG8pl~x0@)CKeM{8EF3+U zSt5!s97Frx(;25V;sP$ZnC|L}v*E^;n|F#ZMt=C}e+S4|Z+8-EcpOCHw_En3)HOO5 z4gb25O%8>*2yba4YogeHKKERD9r;YXX7WnyIK^l*SN@eqn>9+5qk$eZ{EmRbc+8AI zOhxE9m!-urYk6+YHv{9j>o}d(JtZoee|1im>YNP_*t2WxN$wMMwtdZ{Macf*RsGms zuYZR7uH=m{Q;=v3UJc+fkbF8}6HEg_?xgGlZUVRjO{5+^kix)yn*)PjWYGJR*62% zQ&A+m>%+1VXbhS=BzkiUk9o%?mQsp+;$DskL-MvBarNP5<;&36TXR%n=}4IwWEk~v z4i*#=61oyig6HILej~fw**IJA-QIwhi~k4VctMDP#FQ3jK!1HSu@L@qCq&L~^1OxF zAvAGn!A^I`F2(11^k-rRVUC~qThIFMnwD3!ZZR}!9g~2Ix2}Dn$TcCehfg7|=8tL$ zFbE+Xgeo+I1^wrzb8d{p4eAOg$un`8%3sy4QsWDkgA!Qnjo$I9mkUHX zsSfAL^Xn4d$H`vb7jmZ9!>hNlw&nw!su{Poh$d(>T2XRaju;0+D5kC=M{b|PZEWW| z2SP}9_RlPztW#vBe_DM@If|0ttC5qDdbg9zELd}w23@#D>}!subkD*nytrn1sY*gP zm1ax5cGT4{PMd^EZM3(#|I~ZTJPNTO$bFlw%oN8Reu&==`_5AEkw6Y3h_%M)VmMlI zRqkWce3OavMfi&7;Q!|oW0K2k$+ZrZm-EU}L>0|obzs2f$YZbCoCm#x^x~&a+SQMJ z>h#G|E*c~K{&cLgtLeqz!O+O&w~~!+G-MxCOmdMkzN`AmwAph;r{g%bn~^ua4`qz0 z7_o%*Rvd478a-mw8oa|3>{ekM#tWnRJPlt=1Q?0&r@E7IDL#c*6=>)D(&;$?x0GMq z_r?PKS1Q(R`wY5Om5a6t%9c4XEhw(J8%Xc06Ky{D+hL&{=Z{(r-$HHlyjYE&H*IAv z+^&sZ=OKw}kyzvPW)JZl_{%HvidyqD*=J+p5Qh?CS;5-e*NuAj+JpNb$^ifJmsgdY zS_az`?CVzHnvq^I$KNLVa=NbH1=0N(AJ&H~gB(MsakU4g-W?aJB@3*=E#DnOre(|0 zyaP1Uh|B^rq!PJTTVB3KMNo3xTTE5-JRfaX2RwsmaAcQ0TG3Y^TelPOSZA6(I_mXM z>&W&ggXf|;Mu)3G>#0D+h66Vd%IR}>KT%Wuq}@|}gT?Fk8n#|sj9bf#(Zt(^C$~tu zhx*O)WeKrHNTRuPiw#X$3(gnWv4l9i7xylOW=Dk;za*=gV~6%<_#TGGJc(R@~Hqr zOaSkK4E;D(m_PP6@FYX3tQSlpX(DI6EbH48M)3jE1BQ>~rM8cSaY z*u=s?dh`11^t3~=a#FUO1z8PM^~ydzFRObC7oweOEQv}%VSBhUSN3@=VyGn%Z7sos z73POAnb!OJ96c?OW&EYo99Pp_>01qsq5vEMQv%IWqME|WTs4jilxR=SkHAdB8Vew3 z^6>JlRfB{8+3YD&ZXf|UEenmyWG>$Uow$}KJay|KJr_5KRqBUE-B{R-10KaDRnvj@Q9^~%AOC6x7(KJ zZ+)m?Ix=%CvX=F=+03)}$N*W6`f7PefnVUJ|8}S+wTboTc3W3O`m;bmTFG|Q3~kqi zlQ_vx{uNJeL*Ym%3-3vdo(ai=k?XqSyKwL2%*4I#eNqlYy>0jlg{kjErbX>>+Z!-4 zYLI~1m&x$C!MNW!jlZ_@T6VGRyNdt`%!qrUuNLT8shT%Qwt8&|fsMq7x*hwa8sM3d z+5qAIo&|(jvqD-*vAv(DO(&5WX-t<|kxw+!5f}}X9@xe&yE;xA`sw4|+f|i#d3}f? z-mtkJTGhwo1?#;k{1$God#D_5T0I6ZArQwkrNiE_Vi%Ab4~h3XWw>Ad=#BACBfmd| zBRjh%{AE2fns?hz;BM#(Uj`ic7V!nn$)ZtDjO9!9)+5ou#FwQO4@rid<|vKrR&0hR z?)2t{1tX9=+r^fZ=If=9B+b0*QNn%wXqeGc0>&`Go9cu;EkEw=N6#&?&(F>n;)_oT znMvs$SA_4JcP|R>u!w1I6c5wH0C17BY1x;B{i6!UHwcb_y1Ua{H6p`t{mYoFXzobY z(e%@nL&223-8sh>GpXOd`IeaG*TxK&`p6Roj?O%s2Ul@9U3Ncd>D_oI?HdRJKn{ge zrLQX;;p(RxzwV&-fam)}Jmuw*G9INi3tf*=T(#t(QtMKj| z9{Tblh5JG`$O{qN@6Y&Y>Zzdn)B?KZ0g_#cL7bVibpAMbm2tGzTw5EkUG{_=v)|56 zE8y7xaL6*qaFWB}LAKB4Mn~&hL6T6LX6BQCCe6a>_m?RGL_@W;Cr)q7@D-m`LD`>1 zwcGn?|5xI_QfMzr`&y+804M3ls0CkitAyy>wz4S`lCo433vQzGt}aFO)6^*jk%NBFz_YCC4f zs!C&k7RA5D{MX*68Yt(#YBNqZ2;N$gdRIPs%04XeERNmVg|NOSbKY(LX?dz6b+BFa z;#wP6j`QAYQlFV?qp`QtIlPOrAokce;$JJA$BegU;Aoi+4Mka(!3JL36F40=d1aN( z-yMDnsE)oU&uop;k;!@Py6ZjOo8L#;ovY?XJ}phIbbSa&BqMd`iMT&(QLivyh8O5S zeTLD-!^6DX_^p0fES zqMBm$)dI5FFMJ-B zq=9Uh$PY^YZoKbJso?4PrvD&D^^fLYn)g~zVtT@E@N;uEE&#uL_^x9N?*G(_+}jQK z_vCWrX5Z4UsY4B_eR2wC-h&o~yQ=Y+9b@)N+d>!k=~U|8U6ya7xI`V<*OY665CQs( z$*7^b@nMtf>_%65t;L~@R6`?!CG*V8iewq_5TLxG%5wa_#b`0K?1+H2@T#xTH=Ih# zwXuE4$@zKhw{y!l_)$wfgY4TSEHjS5UHvdl7*yI=Q5cx>bf!_=7GJ+7_5pgE`vWBd z} z8T)r)rmU_0u29jEjCxJ=!Ag3l%X(s_N3dcfT{2z|08p)1Uq|`B6zMPSn(;vY%{09+ z+ll!-A%K7@W_EY$l;3CFw3hQ`Bo!=qvmOV5OC@2vdWpPlQ@AZx&zKq)*D*os6B$;! z@RZWx67ezqET+C@k^teWB^Z+#tsJ;(ac>tpf+upK- z-EaRA=3g5WYnllRb>KPVvJDLdN^T63r^_p-Q4C*0mEn6+Pv-3JQA^3SDGZfUVf?Vd zd!KfzsO=*i`-&Eq5KV4jp?CrhPI^`*Jd@6QvL;6+`~lT2g!Zq$&g~L=l+5y?peHZKdQDXbn8qN&H7St=$39TdU;z>y(+cq^T zDfrPB4(q?h6+`nFc?!iA{+6Y%S{ldJuSPzI9Fbdx4~@?Loj2Y{!>Wt=5fvSssdW#Z zK1xA>W}0st6Ic-FP$6DqUNo~O#*`<5#GShKI7cv&Sn;A!RZ+EgW50H>x` zw9?K?P=JKFqNq6%4RBdpK21aXzHwIhB2*sv)pou%4TDcbL_z=AYJoeC%4%3U1@Tue z%uID_9M2RJ4$AU$!Y1Q7w9o022h6t=N7YzdQDOI$iwS7%%vJ5|w<@CjIp3oGerm1IORwgKR508yIniOg?5LFSz+& zLr-9BeX0#Jp~*j$;6uh;4nZ86$tRi16`sCtW7^GDdwjGrBTjN)@Vb(qWh){3+T+?! za9YRD+dzJGeHRm9Sm0x6+RJvtI_={xIv!7ha8^4Q?wPDW}ZDzN62Yx#-m{q zla`vOXO41xV_&z4r+$~tT}-k4(OT%1TgzpUq1~)IZGXz@ieH|gQ9&f;`rb&AjqCgv z82ik)#ZbZRg~Ccl@oB(dL*m2Ph4~SYM8EpcUOOc4jicXT=OoSF-xaTo;&pPQKiG15 zea!YROZ1mSbz#3LgV7vwl4ow7#pOkpa{+@YJ=f(E&&WO5Dc0$4RKw}KFOCA>8H$gw z@?7VooyJ`s+gGcQkB%Q|{9no83^`JoV9dT%(`sB_gS+|{)c-fh_iWbPiD+N7)N8!_ zT;vMk^VZit*J^QF(uTd6$ES2$1go^Xsti`AVRJN8zRR>c z;U~=I-2PF*(g}myYT~o2s;D>dSd4uQ744F3rl0+G!k;1=SP+9uRmpHx`Q(rvAX9}aVsai?NCaf-2_3NMiUE<+AdWw|Q zZ5+xhq6c$O(k2Cb)zXRE)HZ9%r}(Fe@_+8U)1WT@QWLYeVz$r`jQ7E(j&MXd&oC;x zt=r4WGQ*Un$<%>8;4XgOIUxA}7gLQi2bvQKH;fd)le{=rF;ANyBF0=~@>E`o-ZW=P z`G?Fk0DU(eHq9j-E6QK*r4Hw;z6#nc`|x;=5+Asbdz8fF+&&_ry+rWSqC)E9I6n{y z{0)Mf5RBDGe%YQMnyg$*ki(`kE7^Y&k=jC3T8Jq>$Pmov_H>1;{L zye87I_{#29P69D#S)%p2G7lNu?SQux?-o7zhmik9r>A=S86S9azP`87wQKxncN?#fWYPPzF78qHW?%;wC|&0^pSa z$$}V{=$C+g@YaGKfKF6>3{>PV*8Dy&mDo`inE#Vfee@?$2qR!A0Cp*KPzjC}pji^* ze-4t^fX_YPecq(c?@JK|@9TJ8Xp&_+z`G(0S(zG|+O8x~G1Wht;Z zzaa-)f!Cc;lxt3&ymi(2K9sJ6Yw@xycIYopd>WPrOqaV{J=ZY!s#LKzH3l=LS#Kt) z;vy)L0wFV7ePQv{&2D=k`0uyw#>mKz>APX$85dGziS@pB&Yfu55~S=UN7cd3FdjP2 zo&2i!Xlx?q7nP0x61;a}YU$u*&uwc1uHrR=!&xfJ{lpjOk77!C%5d6W?o6-Rs_lY* zP1q(E7~BFF_1A~2Bx)dNFpy%>ZY&ql6Q5PxsTZGy$dp%uu#jvEBybW;>a=Qv$zHXZfB_gD%!HX_&q~aexRX2{(Zw0uNM6 zAas2wR6!JZ8t|$cfDZ@;1M<0(Gz*;)>W82dJs0qw;%6uSB@}(Y&rTS5h&*mRWFtsg z5aKMv1;`cr-veO_0B8&14#HCV#>~UX{EJ5~Ri0K+jAenacG$8+qFi%B`dmhbD_rQ> zN!s&D%T%~^$Dph9{vl}Q{*Lpx#s)PA05=YrI~Xr>Netxtiqu*!N|bpqJJ>_j@-oeW z?c!xSZDt=e?{Zp>Xo}s!9sx=A=|3gSUwr0`VdjPs(G4zoNPOSIL=Lol+tJ@S8S6Z) zW9H`0^I`c!-q_R7pO$t(nwcEa98peRxO8bk{pOdOtM*CWI=mAqHMg`hm!6}R+^K!V z$vZPrl!PPJDfEx0AP?kF}!*)vJ})tQ96rq|0C*@=H}&+>plZU2d&$xr*SI)AXiqBJ7po~Ij;G;_cMu8 z%wFQvxCBnbD%LOZUYVC2+wt?yqz@KOr9|EIU()9k&cl<|5=Hy0Udt7P{aDO&q;H4U z!{6XpxS_s;ES*`CtF7U%w;Nzbj5^x<}x*6hb_=SWmmQL+SoS()r80^2Mk(D z@3`+A_r>bNv~k#1r4k?;i!sCYUw4{#LP`IjLZ88F{-0OqvGy&mCzq_qB+xn@bGtCt zy4QNR4;)G%dnrNk`!0mDGulZhq(nrqN4z(i(ZOVIoHEKV!V)cQ;(A)lEL3gwc@6y# zpEV&9M89yM9?r_ImRf1sS4ApIIG~G-m?{WS+>?jZ(^%KAiDj4`V3jq}( z1q2j?lm@%>(3jvrYQUK<`X-?u;Os*+dY8C%c?B1vu%MnB;cG01MY(BL*JMlC{j4<0 zWg1_GyNBuNOM#--RLb?ID}l*)^e+eY-|42uGh~W@f@WqGg7S(syk0X^JtHsX@riJq zQ`2UYg_189;;yt|e9ncpxwdjU_e2~~v2NVp8g<#3$=$5KdD^8L*CYe%$Qp1*usDH)y(1QjcA;asLdF4$$#U_i;Yl>!M`%GX>fEm*lM>}t#5}9#NNR$tTC=h z;32dePi5@!Ft?QP+>1+(9_h7-1gX9|G+@4)!_To>vz8zt?!7L4#!LAU7mu(Q!O|ml zeqB{ehZ&soMMfpZnfglMJu@TEU7?OO>6@>h*-p)i(WA8ZUUiIv9V;6gv?l5I(Fq3s zc7t5?Egx7`opKZzd3p6UBXbrV?DRk3;1lv{&suT29(@x+a{X(4r^`ogQMn$fp|sT8 z!s};p-saHG!0IV)Gqae7v3Y&)KU&vY*w| zZ~f^=Y*LoxITup@u`3V!1_G~(`uAmdoXQVH{+T0iA6ys1W`l!sJb1JBdX_8f!Cu`Q|CVh3|ROo3~)m188!lK?o|a)PRJ)n8E3 z=y{FRoE=%J#Bs~;QGi1+8{qr+lep^pm&6IiGZrqpzUdryn%w*XCh3K~f#1)?sGz*d zNHYEoa&|LuGwwB$GQ3<2%+?*3@0cY2lAgcK1t-KjB(jeOt0}QK;qaP|T4lyT^AOE{ zBD1iqAUa*Agx0WkJqU~2P`>UR^_YOgxitL4J{ zlKBnUR6^!Lv+;t|kb65I0EztbPX#3vwSRTuOC9NoL_R|_{1qJ|{ue2JK|)cHgmRF9 zwiq4qS}B3Nu81)D2Nb!|mC1KL)>x*MhabPk=lGYlYIeOs^B=Evb_vtm^w-CO&l?2v^XO$9Y%{&ElB*-$;6=SO0(_%b%Q7#$MfEJKz^&!OaB< zMF>KO1)+UTM~IN)$9>3vVkUXexL-VH8$AB09)klqlrYQMK*Re#n0w2hIRAf5vm4jo zuE8CGy9Srw?(PJ4XbA4^PH=bk5Zv7fF2UWWfB)H;ojNtOd(Nqu+3h#o{d8CLQ|-_9 z`rP*g2phX0pdrpb!>skonJA2w{UrE7V~U%NnQp>c1;O+uMY7`n zmq$l-gwRUAt+MjFV8g2b>#Y8v&G{PP+tu zc%F}+gu;v6-(PZUByOWy7ZP+$#jVmcwd9jO4M)Udg6H_N3-w?4jg0`p-}%{bn~I9C zOl9e2O#kZ_N+k5h(5B}QhijMrt8*g2Crwu5u?fhZqeleSpqp9}DX%|D?nPUm(%e>g>J5>ubTopbwV3 zJZ}J}7j1nz4Lx}kFS*^f!oEH%{Tkmu61QUJL{%S=FV78W>_7cY-^EMU__U|xD?dq0 zf%~UqDqR0oeLpkTq3=7JF&~g^esb`>3}6*TnFi`NyAGHbK7{i4vCm?_&9$xgLMnpA zPISVwc@*qa<$wqPeI8#gkR1pXpuh{meYj)UPbYwQE^AdFq=NQR)Z)}fWuR8M@{3ri zY>^w~)U%Iz5C9_iO0?!{OuWA~ybWXATa|8!lq4 zySG*bqdf`!we-nsgr_aX-lHoV0ZMp`UB)KrPS$Tyvd(5?6|9Hwa?;r2tYwvb zvMtX?x+uENJA<$jLix)BjKlt4|NKejtM2+Z@?A{cH}kjs^?OQIq0EJ?WtuGKFo85_ zoZ1#K&VD7i+{b2Q0Q+a6xH|bOA&#EtzYn`+A`!Q;;#LXwnwCw|u zYwBB{!akzp@kH`bgE|BGi}syUO)Sf1Purl2IE;%CNNKJSuD`xO{2;3-E+bRXQCHkN zfFbB(KdPQr)cv*pBThp-MO^L1Cw4E9LZoC2?Tpi@Gb+hF2?(=_35U})a-Edqvr@wt zZRu{n1*k7h`7I@sItocDLir1hK{}E`Oht7`u|PEyQw=Va+2eTRIL+9K3g@L3I}cww zV|0H@mX>x?E@iS)AS-Wmp`GIU)s zdWVag7n$W-n!699RGo?ZU|9RZNOtDj$D&t)r;>Y_vi8D7+xuBrem64sc3aNO3C=~8 zWT3Fqg|of-ont0fd1!Z^21X}!=DuExd^sds@!U?8tR0&IafjLjt9iqUtqCMmHh|QE zmy*S@etjYC#_D7RDNRPz`&RLr5?;Rhdaw_Lh}*2Jra>DFHOSl~S>0}8Lqe-@ z*KOUtx)2<^4cyKs_*OEG+Yt^iYMvM?zHaL~iFH8yP$X)mW9R=>;&5Y)DDIyWd*Mz_ z=%t;Z!xN=<#5Gs{h(O(qKq{L{`BV9C@q}yhti^HKr|<40l?gYOGadIG41SY^p-*0% zi)3yv(X^>1iRoJ&@)s6AZCHEfOycB3$M5)+17*UnG>sFQZ8RTCy)Zb5P}T%CI?bY_ z!KF#kdC2!^0>i3H)8{WdChUnO%sqBN9*pRsY^PS@{L%jJZSsClm(C_J&N45PHxF*- zBb@AYj<1U*%?i4&=-I>gLKER40QQjTFPRgI>IJCRa$=lo%fey>RiA{FPRz&6 z2~Jr};doqq!CMt&0|1~9E}WPxQV9nAQ^DcY<>|&lQ25Pywko`6QEVZ{$5WR#-U`I5 z{g%J{#hK-tYE0f_FfM^Los?!W<=BORpYVO|KF2TBOtU=}=X;u_Js}5ES2yrA#CoaaMJTkI348Ff=dRQ(n8}G#4j>b_EHw(Ou>~M9R(*n zr?OApk0s_s*8<(=71F6hZ44f!bIBns`J3G(tWTz9ufPvTLBwJQo}Z)4KCWgOhRd?V zfbzP+LMA=&DT@vj6@>SfFtdhxA)EPH*Lq``S>44mSF7hD!OzQf9FntvbQflt+X`*L z=kKumG-k9dD91~?*+g?jb9xbzxIMlNa!@sc=cDp5Ri{D2pHV(4s$b{Y) zezB*YkoSNpvbMaDw&8I+8)O?}mM z7sS*N)bb+d7WVCa_B~xJ$!!K?0{7Zod&TCfkX;BYFK3*3p(b->rhp0=QgaNRT>zlXW+rBC++oT}eDR|2x-{G&#Fq5P?Z+z#5b=P=6@~!IsI4 zD(af{Q6uEL^d@ARNVETeruw6-ujd)%1vaM8=d;16zpfAMhmi-511nsLsI=30$%?=m zSKN|CMNf3JkMcFi=6n1sm5VTOoXwr&S*6l!5BR5!vQ1MgJ2yw4!OgSW=25ge>Ekk9 zlUDhs)YFR=V7Uc6SzmkS{NfgOZ6E?JDvc)-AEnMiENyh{LKuGTFauu)?<4r$|DFp^ z6mWN+Py5~5kKPd>-duqQzW&^PhAHW`FYYq&*UZAd=Y2n}2Hhg`TuOfw@L5?rw&z#v zO!$A9PFh7`nAt}i7gRBqBVHX+)ySTtm+L0+{QLda4ONd)P~b6_VE5LYMa5O5f!@=8 zNnFJWKgjU*(Y*bX#v9RBUffT5wQ#w1phtkg7D{-|)hSajzlTvrN3EFmVX(^iv*fOF z#hN#b*4yU>oOYCk`Jc%}o6mL^ev>*P=-A-|BMc{ za;G}$Yo>kI$j}W|xeZ~ybUn5ym{R?!_MYjjG$hK@9fvC!F#Y{j_wVA?IH*XpidN1S z^JVPM9K3imy0xaV{+2zW!FokqA)1%3hnfn{HA3p=@&Kb*XX;v0*DbG~vyD%jZ?33q>I z<2R@=#`a-eavx5a5#vn7PWT*W#t`x@u(#ml` zx|8ksj&qy*R1G)7(Kx!3#?VQpjUpr!WHSijl9(HsAJPj_2oQ*iq$W&-3f&1M0l5X4 z8t@&^%Wa6z3-rUt6+-5w06&Z{WGy%!1KwYtRVe~wR#mXx7-;w@_l`04Ml7(j1Cy?yrXux) zhL0TCdg3K%3>G5xm+bYKBnMH?=nDb8iJq&M$x}xv*A%h+EFWO|P?z^@dCYA}k|2?eOf{ihK`j6k?%Pl;*T8UqrJ0Um~v7bUp*il{Bya}#7_wwiPpzp^0<__L! z#fyI1+#rW5m76kJR2y(!zFkFkKiDvK8?=%3c6>iShfSuK7!@$AQ(2r5uCeh{9Z*7C zs?^j;Ji|z#6Tw)he8F=j$$H~qr~rG~{+@SvHTVp!cg5N~J~`?fQo|LFqLxEq!^Ft- z%*C+jBj^!(#unK3;J5qCh6=G`3dHcb-0LY(mf5py+T4c}B|AgB$AJ?BqA5L{nE2^x zy>_asM8`bThKy4dBW``DRAo&qy&sJGST;#|DSvXyM}O6QZBGhvNcBOZt_)`kDz_8c@L;b>GPTJ4Vw z2ffC##>t~G6lBYLS)5R9vapp>B$`JEI3Xd?Z+!5}j*1BQQ8Be6kFd_ecdn7}8aTFg zKs{^b?RkEw%6s@QSH-HYr65MWKQH6(DH@P}d-qy3=aDb_iFzKAqK3UBzOtudYUzc0 z!sR4HytswSA$+8)X4nCNp>omxDu$zLGn;3xhp$0lFz=95g^_2ciIf#>VY*NMfQq_1 zR!pes2JNh3U@H)!7JnKBAHbA{hzl_l)T0i-15r&w8bbPIGg1=7LAwAUhJh!+8);bE z$ci9kVZ=0ORYao8@^A`jfLR_CY7`4&(4XaTpq6mnO%piy3tJ2FA|)AymCC~(1^{XS zo_T;$7{O1G3skCwGZ>XBWbP5an~K&vY_CYv@$uT949%OOLb|oh_%_|)15>>()|(P} zC>Pk(x5_pnxki&GHnEsr`ztVZ?Uf;^xwCv63z0Qu3=o36a*y9({i377!+CMKnJqJ- z`?s{)SJSG#e94sf0tYfgLWzh%a>5Sc{@kb+$YYVR+Js;r;;v1E*73mirXKkt>3r^f zNMHAuh9|5tYa@Z}i+Ax69D)%NN>mgQejlkY%aC1cTWzO-iuF@IkWis_`dcYdM)Wri z+hyH~SfVlXRSfqxzs@_?FT+T>Lw}$?VW_b5Wwg>CtSj@)jGHENq{)RWZx11eL2_s1 z{fRgdM#gY~Ni54}U~Qyg?|%F8T-)JD&y}dUn;vQ$Gi8-=h*}xmVLZujJ{J&5krYxH z`)H@+5Wn=5d?IBK!N)OzOG@VX39u7x1V?7cjxNNXDQ(FANhySwHpF{SI zVz-fs&U~$<3LQO4Dbtwy6sGADwphaz51MoDgyNoaVY)YQv_R7@{W``Knh^V!sY)kf z9tZB8Go9jE!a*Yu^hWJ*6*?_B%{prSKn#qh(}26Vmr|~9QZ7rq+hdOEM2!zZKPJ}e zB|`)12{$f;ZeTy?48#in!D|8lUXVt;=pX=1FE1$)E?g8$e*j+p-Y)37(UIcFH0Xyg zP2Tz|ZZA4166)7=+)qKkcMvuzf(Kv&wA+gy48sk_fTh562p9?o?qvq8gchX%dH}#G z<9^g$R#K#+1)vhNqP%(V*Ndz?$^x{YRj{&Q0O$VL_M0%r+g5y8dH88{W}97JjJPdv z!8Har^yz6<{*{cZF1*Pa+OuBaiE)XkH~p{R1F*|n+8KI&w%!(6!7VI%Hfl}g5`97?2a4t_ zc+UgK^+z)qW`@)55o2-@bU2b`etVOfE_g=~8%vvaOIL`$aLAP+8(_Gdq}6PM7NSK= zwlZ4y#l~>E(pcULcNH%-f4LYOGmh3*5Ky%u#f*MlBS;eTxon1XW+@MEDw6YZvX=El zMZ%b~@7&Wk4wQ8rsZlmEHD_3(4d5#lw-cVpZKZtO%Sk6Yy{`XlE+OTe&Y+oWE#;rC zyEHK$Boekn_Stl0t%Y)RQK0>oICuVPLk;cI-$emwU>qE8#bKTxLqYYub4{6&i}%A! znM~{5&#GE!%niR!t6)P1y`0QAyL02|>kURZBo4G!{aj2<#%|qXiR1~>=~9#f{ASVW zR5)6L+al%?rP5v)^qjYJ6xh9?4ghf*jn9yM>63w;_1pAJBxS`X@qhwI0q}voc`(~x zBRZ!r@D?a8{D}re3IuZt7zKF)fVYp8WZ}Z4ceS%j^3t?uo|bqwH4Gli_36ZXqElHy zH?o)IWd>z#j{?eAcSI7rE)^ax2S0H8qOBZeO&RRkEp4Ar#DDZ?)ah3wA8@nL02Eo2=lwlvR(jy6d?UoM3viZ74%!@@MHXiB|Piy=nwBmYK`e@ z(c@Rl4cfk}*4E+6Xp@tv>WyE=!*u1&iY~gkw+?;wC_%WJ@m+c6g2P^Yu;FQ~k-?+8nRp%6=E1I_RHbLZ)7PbJ5trwof#S*k~`C$Hoe` z9Y>`rM^a64KK8{4%2~Ux*Eg87i!&;vL(fKQWt*Z=SLMJ;hha*!IQQGuJqql;#xhGb zEGxvkL&E`|u)1C8I$k%+EJx6ucs2MV zws4w~8T(ESE#t0f$^s1@DXx4`h6L%d|H{IL{Ahr@yJrrq=^UB(*6|=aT*NwtCWaKm zp__~8dSInRu9fJvtI(bhjwd_&QUoXmfONlbr2#5HBtQ%hZ0B*-uyGzl1OOh)E3o>v zZ4iXv^AK6~SI8L1#{d9I88yBhK*}0umN!J_n-u!-W>D8WrjeDkR{Ua$xc6Ak^QQk+3IbqC?uf% zuhDw8mF!X|u7Ka`^+ZKb<`Rap^?Px5l0EB+gVjZgcWSPEMn3xjYfV9GZEZn08Wivv zQp>V^a%_=1HMoj5<2L^eBL6jch?n`TgD=Hd`?n~2MVq9%+=&FRx1-H*wpeGv2t_I` zdZ7q9_)a&cR{;biyg>A4*UsR(^~U)lL`I(>%2rc_Y)a)WoSca%p+?RXNx3lKwO~u5 z?IY_}gimzl(d&GbTH5nQx%w!or=-sL2B8~UUwxSwVB z{Bc&nkntX$Zt^#Vzf&EaXU-APJiU{*(P?+iNxZ?~U=r~)e=n58L1uLT8Zd2YI=wu- z=uuMF+*z6zrbEqo^5_z1xHB{uj+y0RJJKEMgM1p!2D=yXw>9hK>4#hdW7c$| zJBwdxZABWC(90D@b)<>Ipiqsg`F91QV=Ig{>2!IOlaTR7hN#84Vo?^VDmo@B>*5n@ z&$zR;!{O@qyhy(BOV9hQCol z%&hh7?DPK9S!kGnaaG;kx7#FBp2E-hwVRMjNarPPwC!JaB5kEQYV9}GphHB2aHi5D zb(PhFdob;aPKEY=JUV>V93n%ku}gm&@6^bxsq{w4YMODKzamM=Qn+|d<8qSNU9wA4 z^*6qY^*`W9mPko;%&#a{y*%aI5&~wZF`IoKYwb?~E!rK`PdLvrLqF3henjMKD@t^oI_&zYG8eLZuOZ4AA&T} z^Y1z`y$isbhLCU`_Y9dO9Tyck-~-wD;jgltBOn0L$0Kh%!fs+G_oXKj4W0xWt_5aQ3~)-%x47PP z8VDq}8dV0)`kAG^)#TNs(_yO466tP?C;B5q`68uq*po!2|x#{8vWgl}Ytz>Z+tJq3tTM znj`V!2Ysjh3zX1nC!+joL7?%i#TP57kKxxy#TNI*yi84^s2m^wDp~z>S?AB{M6-I} zTHyq^f$3)JejCyZM4SiNX?q$n)O(KN{8|dc{LdnyjOd9GYkP6XkGGD_;xgEpZC~1` zc~y9+a~UO#ghVBXpIyFVT-8fg2>Y7kMW~K&jbuJbROD*Vjl%W!%MFNyJOh1f~V53P|*NGolG>F=A^OXg; zot^^|$MK1DFFDyvgmdaaN>Cd8HfH>j2OjMOO*;%(N2;l(j7)cBdQrTg3$=~4Rn+aC zs(uNSJy*Dswu+YN`nc>jh0wa9bW-o~{Gu}5_q8Oae^?@U;gVivYJA38pNN&% z;0qPFl&R8|8CfeQDNa=L;ey%|wu19mRCQ+iL!RY%9BuK5Cp_FUqU&YN&o)K0bd^Wj z>EqRLQy19%a$eX1CfX$kBU2-xG4UdEnMJN#oWgzzekH#jDJ}^CEcMAN@!T>1bQb6% z5RxH$T)*$)w<0ttSQ=pifUp4w!4#4|4=xWvTNpbI{s;mf1M~zTUxL1p0;QkOP4CKrK>%oWXz>~Ip#GEUZ{DdH zGn*pK9~6OI%EfcHAHFsY<%RjxW`DU`OL)21D!N3j41&t}tS8KwyMCEaC*+O&i|7cb z;Q=Tf1P{&CNLoA#y^aWcIQqQnwKn&cfAWG1c^Nm`=Q(%x>U0(uO#T5zoQAXT0HEn65H*X{VfQa@Fkz;5MqCR}NqOe2*kAW2HFl>k;rg)jIEv_- z0LNNdj5dYjNY3VmR{Pg~JFW*7F~JOiV=Y`#rA9_F3q}>917beUoc=08(-qA~ z&7bVWx-s(Re!Co9x$)H_fN!xPtngrs#_%K@!x!l_4hA39F8Iut(6b!-&Donc&m|Ld z%O3*fD69({jW2$axD$KJV-5tL^&^9($Gx=CzU_7#;SvdP9dMU4Uhw-n9Ol@HVGs;C z2$=JoHmx#I+*E(1uK)eb*%%cNoo@riVok|3LHu)Z;Fo1O&awhhF{vG|VdZx_5}v4n zUM_g+yfP^u@6SZ=E>{>@{)3_BbMYzzd1!irWEtg$CwWCfqj}bus$bCJ) z3)V0IOQ=zRiZHPUBot&{?`IIR?llJlCxkN)Vj7kcfT+E4<%jM%wUgU_O|KGvh5fM+ zJ;t0Q>EZc_ePQMc(b1QI@C=t-qp_sMyHwEzN4+oZv#8!Wvd&|h1Ll=kyI(zhnUze@ zWlR0cDn8zoBv(T}NCUk}Ybe|KrU*E6WW_@?(tI8)r)PdK35wHi?VfgLxU9sF1xj-2 zS$PngoO#nFepCNVaw)XkVECLOR{q+rq2UG{(zOT7!{_5YnN_>>Y3Ac7+U|+f!mh-Ac_}UIb}tCYXr}r>kK<14ADYxS$GL#>?_qu!q4JHU8CEdPZ(O( z2#u?=Q6*V+YyBi@kf2t4Y{dUPj414HQg1>+SlJ)Bt6VOv+o4H7Q}B(iTeMQ;m~6yG z=bPvpsYDhwd|U(Zo>WK2MfXpYGk@s%ldF8J(+GZx_Nq6D$VvK1FMNX8-vI*kuag&C z{9JMb4nBupqi;riMRAbr*FLpgIZrX&^S>&;B9dcv=X^9wix0Hky$m&hMH;g9=h}-b z6E`m_1jW|V)(CUxWS{0m>T(Mi@8qQ-!6J?OTgUe6uaY(^k4pf{X5v0r0d3Qcy~FmK z{N?MBS%N;`$xWAqgHX9b6ge#*t%P8Q&Jd9Wx)vH&_*2}<=356)qZc<1qO6z4 zXo?!>i-v>jC3-^!mUIUY~Wz=>Z4;#ykRH z*xO*=5(Y!Sc8wNA{Q67k`FM`d^7Byxb$?3kc;qJjPk#T&P9hA|@arf^3(i+U`kC4I zDaNun5-yt~BxEdJt@PB_?W5H~G_nnr~4wL^xPE<)5!_mrk3e zs0_ggd+X)Q(?}xvxmE9+oY&IfE=cc1BCvbFHg*5`NqovT0@5*+gh-D0r{m+nyR)sg zV@39rkOg=08uND(1@ewGX4f#%f9R23KSXbL)hTm8Rqk5LkE9O-aCzxJP)QJ|CtOr@ zswTX+#TfbThD`q=R3fD)S~%Tv;tw?*{4Wm$(+{D$u;%F_&Hg2rv>ypZBR~)g#3Ov!iTLO};i|2-g$3bxP=UQcW;cvAoj~vU3T>2MJOA-}5 zSKbmmsq`sr836~|Md+g_oh}VQh$vUG@e{aoYI8gEF9;dIUzfN;= zxt!}c7>kI;{4P>&aqpB>_aFWnd_KUyVP#g<;(ksrScFoUWe*>AeQpA#%1kBv!BO4 z;tyPII=LN#TnC#KO0)b`&#X&cdI6VDK#i;chHo)h`SsR%Brmqpl{g=oMz)f{CS0|Kt?}T7q1)N`it&ip<(`Le zws5-7XpYjq7HWTW;&Q6^9LoP)(raU4roETCWPU)*BxDYoBg^Bxvc0`EeE5^q^d(r& zZ9cBR{&eS9usD|%{AnNYayuSAPYmC8`tdgPa+eA%Ri9r>@d5^TlA<3{6;!~8$)xSV ze}Gc<9PwO6hJ-B8+kl?%sazOBbnwIE0W~3#AOM6QcmN^|j4{Xt zM81t21hEwKpaQxBVb`Ks0#pO^KuD-4f3Y@A;47b}kL|H*iEFV0!)U~N>(!O)wMAG$ zr=C-Wo<57r>meksEG>-rCS}LNG#&Vk?n4Gh?yOw}O0!f_jo%YqSQd-d&@1#{v|Bwa z6i+9-X33V2ba;GgYIm-U%u@asmmNSd)_JxsISk2WbRCu#ot|DFka#X6XVWg! z)?^!7uh&J=dM?m$CLT<#94&1(u+pVs(j$p?q;{#lM`P4EIJeeQnH+dP+vYJ`BY(3Z zJu<)N+`AbTD`7)8Nq;Mzcrl8UiC#J&KqtB$)1K7rvE6>zCGfpi()Q_b5&^mYS>HgR zlg>!??lmr{EDX?Jx-JbV#IDw=Yo-F5T+{-o%C#QY4g|ShoHf8NFHOWUZlmlY*{Xga^xGmw%;}V?#C;Y5?9(3 zrM2r7jt(W?aP2U0QWhzRWB>ohn*wS64R3-i`_NGYs6(y_L-vBnlGt|omlH|8%yxlgRUYQssdW)7lx$zuY z-at{@0Z4N49}+BZsN;@nCQJ+$OG(;(mVi(UmfKx!W%Rt2$DpB*iKge}I);1!$EAxQ z9Rr*n`wB1L#ngYWi@?nebTBT*gKp=%>Q(B2?eOj&YHxDRks_P}l z(~<`z2Xqnp>Gq>J8(r#}cb->W)4iI$ZiS39drTk5AmEw~wALwd5KtBXkq0;hu^5uF z;KRY1!zIQ-_6O&SQHnu+g2)Fs-IxGmK`g?kjwalwFprSh!Zh1J7swb$dH~)wX{{=E zTNWfCEH*?Bz?>w-7~&NIsxbmy3@`>_$zw(NlIK`-q6P4scIY3__&=x7_h>5omn0?|#=%XfCs8N8PL@rxO> zl26bR#HCB^O_Yr=vBxT|^i26;k?yJ(HnQorVB5|!DK1sRCn=SgU$m5v@qFGWzLW1+OYQ3DX?K<=4?ZABFW<3>m zJLn9*)-gn!Z}E$(7MJLQ?OLn($f%t~0>@DGChOFBVLs*H_g|J{ffbI-yp4>)G;XKG z$~vkP^XwoUB<2 zc?d3?O{*a7$@pBoL_O8n?`#)J47QY?53)d2uw28~o&~556oQ}vpm@yj#19HXV*=5) zApmqieM^`ibnwVDfDTC6i%JSI27s9IV17c<3Kz2c)y5GvvuX(2={Js-NK{l^ic7uV zy3>(apG+R(${J_MK&$mhD*ky5&w;FlN1sZYfpY)Cs6%kAX&1PqjWZLB6t^%KtR}P3 z*a22;kcii6&^_jADCufyDlNbT0-oF%&FAE)UKr2b+%B%?QCL%i-RB=t1!#zEU#Eh9CX z^h8L+9HUgPuA*~uag;OkLtp*V3a)7nZRb8549sS3W5)?i-1q)8jUMosR!Z=l7CCYj zxz!F9j|}J4*%z3lvq`hNYN9cqp7H>J_i@3 zptU+*V2+QEPfAYi*^rMH(S4fpBQVeT?%REPO+-o~#-_4gCOZX@PW{Dag8{FdabVkL zKBhxA>BjwLL~8akqNpv(zjRc6Q+}^Or#s6!S5r30*@}J$vfna?8P8we)YQtd^kaLCk_PItj_<=!pHR*X=vK_A3$_|>{o9$cOL!}e zG%8eZ1a*mDjF&F_&k*7!{8qc~{y!S<$k@W3zdez@>r4aU_RVyU%IUCP+b15rfy@_V z@zz<-w@^=XCoNywkrPk8RlZ+Mbrzd95gA!-gfOk~OTHEAR*wkv&=* z2D@Jhm^(i2-_q6K;sd~MNcqwJ!<1w(akX@B{|}T0U_^HXLMxB1pe1Lb`6^b<6*tZY zIA1h?l6kwe%Q|{HJHr(Xz|RSKoa7M)f_{$%qF{a7n6$V-zX`Idh!Of%zKGK>ik#B# z&`z4(k*FY_pSh4w%KxP}5UYLA?$?v#;q|*yPI}pjj~OyDZ@?!`x7WbiTLk>fGEtER zqQJn7qrP(Hftv2qyxBOleXQtfnFunlPQzY{Ckb!#ZfYRq1psBzh)~tt*%|RS%Fjl+m5DYrWOIx7>ceq_eyq@?6tMu(wUZ8)LWhMAWbL*Kk+)q({= zfZxoEad$+q`5JRfCDZ7rRK=v!+MMP0@4-tpx!a-H$72*&28vPd3{=R+BvoRlC-*Vf zE*KR*X4n9ryjg1^Z+hL1l|`BF-i<4e@pkWP#6EdQ(~vHpRJ)B!+~qf;7?S8)sD2lF zw=IAwa1;dolS>019Zm-#>qR*F^c^7I3j-Hwl3Lxy=mgXL3Dy zfVqiteTL3Vum1;AjnzpXy@vq;IfoiV?07Nbf13p`?ojp<7Z*2iwAY{W(=_RO5lzT1 zmO;~21m=OmP1kMvxf)m>l!^d$bIOv%Q>_fdzzpTz%pCx6v_^B}pI*}W2+XHxT*o*@!kZGLvseYKb; z2^9Sd=Lzi@KZwB-f*n~z^)a&Rl+hheTvX7iX__5JR`c7~>dUV)el)os=Q7BH;*7p9 z`J4W?ORV9JT#>x5VgE#ZF!dngH)O#h%9I9+cC z<8j^0Ce9hzT2T$>SX)}rrG9W0Wr3&qCWen(mk!K+9=J_|TJm>%6TQrE)SFX77{19! zeXe|YNbLNfmg(}j-172+3fK1l?({Y5*DwCT%{MzCPT9}@SFDHIp&GE|`!KUMqu#9& zymz=KHZ+`fJTco&KtL))-J^0p{l6IDw0L?P(`xz1+f@}$z~dpy!;H#`yUlC+(nf31 z;vrjaXv#Z8j?T}MwicO@kq`wh=;husaTMC1Xupdo0^-(RvNF|t*AJpk@*OT0pe{zt zJ;Aw?_WQpmYVPwH6Z&4^LkbiksS{wH^V_SOH6iG8nnGj?Q_}>u=U;V>u{7`v(a32o z5TLB%q~5#{Ck?U5k`Z^Dy`m}xPw#T3?-GuEfuOw9) zo*5gTsq>A-=(A$4s6}R9%v>@n3K^P*tS--u>4->4V+6J6Wm|C0By6D`PngY-*h<;u z?K*KaMlGr`BL|#MF{eex6lWwiYEoR;#h%DL`MW$ey58@$omA94Y0dLM61GeiLYdY@(SUCe639cLh2-r`auqB;x2 z+8PMyApV~wHNoAQ&is2#8-8 zdJ%kvAPkWT6l5WWgE5By?0`dRP=IZqr!YPs4~+&=4(Pd!jEV#W84BqBKC%S23^xu9 zCrq*oV6ZeBdXb(Ni1bGotC17`t@G;6#nhun{AZtMT2*q$C2t6c+IluRlu>1N(Evfq z?P0bHhT7fXkl2e?;(luiKR@2@M!{`tjZC$te!>6aNJ(<3`dtT3U66hk<&or4i^X^B zvzp(Z3i=L+0e!ctUXkvhC0~x?dh%50Sljm5OV0VV2URMAEEZK0NlCr-h@2_6l48u) z2edKsGyla>qf^sC#h-1JYp1ifvc96VYt}J8q186WYJ0Pt5I5dXJQPQj?MZHhNYgm5 z2ki`M_Re^$-uxV(>&XrWCj@L_1(RCY#b?f5n(82aoOC<(bZjGNIWtb1-DG{4usJV58qmoAoV{2}(+(91ut&UCD?vGEdo(bmZb%HUML(epO z7+Q%q#9k#V&+Pem$Hzay^T0|kAIrgZvZ-`?o1U41n}~*--yw~ThOrDiH!sLj$aB95 zws@3wJDqZ;#eb|dL)yQtH$)1c^kCLV{h!G3xQOXO+k$Nv%>c+@AnRI(Ki4(_E~F|c z7B}_ZCyG4godS_>mjCF^zoVwXSptIruwc7}2iUH$4b%dV(7@scfpzCWHm1_u ziZO>b%)CFl0w!}t#d2y2%Ihh57PC4bFHmzHVYH5N3PZ%EuTZO78gzR&8(_CXnr4gr?q5 z{V=3WqBvCd4KRnhezv`9sf+(6^V8JU+9Ww`0N&~1_CcnhGFlb~CfKl$w&bIP7r zV@mSahfKKE`^9Be|Xm7^OsoW=F@V3CFX`S-@p>G9hSp;Wd6tkQoiAH zG&qd;wqpIdqoLvVM7wA0w&eARBF(pWJdM9Gwyc^r8;op)u9yFW9m*3gu40G$NAo~@ zo0JtoruU)`MkyJM_47JCXB$(V^irZ+E;(#du5roDWVtWrD+`IRVl}dri2vR=kSD_* zLaxE@K~v-LoY=)1>5Z^!#g7J7ywh?s1l_$$MK$4qDrjm?4(H-Th;5GrU18*^6Mk$s zlf-kflGUvAg2o@4Y*Q4AwLup1k8V1T1^N@!)~6&F>2<8_X%tD>Tsivo%=m2Km2GV+ zt^;?UvIbJlzLlE+dDxOXF=W|6&SyS7c9ob3Js+l)<0q_8 z=xi;~bL*Lt9uf{iRzpM@z(s&cFIyhhCFDN_bm)H>&<)uy1-|3K!2+Tnivfh&TvtzX zATcs<7>OOce5ecnL9zf1frG+G-;uvVbp|MIXI%Or)DllaU_&5-=xPz;fI9(Q{oV`# zY9zcH6A+7#&Hb=wMR1ynbffb0a0i!KTi4t|6pgL2`PQr7axcELYq-PoO?VM{-yU9i zgd0Re4Mebskbm99O}vwSSx=S3P5?aeq$&uxUFBH29vb5C6upO{{i0X_&uEbu`)XV!OB`xbY z;Y_QJgK>d0`CA|65fBRWUy_(I=HkOwFNVY48XV)JgR zVMr?gMuo#!SkwPwS^`r@dMrjQP_9v&y=|$bTgWX*}r3LF?h10;?Ze-V# zN~Shs#__zc!9>Ru<4i&Mzlr)lL78|cnwrKnke0*cpP`TQG|X3LhoR-F0h+$(m>6?L z8>13ohnzR^lDS>DKUZPH(r%QT#dfvMDml4m@pMpH7~jjypkemo6650Gu?LEPz}$q` z*~qh}c>emIbPgz=WGFrXF!7t3pVPK_VJOB7{w%!1PiXVG9oH15diOg-XgF<}q5L|Q zvwc~%rFs1*z8sYp#p9QS^_!1XzKho4$%|P3b9qsSAd2zY;GoY1gFu9HUParD!o}dh z=u+2sXJrsjfrM zbI*IvNgh;3L*v29v|Wxv506V08$Fq{?aPUAxoGx~#h~NE%z^vo$VM>Rc@$935$x`j zESV*1&8_CX8LMo@&prNuux`m{j0-nDE{DVsky49~P3Y%i?+q4oYJDy;S7P~U@(^@^ z^1V!pKWGKy;J?MSS!UJgjJ`M!I51Utu4gk6HRoFta?O&}v+DnznqI}>^y{Q?Pxn{x zlno`tqwkVr5c7q4#|fJbG;z!_$ErwSURpKAeXbC1Ntcmcef+0F_Z-c6>7$POCHdS; zweF$XLwrVUy>Coy6R?cS*j`lpJAdo+=zlk|m7xY~*m*8rQIdx;zJIx$UuhT${K1>f z)v9!fhYI1NLqDvoLkjh;22BQ7QBXCA1Qj8wN=^^}SA|4WPDE8pzzv71W(JuC83Z^9 zBj^I58d4ep385eWvfHS&07GC$KwEO+m~`)FL#j)*ZRIych2E*&a_xWY>BOiIjWZ&u z97rWsFa6D*>OD%(f<_Lvf^zkbRPqsn7N)mrc~v|0xzD-XgpaTXr#m8lQv8ssa6jx?ul&cdX7lc}a2Nx|0StPY(j_Hv4cE00YuV<~wX8o7a z-ZChz@7wck8Yegew?J@rm*DP=YX}g6yEZfu2oN+h?(Xg`fuOf|IQ_+zQ@sJej#?0JSNc2ABVx{uTzyU28q12; z!)!0cc9Uyn`&yDEQr3eo#|WzavHd4~jf>mH;TVakXH^xy7PCHAXt;y;*urFzm)m7z zJwO&tX0BOZ@PnGxL)Pq+Y)bucX*k)6kGl5U$BF#F2GCWY<-A(dO5>dex5#Ty=3(hH z&Tr%pJSCLG=N{N!S&Z?hwdD_C0qALWSVMgn=)HX%c^I^}f`*<hOI+Z6-1myxH!kbCh%jeQ$G24gG11N$__c@Ab@vhVJW!)KT-4a8Q zr=`+DBll!TLowvV*iCKa=~`X-`r}c&Z(FGui;?n!zW;-4%6iv&OpK+(>@}lklMT30 zs|hI`5*6S>_{X`gOGEJ4aOlz;1<%+-mg~Sdf!bKK(RQ+#+8NJI0L$!6Yu0CF#2p-; zD`79%P|6s?>au`Gfy&J6nTH)3O#X<$aJD*`O_WV^se_WFc=FcLVycTU{Q=(d``SB? z=307rt9UrPneP0r0l7vMg78 zC5^SCh1%^L4UuZ>e2p#^@wp|?fdCNG2+M|^9yio#vLno^Li1VQh+^a~3!QoZh1j!3 z_&iC0slsl3#Ine%M=xsLC(}fp_RILYo$pKwV8wf%!Cqw>zv$ zR?ZV)de0HNVhCSgA|Yz#mQSXp`|MeC6yD@4pp{KH9oxfb-{^k?+%zytyz#R;<_N4G&isZFsa;N z1PNFQq8qfk$=cyUHy<1(vn58YgHWk{wp?9)IJIrd zv!zz1#l0t#yBGU>bO>DUipcSPeOS|!29M@`@w{i-Acl%!B#|Rw`iPR%2#I$5cv#HP zhe8u|I&o9ZWpTA=IL>h01Eq=G%%Q8EGyS zQfq`_qXnY))vdv$1#c3T*&pw8+m&yD#XrwnHS9~=eH5JQ-mJ-0tXXc`x*F}c7|ZT=)2X@kr50ojPzSEEPNxh zPZAyi=YW_Dvku`OLjgp?VnRD)wCu*zA&d?kYQV4GW4GU{o=6)2iTZXl9fy;+VLFJD z37oe)`NM9)Ba58!nuDq=o35{2W!tW7Nn3P3&i1QP54~0v-;w*nWhzF7vNpIngH%?K zIkmMXyBiaK=AX#VqdzB^orQmUes4PW`6?OO zR&&d;;&g2rfuR$h5R**<((@FThGOApe?3?*Xd6*>Fic*A{`u3Y7GU~&H9hc z-m>=cdET$fa z-s#!2e^>olYCL_Tdhh6%CKFoyOxX@)55;V1DkL9u zaB#M;?CaZ~$cLCO4$G(GW|Zf^RAjH&e)r1zg3l8dJQ(FgAX9s^^eNMoMT^MwAvO0= zJCH=wA;=Z9kRwAFY%AzJ#YIU8XCz`*t&mcnq=r+w$+Ga^vB!Hron)0%=~i2DS3PV& z>HS7sc?QXnf$6Y-hba!h;wTabFck*96SxE@cFMR0s{um+$R0p|5DY@}TiXKUP5=|+ z%Nm*qETA9$3Wl8mkqidI|1B3cB;D5bX@3F-dt2N)MF9O1W0+HQ-glJr+k#^qM-}65 zrE62=^xsey9E*vsC;2{wclUG5_2@8sUQj z)L))WTL)KF96fS>>PULf)skLlC>YFUF;H|T6L9@%?Y+3uR`BzNp&83pM*7ps!6(h4 z#kB!gecqZ{Y|jX!vzj5WgUX{Ca?T76FVm^o*`f;8JW%GJarseJZ4ubgd>;Aa$_-1+ zs&bUCe%eZXuG0A`8y$=n3GMC1#7N`@2UVyLyU*^B8HS9aU2rS6JSGG$V+~n9yo?3D zYwoBCR_ikqA~(C4-(n{vu}y7OMB3}~B5-65{C4Mz6ObN`9(?ldsv)=@7`u((W&&KK)!nFGSbuwp+i zHbcD@9F5;*$Up;D zXzyo67P-9?{vW-R-jfJS*K*}~vP^jMXS#5Uzm?zKm<|CZAkzcvm#8)rdD}+k?RHAPB;q(jVvmJD_S|uGJT^G8T(Vj_{fRW3mGn`fM<^#U z83+i<%rT}_o+5WWw!jKd5jt8C@yI+}n0{rQV$Aq{>sGe(p3iK!PZ$WgDH&QVL-(Bj z4U71UM=CtR?*-n0zb$Ia{vpiAy|+gU0(Y}Xiiq%#q}#4Fq%o)$uB0dN`tEY(70J-L zw|{WnyEv9$d{KX4^SIh@uzgp2k?^6Uq1y7HV(GouPVe$Un^S_<3|;7x8@&5L&<930 zW$sLr38SUCdYe~pnSw@cgr!UjOvZYLT|vhK3dqUzdJL^$2nKSzK0CxfEp9n!IMKX1 zLAseXbwG&ODkx^iH1K_bvSyvi5^UAAo5?5mGJZZS`aA)l4&}JNdbnQF{k3CH-o+x{ z+jzyFFap-iMBLPl^Yta z+BPj7mc}D07;Zy$BEzEYOW-K1KJQQOg;#1!n!a>5jt_~{to7#&sEnSLY<7}C{T^=* zab|q^Rb3t(LQlI%p)5qw_6yv4P+zB;pf=XSQ6bYY$A_r5+X$s|{A+392n@S@?w7d6 z$^_hw$4D9$a&FyUZq;%By%wN{vt`g^uIo?Wx!0;-i95sT{-$J3mk9Iqi4?4f7aZIv zx(Dsz_dKeGm5SSE&6Ddj5Y1$P@{?N!at_7)xcy;$hMd(K?trs_3x*{FkjuiZaJjtR zcFKyuu|Yi6G|fi~;04j}(dwZ)Qh;>W7XK~?d^B1RtRGCFkX|xOzyB98_$}Bl`8PLl zsPz|JF+7vEa(0r=^6EF4(Gkp(aQH`gx7+UH(8-pDrPm|5?arudlO?yUIacN-&6Sit z>xaDL?W<>ws^WK6qAJsEBfN)SeUNLEmkm}WPkva(YRqtPy_R4aoO)(?Pg(Gge+bIl z9W)d589&P5dMdczGntD*5~;7Y{6(?^1hA!bEI50#N7?aozG7rC3XF7o7dm#u{=n5A zDp%2Fe*a1i7Oavxy01}j+GD@_gMc`OI9K<=PGlW-WegdN3Xe%nF2u&k+eTY`eu>`s z9I_!gYUFuY!5?AsS!Ct|5Dg7Y=@%R9SL501gic=ag$CG>SNy&5xZvR69pOqC4_8B0 zVC<`v?$`ffti0>qn%vIP4_SB$^mlyygeue_Qfu9+Kx(IC_4S22xq0IGv>5!ogs{8w zzUFQ16$p<2O=u_hy_l{-=ka)TcFV`U6qsT7q0-7wi5D8nTT4Gc|A)wTkjh!O!Bh_X&vA{~6)t1%^f-(-Mm*|@o%15(($%ctOr^A1bY16Gh$YoOr zx$W394@|x#>z^hO+`n3A#$&m@6s%>OT4?hb6{>_oHe_gf`rsaKQH=3op1Y!muyP#wl+AeDo+vBQIFopOu_{kn+p9^NtH?>1q*5=&FIoHF<$lQb&M7QT7a2_!X!IQPhZ6#f7ZZ2PUEm&~(*l{nGes1YEOgNjK zg=Qoa(8EB~85F|9tJNpSq}oP6Y`x2ZZZ$dB<*V)Sr9d4PVX%Ncy;;SJCudpvsWgG# zgk2`0c8*|nn6XS+V?qHC3B4n)U~VM1L?v$5(n6#)BTgNT*q+?jaXzO~Mh#^2abBxk z!mw<@n6%|a3%z@yB+%Fy{cS-*_B$)=-cL8WTv;Jy=6)0cZA9p6|KbM`jz4KEqzT42 zq6ugh=1hRZ^d8FY9qYB{=kKTEiqro*34VLckS48&Tl76R=+shaU|qh5o%ij|Zekqd z$bY>mrWe!*4lGD8_1W@Y-QWoGEDKglsrT$)a0X`jMLLqfz(}(PliUWOaw~3qfqE z#GKo0MzcqtZ&%!Ll!9hb%&MZF&OSpLrb|*&v&zOXLh5-e3HXZ;pZg&w>Ry72g_j}f zZR3d5x>eZxA#c!$;Xq|mq=A9iX8D1wj`myeN5Lqd*!$-u;jiDIukYGeg$#`87>ZK~SCW zQ0eUw$n5)U{om!YzDCQjZfb>h0Xyl6S~C?=2S9}mY(hbc=nS(jvfUv!9+KPn`R^~8 zhv$=DT;K9K{Lu7bbZyzhhTD2iT;GxLp~Z8PE5U|>;;S<>Mn9#1_NJ88prR5jx_m#d zIG7-I!|krL<$h$fhRZdK;l){IY)V3L7t7j`e|4dfowBTzqUHeVN&{o{W*-!vX)!9{ z&eW7pzP8x($j5(C-gaN0rxkFzP@R#$o|1{1XYPcsxD;$JnZK)bMLGzSYga6yW!vVq zHvKXfmvLW`iFK+PkGs1SFffBpz!sNBeNR0Y`X0I{&<>Cm{1coC?t zyy_ZNvarl(Hnr74`);D85ok1fP1sm6tkHPmki{RPRG<_)5RInCvg%|eF6 zbxqaOnu=AGVTxm)fXGMz19)fG1Yy-nK26w~zPdfz`Z9SX5Yx;1(htG(gbeRUon9-7 zp8beu00Fzty1YGzf^LQ$F)ANiXNy=w!Q-P;SJTflBr*(SM@g@l7oy`uPxUeZ0zTc3 z!ouX&C^+CRy@P|eted(gqzQHQmaZRJq(C0mkDl6$uNMNN#m^_Kt;>nCr(X%PtAw9? zY&Vq4g|7M1x>J@zz~UA@J2kH>v-(vO3XA!*0t*D?%a5(-#C}pfEJck2N~{-~#u7)>(RS2E z`{Vv-;mVfG(n6x;6=J3S&@O$f`rd*@v+tGWPPnge z;MAu?147U}R--T2n^Q-`a!;t-{%r6O%US%ChAz7DHPdny^xUlf?8wmO3oX<(VfHL7 z2r9{C!+f*FrS{~Pg2rOSFF)3480fd1>eQ+dTLD^&?+K!FUl`SJ2p z`f2~6LMC4dY~Y}xCjA?~^RbKg>Dgay35PSEWU#t&EP*CB0p=hxD?9N}-|oFD>8>q4 z_ASc>R6IT@HnvpKNu8l1@YJVbhKBanB@CU>iucLb=^lPy2$wyz2VA}n9>y5@ffuEFhca$QO^G@vkPjED z*Aj<_k4E8d_1AS{L!K^QF7u6ztx1d7l|-zlO>%^u$0vtaQ3jFobvga3<%Q(aU0&zG z$i3B$qz^^VENCeE{Ezau*xq&_e1)^+MN~U$%~VYAiK%Zd-SkxP_h>n&#VV>dRt4M5 z{SgkYnKkcFT+4TJhVC)3j4r&Eh@-Euk9WRz`gkc~YHEb=m#%<+7)mjQoeIkq@j%_{Vn-&;g3RfBJW2vCb8u3kgKZAojk*)=u-XPK>`ehQc2vz zLf&G^vJMA7MlyJx68+SUUx%Ur1UD?7wGK+Y)~)(62ny&8x;j-oAU0IaJ=oyx$STkq ze*d6Df-aGsq9Itw(KTbK!9PJ#woWC>h)-M2^#JwaQhML&3+={k;WC2^dS45HDx_ps zo$-+BT`lc*H)Pz6_c(@%AzkZxMNYX*+%7*pTwFWLwd6WO2#%*>WV9X$Ln4Ej4!SDp zPbAJn4V{h*=H@p=!JIv#MU<%^32H@xTRm*2E3s(pYuTXOYe)pGFNUDA%V=__p{;eu z4&{I190U1%@g`h#Xh)WxjO-qx^?oN(C+H6X8Eo?J^8u|$*&aX}SJ1+9~#WcLt( z>z^`NA3_a_{iENs2eaAog{^aQBqj08$(>Ss)N)F!ocPJVydwYB=TQS`X<2&2ze?v7 znbRwqTfD|4;vM-+B>jQboMXPH=98J?veau!wr=i$SH#rDl8-9<+ zj!EU+1hsdcC9UPQDjKXK`(#Z=)xdXZ1wCeUks-4G(2G{_O)`ZjvQ?qEdOBl-bchNt zY>sM(N5moB@6JH-ZXWj62utZa?!DITL7&Ust2zGmi1Ay_Ri)c*e|AV<=diod+`EWnC`KOSZ#)wuXk0nZ+Hgf!klE35K-m$%AI*MfnLYQ|HC+ezi6gB zPH>-4yg1FTmWNXTSBKyN-%my#?to-jQsE40@--hTEAeS$8c))lJ9gx^r?}NY!4qz z?!UB%HVk8o78X3Y0HhjHQk?>lpA~)@NboJ9XpTyeqk(D?YQj8wgvis)$W;6OB0B zy`Fq7`3`cgTzdAg#p#}%B{`o#{M8$vt~RS9rkl(<5Zgb<<#hY<&ng3wlgYm)Edr-y zYnoRdG07Q)dTrh>lOIfEGvK1Y>oAd866P-V+qO)9+8xZWxi!Y6nWn5du$52FPB7=J z5@vmQx+b|rW??DX8UCrgFArg}*_8PuZpC`vSbKW@H0P>;Q^l`A_E#_G7gvfm$psl(nv-HjKm? z_bI;>uW1Xugoa`ZV-Ry<(*rUGV>C-UR4>%|Cx4E>5s|k9b#Zg^XwnabeHoy)!pLzN zI@H^KT~p07|BjOA2v6g~!1-bE_jJFW7`CRaDLXvEs$PHQ7QF5~gO!{A#Prl)m_q(g zGKG*EDKv6Z#7()P_PNGxNB#7@;1g`|^B*7%0GdG?7y(Ifwb2-(hU~BOAyv2L-^FvA z{tpPoXB{EPRPQFS!8CT@J4iu=R&#NXy79zpmgO|I*{mzFg`a2@gyrrtzJ=r(botpz zN}?imdpnSpEp~bN{@M^yOFR(Bq?8Y=nT~cenx_RSFMBJ%*o)r^xUTTjR$P96u7Cn? zRc_#w1muB`YPJ%+f=~Zj2E&Zoq&$`ICpZfw7Q1GAc{s?w!SB|&q#7INUE*g>ve529 zNdzO`Wq4MJirj-c++w;8v7%A#DI^7{fr|^%-@FWdWE`TH6nDNt7M{MoSkna0PY?#B z_uGSmNj@Ti`@>WwNK(xoTM4N~hiNeaHxz*eUQr9SUOP#Bj> zywoj;gUI2mGB``#+K16QM4;Y%470|VE{wIrKUq%DtSK!%_qbLSo2E0QXQoF)s&6NQ zRfTy#@Pbp-V<^z1V?r3L$j^+7jH%jrSOXsHHA_{**x4Qof|UqB43o*iA0tD z7dLA){pJN|B$xATWrKsBOXFKt6u5ye(JU#xm!Uc$zTR!Ss3NrseoWDTxB>R_?RvZN z0}xU7@bq*o8w*WNQHy%L#B1K6Obl&8nQ+2Yx%Lzds>B@lgx7y&c7{ptDO=A^ilCmL z&BFZjs4cv~0IV+oKX}2RK9wua$XpL1WOw|YUp~S-#k$_i)xa1P<(UK5^JA2n`=Cxf zkCN{Js@13|r>xgoGvUlF;3U4rZ`>m7pJg)NEXW5dCkcW`*&|J2{Uz3NYvME^ADu zBi$`{jmMcyCi0_9QO_>Tb;Nh^cfMe6i=ZShXSq0or?w~3ufM*ex>1z&vMztKh3HwJ zwN}JCg8^e?@N6xUTPmt?+D?*J?}!+2yO$R>Bq%S}5wX|T?A!=|JXnvKeJgI~*~*e6 zv2NF@hMNQ3IhQTH%?Yjek1QhJ?}{L$2j=K{N;l`Kp+z&$^47#rqB033JL>|F@{0nC zW();Ej#a5ZD+}s1ObXPWW$Z8y}A_F4+p*T|Yz<3^0q#EU#j-Uy z^t?OZ?wQlRc}~t;ReWY*q&hylGFQWA$rr>(6R53gv%Or=koJDRjMPDuL*aK#Q9NaP zw&h=zqN^9$Dh+oxzb(>;Utl{O%l1v!vFCyezT+7;hS>o(y!UfVPUV3QQlfG@IQ8Q! z3(uEk{m}HPvbUk%p&?IdsbNzOBvd}&0zEM4}a?xVS zTU{6|%KKrjY0qS@U2L@YB&ha~nBYpv{&dE!{AA_Xl7)1arj5k6qL9HK6yP`$g)` zj7Cp~U#Out#4y3EhR#X@$yAlYw>gWq*)je8Hw%bs(od2OBWmGH+*%kuFYa_(FF1k^Lct$;C zPm0;Uqq4P5&~&TLg;091lu4r=@_kcvmH~?=C6rCm#jo)<5S)3oq>rG3@+ zO-}p(&{_2jHJ}8Tt+<-}VMSy*iZHa00`WSY!SgLGYTyuAlNCjeJ*Kx zdio?!CwaAKXfeM^;dJHG;#-1Es_jD8!+v(q(4VuryrB`(u=oDP#$)qttI=?{nK4 zt8C|A9;L2D5h-ki1jA78P+wgIpQp78V@pax>>3Tx0X7&NMq2b(0x2i4GtcoS1gE)n zP+)*NVqrM-{qv=ck)p0Ev7mi!D2zmU!o$;pdpNow$iBVpb~j%>oG=>;$NTXepJWl& z`FWEoag)U!`rg8T(38P-k)-*>{`Fx~4b8}^NPuCS z)9Ks+`AamHvWczS0sT7f^{7AH0J*+4;bJ@dGy#~Sx!wTGwkw}Qt=+a_&| z646gs?jk~7dx>gke~o86Y%a)6)r|kz6}*uDN4S$YAtk{rS4{2C!R&J!!10RQ)4swL zqk@+!(s8rd{=>!ASyAd}d^&~y(~E)|*jzQ86zu$Ga2X?vNdKGW%i-?sHoC38j?TsP zTv+wd&nI9Rj=}cg?;$_zeV_?e3)K1mVlvm@Q5Pz>2CuN@J1+>PAjomfZ zY*o4Ep)&r!@m}v-_nf0XCM(pjmku(rU7a;JOZ5^t?nnwPXMZaBrXnGsK^kx<%<2-g zFuX$*gn4D)c@)B${A{1ZKJnCGbs>M-QF8O@&7Xf?L80QECW(aR^m&3<81^0`$DWoa zRM_uE?(geNz+AtRe3y$JRZntnNd2)3qmE zlQI0X-adx?k|EL8%2Rpy$z*RFi{s!Z(wUsJnh0c>bW-QrBmXyt74634Vts;u)r}f< zs>gbJJ4?I5K{*cxkuRsLw>3~eB2Suh6yemogblUH`+|-}&u^5ta zQG!ezBp~wA*I+)y4?Gf$)-VVY9ckuva#e9rEe|y`7W7zFvUMy$njGc*{`Z@PD_7>z zd41Kpo?Kkht(KF!r<-IMgu+;2V(Id>{6L&fZFoI@nuX_UxR2Acd4oMe964!ktj$JP z6x-b`c5iS-Ym0+!Y-WG`Z|M!=^z5P!ySYvQ-bn9EFk#1Vst?7^a@W;=#5v1fLNMiU zqOx$F9$g*qoVNG}Mp>S&o?~S0k4_l<3>S1UGU=q`ln2983Va3bWW?Fwqi1>oZ&lp9 z3u23}e$~*DjJ*?TZR)TZ;ZaWVvDw)Q+!vlrEp#D40!))2Rx`E9C=(nn{vD6gO-{Sp zYcO2R2rYMj9d$^nv_Dk6Y=qUY$dIq-?=T(Zrrl9p-PhVt3S?(PJp-UZ8amb12*>d5 zh*Vp)7=bH*T}T3ioDHQBDF_Ha0QC4ftR*~TjKbXjk~eAL*%15T0Uoe{fDaV#l#mh# z2HSf+B+cH95B~2V@N77$0N|P+1bzv&UVCK|fl0hB^Xot-N@orSRkG}xb+!Z<4pNQL zrf5Ql-?QqZGi=YW^VXNwcB9DrpRo;&`0iyd`{`Qlkf6#*ZJY=1<|Y9Y{_&QMWM{q2 zyE2C3?(;tq1(6ONZI7E*e@h~@2W>@NT}?^~78C3|2W&)5$Cuul6HfYhO~<9t_jFAT zv58!C+B*{VwrWY_E9y09Vl|!_2!JZsazQCKcuBJu8Bt2V_W7?O&6E_4mQvp;5F(+ zS=7v>eL0^^%{2+d$IN#QL_!;g9r_fUu42yDmddn+cQD2qmkNc7HIm)lk=Um}OSiOJ zN`0P(F4nA@Z~MF?A-toGp zO(lIO6}D+D>k*Elnco%S@!&>;lS<(_ImQ@&HaT6HF6@Q=twUjYmj7~;_{ldi<^!_Q z#>02Ev&34fwlC0#IRN0j#XlYa_Kv^XuUm}pol2Jly^%cOE@0k1!xi1d)A%Znn-wZp z%L?9Tr3I&kXmxYLC9Y>InTnAhW}L=?_!kFGmGp#s)mRyPWi(4{ibm1`zstO*wbV9@ zAsG4el>FSm*Ci~jYs^W{-wV2b8+dGf$}+O{mm)FQEP39Rar*Nc$5AFWq z*-$pWP37P~ckh{qGw zYXbnv!VWUFu)CWuhyk14CN~)!!bbo+f%Tga4HX5VY7|=vtfCllBhU+?x2xcf3qeEj zccQ@Qhoj3RkOcyeV89e_4fHNtu#(sJcni&!=F5`HWBJQ~Jmp78-ZyK(%l2Wq`EGsR z(RvR)%psueU%nF+y-pSAE1WS7Czo0=DJ9ziZ}naWyatQ=I3W2}a9fU+pMwNnX-k6< zLNXE$^Sl%DI#?l&9rl!zGq>9~0`GeEYww2dkB#T1^+-OZfSWF#?B9WF|D>6FkMLtv z**4ZaP(K-!jHVk-rl>&Jh|g?)@86R$s2|?yyeDff{^Knv^tm1dRhXQkw=F+Pq5IpJ zdk1+jxQ$H5Fd-zQ;zV~e{BSTQJ*Fs$@J&uDDX(*7ROe?an&5j#isOGx2%Z$M8>E>ZoHPGVTHA%qMdqguB9Kr#AZNC z@`I19>NC;kd9t&RkVj%23xirnC)zhPF!eASW@1tj!8ae;?r%B{cjryV`~ZN(_qb%K zF3gB!oOaR9Jd1No3)uE&@Tx~a{`p@y9gKJAqBYI#Wz?L?w@@NoGd{n%*C$p^ee10s z(^dmbKa?_N$v%cGEtSIXR`E$dN)NUE%B1EpQfnw97LUiMONf?Wrs1%9r0epaK+ zI$bd41smmk4HlmLI)32gG+-<8wX1%Na~;bv>R69GKTR&r`_^u#Cz6$r-{w3jtKe_C zFdoU&KxTIzLeWD&f#!-U09`i4*ntn^NIOfEGYeSeEJ44Y()N zQt^?*WjHnrB$$OgiejSR$vd#AKH^)&2b}4W<+6Pi=OQ=d5^>G-PqXz^jH=S@m;|`aN_VUpbz`ZL5EM-}m)f|)t8@#@Ve5|w-;!9u(R zZZ5h3Wuy5{x%_&Fs=3f`9Bra!c~UZe29IZk@6>KqeE{g~foHK%c%;z|6Q<4K-<7|; zQ77#lQDfgx(PdPiR3l~VXm7jwXM+ireG&?3LD#LAY2UuAoDbn%UlB6ktfuW}2xj(4 zW9+S=2tBS#k&~t!8R*OHHa`(JBLPU=2x?fFww9OPh4cy;#SbcCewH(QSUF0ZfC z*YD2u?r@XhrE-0T+2inSzfb;WsGl|&-0Hx*I@u+I8n}pQ2P8ydDCvb(B1!tcAuZR% zag^ugib;7jIL0A6kiqbXk*aU=;?|ABed0)Z-U1q^=U3*?r)#$nsJHr@vnILk)c%=HnZmb^ zDxET)jItb~@?@gy$!zrFSYcHsg5h zE%jM5WK%@)$3{do_~IklsFnIcD$U|ZOdoq=`@XV_TO;4J^dyJfT`>N|l9%5%<9ouP zoWE%v$pyLcZ#6Q?TLMi;bzoy`OaS1`Xu1no2hIi|6~KS?Cfb{Yg=K@I6GH&d0dN7Z zYyc+!j0pxV(4Z5B0zePwL|{X}_U98ruC-y1sX)zwMn_vHa1-HnkNws(?s&@%4)mA3 z+pQ3e-Qshbern(GJAKxy;%fO}Z8fc#uk^}r(58NE@9EDa*pexW900ghVYYBi4Q5VT z<@Gq305%&hL}l9ySC{+S+v>!dW!Qjt=D$fbLI$=(J#Wc@ z&*m7gKvg+kXS%{sRru46vuUfDM1lKR!+_V02I!q3g;**C_I0FlbWVJgUlKJmlj zx0QYu0uJxSgRRydsGyMt8M%{ZH|b|io}Fp^lasY}u>N;x(b9f2C{BH)vCcK_ca%0RRtJM1a(sxJ$MDPCQtm=N4sxP__gx$YPvOx*;{Crk$$7=UbCPxL>!s`;0&JFl zz)-89uFdA$(?usW>&7u@jsF+jiH5WH<}({`34*=$-T}S;L2$HK3LIMmpf^FB14cpW zp&BZ#+6zDvfFlI8A4md|Gx+zer+dOoT+OKL1pDKsz4xz8ez)YK+hQB((e;K2E~h3w z9~8Ym&LYtHWuTnDzM}y!h^inE!|)!?6+4+U=b{F;{y73tcz_11Bd>4=iE}5nG?)X*B%jzxDG~9O1weoV4XZc(c6I1nh|y zX79USX5|54w2uKaq|`8Cx``mebH!F5@314d(P}(vmpdCDtIzP^KKizPWuhLt0OxwU zs$Bp2ttdO$i|du%h5>+yN&~AfTHjG;we@hAm(0ts^1Gn$r=k)+oQutorfz5`ykZq$ zlq8fiz(2v*y=!QUu}FXc4HRdbIkii~0U7-Kzm}?edu!??2F(w1`p+7a1^sufVh$0F z(c6bEteJyI#=O_{Uf@iwh7aK!(5*7fUQXVM#~!ub*sa{4joctx`N!pVG%|MnT6>@hlKqycPJr<19hTkV22OmF|gqDVzQu!Q$O583XAfHy_)-wd=Y-~~Xx zlgLAN7A?yEv_!P3PgaFlans@!B@>Aa=pn|^S;j@f0Qd+I979Dy9QJ>6D%ZQ$NFsLWB-&Sx6$_;a-%r<((o>LDf$f zC1I~vvVg&@#5*T_UTvznh~T7>5-U>!MQIK9Je!agh1n=d6&8JOmVLvDLM4LW%Eu*p zU|B_(uG^hd-Afpo4ZGLK;L5x=zI~J4BvBm`E0vT|aqY#`4+bil^0BG9Ca;vVwf~7@ z{Q5s~jE;}CUiY53t6{CTyw@`NWH6QYc;Z=AzUGS(?^hmt2Y(M}xLK-bvh1sMuBCpLs~+Jh{-4z+q&WX;^@*mhfkA$HcuI~}g8JyZQqY@3wF&(} zSN}g^4&MKSIVQd6GO^=rIT=0GeVQW?TEhYw-XB0?4d+ye7(@?DNye+45sw9R^3)1O z<(mDt`_Ew!y|wa$z2Z#g>T6__YH-EZwl`^7YCV(nZu8-e8^h~G$Q~lR!R-91YclbEzgt z$(J!1C0RFh*7AYT-4<@cQ+K&h9OdZ$KcwO&1a;|+rk+u6`l(-+Q!NatTh=pEYJLlmW6SJqS=IG!>ECsGj%$6e2gi(1Uw zOzLrt_@jRk!91Rdh%&?lEI7dCDl%zAx$Hk)hQ-_%7f6EE=@Z;Fs5vT|gZs=3FhuHSSv)1tzOEM?1~1-Hq21ZfPy z8>$}VyR}dauzomcs@}a18Qb`5{fyfOs3ZST%v(k$?GCPUYw^eL&sFaeK3J2!^8*YYzPhsS!4>Q=?2Sv6I0BEfa$cLfuIOK~(LO z5`#yD3-EUYKxD<>W#1+<1?=0E&R?jLa17B1wo8ny5>XYzaxVZpgwO+E=3uP-3G0qL zR>P|;Z_~SvaV#Uw;~B0Wdhw;(XjS$OY;2F0xJ_(mrKheRPxEtKr*I)%HF%-Dl-44@ zwi4$BLEPitkh*Be-0aDP#$1mNUhxm0qut&uS|=!}>=v7EXP?LE?NhCgR+|m~K;Q7l z^c|8mk;{NbO#`*xWT`|hR}sY`rUaDascMNjL`b3SXIpio?H*c}@+DF|D~N&2<~2)cGhzZWbZQiZo- zwX@N$e{G-1qo3%j$?1oTo*6ex8iT(xG&Ote1ut#`I&aPn&7s&?HTx`9%l7+`=gQx% zQIS?iGg;!d`nIabG<&I2DsbNh+F~8+?Z!>Q)<@ z&WAi?o~m_Boemero3Y-TnRfXtP`XW4Lq(FYx?i4mO{HP9^uJUpj7QVBtzK@hjotxYxxx0 zG27su9+lkhciGL4gxv2&ww$ted$1N}|MA9SN>C)=^_sWDBWdEg-@gaDlFa2?*uVOM zyBAmy!|cde&J7!LCZu}ylv<=qCRF~WSKgXG56Tg^q`sKtg$Khhx}kgQX8R8|oi7XZ zCg4ab83=aA>Bgp=oeh_B5V)P4o3yUn{yj(=^nTzQ|5~Y{(B?f3NF;;lYJpuDa5LTS zFS|Vii$cAHJ)i?uMK~SH_T6-{zE_LQ$Cm0u%b55u#Qy6L#7@Ks2rt_5t1ufjCJZVC z86Rl=(yB|jM=H=Z&l3x>+i7RQW&-mCcD>UWzz`L0@iuV@RblQS*%SSHQrkqjc+v1W zfOr66Wyz7?HNYF-H%b{AyWHmBy>WHId@Jg$&VQD}(cP|V#s!|JWe$Xs^qmOAvGx;M zg}~EvoeCWO8N{*cnLQ;j8kf}8=}L4x*m#|TAiPDZ~T4DYxLc64o}TJ(g!$U zZL-Jpa0~LhbFy4Dc^^fBEjyC0t4Ikn0U10j16DzL%`bVBJv46 zT>mYUfL+IIyI+5ghCeMGCwrnAIy3pKN;V*T{xtb7?xOkW%)5-=+byC(pcu)Nn~U%1 zw?PF0rS!j18Nk6F5Y-!>o$(q}D^LsvB_(Cv7HHCWPRkVj*8s1K(SWyZ2#C5yS;uQ5 zf1;RSVu}#z#{KU~w03|gN5cfDP=}n;%94w8W2q=6KBD8^9 zDm6<9V1ZG*<&low9uOH+-Tl{3$qBF_9Q-uxOEV)N(l{uavnx0A&+viF7WKDA!$d^M b!S|x;6jjXxqIS`Mw~&)kmMj-H3Hbj2uD5)u literal 0 HcmV?d00001 diff --git a/media/ipython-prompt-no-git.png b/media/ipython-prompt-no-git.png new file mode 100644 index 0000000000000000000000000000000000000000..4553bdf7e6827c06acaaceae995537bc5ca412df GIT binary patch literal 7969 zcmV++AKu`JP)!DXaw<;jRH~e~ER{=)oG4aGiX_;iWFCS@LWBs?Bte2CfCUzN zV-L*i-1BDUo$Wv7dh_PpGqWJ&`D&|n=5_b)`}+9x_jSLX_fX)$FBIN6+uu73%?P$r zrdkLAQU}$AwWHIFvVT1bNS*)xdJU@sCRkm|fXtMTm9(s{ zt!-7Cg4EO?keS>9JE-O%%7TpMUzL_dsN!`oU^SW|KzhRh$-Q<91+`~xMgX`3jb*cz zOt3B8hQpvuenws$JtOpMgcU>Hd>d$K)hlg=GPawmZVGBZDGyepnZb$>t(=4O=U;VA zCcLh`&NjNoHo+nQjrqos$FZigJ@QfXx`xu4=4!9kC0aZecc^O$wnJTobf{}hsMg0& z`k|A0fPku(HOe9V+ExPYR@bK80W($$m@Nd0R_tq2U7%VWGx>~x>OR%kthujaCtx;| z)-;#VShlN%YRg1yhq{KnYCvs-0AsTwNK4eF6l*)2W;>xZ)Wshr>b4lDp$)1#AQqIF zoc#0)x68MweK9En(NcSAVkclW395;U5P<$hmT3hht}4aMU6BUZ<^yK^Js~aFHb~2m zH3MeZGRk5z>x#k7XPep#X?`&yRBdw87aMHQ$Fw;^oASE239qXW$m^EDwg1SfJJ1PE zKGI%SwZ*Kv$yytf0W`d>F0#oM)G6GSHbZj78X7dTns&GCm~%c_Ue{a!%U-vZ{TIvY z+Sy@L&#EY-?sZM9vh?M)d0mwSyi#?eRQHojSk{Mv6~1W3lF_t8P&ByA|qEgvvN+ZjEn6D1v%o^8T%% z5r)ry=gMFF8}Qhev~R^0DvUO$9CMeqibw7z5Ii#X9Y>1N&2pVU3d2Hbdipw%=#-! zZ^oEJ6~Re5jt%eoSkE?^pq4UguPnV4%O@4~t1K%U+Q(jlb!{7ScZH%KT;uaaRJT8c zOsr;gbT;grwX{Rktx&bMMS4jBZRz*(l{L6RZM71ypJ-P@E^=?%HOE-GIX zqG=Xa_xus+4LQ9oiYW@wRMF}&TXlov-*qNv*?ub})hF#g{^Zo15B|gd{trxcLsNO{ zdYVMUo}TRo2X={Ann^AHc;;ter~mGe{Y8O0bN%H+Asu!He*ehl_VrF8ga80z{P>Rh z|Lnrkmp5h`tf}h=2}{R@_hJmMt-Sm8`c(kzcX%Jza&#;(5S>nlAbK61-#PTz6C?Wx zC?h{MdGfzr_}fdjrU4-23jF@j&)wNKRnt3l|9^Syf4v*Mrl>+YsO#`~wx9llr#mci z{QA3BK*3oX)J16919y)dKOnzXoVmI7&i^?h6pAK12z?GO^@GmX!O_tF3Y_2&F`_9tlUP@L63dn(Ae=(>UY_6&KOoE1Of+5002!A z6hZJHRgnRp8R~jnRM_tz2#94^8EwJup@Uu;A&8}s`UyYX&NiTK-4{*jQa113wtA8# z0399Nb9VmqIwc4_yzQR7eUqXjUR~D>*KIWN=THEBG6`KRt79i4h74<6BN$mMKg>^HW#Q7r#EQM6gF) zj91@&KRLHlx%vr?1f-_m+E)?t1+6rSCi=6pDsr zUE#paM^5<%dNXTLr{AlR`lx2A8R12|aEl3eXr?F>II)({BCl&lj5=G7x`sdq14fkg zjm}LAm=ORVgm#3-hW&l=R&-O&T|HY7hV#qs{`ni<5+w1VZJ+q!fnOUB4)%K^^QjdD zh+I;|>{4dE&l8!9j8g4(Bp8&^QndODn(Ft_DvCpxOnU8AD{mQ%X9Zn9QpF0 z&yEEKMgslU6N@{-qXeLf(d+;DwQsTl_r%nx&)@m@P@p&B2{9QZZ=vPX#W=OJ(pa$u z>KaNdPktkn-$(%f<#bFvd>`d>Ts`xmz;ecA5$c)T!WW7&FTBd8vjBhyV#lZM@%445 z7H%3^5F8!=gx-Go|3`L=4krH{r*{I&SP z!GT?){sEuElVNjHkqH9OQf4h)NRtHVpC=Vd*|}}E9J<-;dSqO>haua^y;%` zL6kh*UHd=xgu~|r0HMfU`u5+amse$gsDJn5*zp6N-iW|*i5rV^FI_0aQ>Kgo004p_ zw?1&fKiq%$yZ@NGwV`fhS?bpvf`G;H&=h&W{EQu+S%_V|Aqislj`7CSjq3}sD>o!j zjBHm))fb9DVJ}UR<&d$+iP2=4JqUr%MTLBH$mb}11%U3Lb2-YyGn^nwJ{RSn2~om@ zsE7f3oMd;vfe@q^o+41tOHmbAnj*qJ2LK2nj-^??qCMbo1ig;Z=SaY@u+C)iJOI!n zF)`rvx#@BeKwsFkxXxtrJObo*(?K5{mRS`EIu_QLOrE#o1PKWN0OXm(E6@JLbKm>Q zwM#EB+4#%P{Ka$M`^xj*{mSBvH_C0~aK)o@Km6M-`2syX{o8)<&EIAVnH_shp~^O1 zFfu&4?eIUn^7O0E|E0$l{`iAm_ISf4jgSB@W!5A~JTkP$L%XZjQTg6V?N)nrd%$p7 z#u!h>=Q)9oxPybf9uMuB2o7NcSL5@Xq~c_j0~58haLKUK_1SbA&iGLMB}f8YOn z;1B-z?%zH#v?tAGWBH^giRSdz>L8awCYN5k8QC^QyPTyf{{9|Uz_)R24nzq6ika+{ zGcUgX|DIhq_l6`XHXopG_vDTTPo|bu-}}2~W`FYY;K<;vU;ZTRcA7Q@jUGP`**1RV z`_E@qZ)sXt6AS==arE*G<#r7n+)dDwGvFIOyf?dYE4v;uqf;odk|1iOiYzOYrUUEI zDkq5XEEh``vxO>~RE}ii3PLPh6hurQ=n1(f5^=ngDewRg@X!>6N*@RUaRSa21zyA@ zSe6$7fD`aWnvJE3@eC`7@*cryhL2}BQNk2S^n{!QLIBVkc6nVi#yFMZHqu2w#14uW zh`6is3jkn@W9j0`MxGO-a#_OKuiB_mO$DyFbmN}@P&hKuH}bKi**BPMT;2p&lCsIQ z0+Y<=64`XDn9pRAYi>`d+C*5A-gx=xbo?d&u=(^o5C3kYe`|jBEfY3i0Qev_OA*vW zaA+bp*wFH7VxpFnC2rSva463g`@IoP;HTsBntOnF*RxGlns^2!@1blO&007-Vr_V*J=3!W2 zZapVTm??^5y&eZeI4GhNyM}!Z2ZelYI-BSH9vT3$d7c*}z_1c40D_4=!by__mcO}? zmns_psKPI%D9*3vBnfl8yT8lrq)C!MAc5CKA_Vaaw-n7|jG3Z1+Us#SNGDAcDzP+E z6jx$-i~#`}h`5~&k|dBMVe=~~f~Y&4pjS%W*HzZXc_zu`%NvZjObkns)9EwTU%`qO zQt!oP+_dZP;O?45^2Ix9;HnXIQ^o9ZW}N^u6`2?d4)~p(L?OMH(H-IyOimP@zVyQ{ zpZ#yo&YVjYG61kWJo?4`pQ(fc4L3sdMV2wMyvFAXUE9V1A=>2(j}Is2mUxB%6MdGN zU*4FW#gbHl8gt7SDjE00Ek$+aP!j1(SuWw2>>Vv26K6t+qx4JC-GO~a|Z`^ zO@sykfFQ`l>{_yz)vrty6Jxj@U%Vb)eEQOv-`e}wr?%a_BQiD~8oUylGpbRoUKOdG zOy_d>KRD-QXwbDM8$e-Ku>yJdXkFUQstzFRWrlrcw z0ku>EF~}rJIF;kQPRi$|ND`3*Dsm!I6f_jKWDnMCKbcXc{=0ddsZDGDy1W*x{0bIi z{#hni$ExY%!b&c-B{)>QB1xhki3me=7s^RG2tcAF@{*u#N4;E2EN}up8W`wxcLBiV z*bQFf0YH+lAcjUZ2pm4IB#6~JH-&gg5=DpKXE;honsx>K`FKjKY(BFYM&x-{S5Tv} za>Zr^DZbdEZkOK`^1Bc~GFzVa5kd$dj4?t8A&_uwuO!3py&2#478WwAcMa^?-@o&r?VpI|;=ep~zt7=WXX3Z=aaQC2V8GY? z$c}rm923hYe`(7J7v;>dOuV4Fd25ZjxwR;pVS4Y_=IifC%r5dK?t%gU<#Kv^y4F9q zR=ug~>5ZU<2ZX8Kks@h&=VK3Gj4yxp$0ElAfTuf5P!yNV$*uSGcW=G#7_*U@fB8Zw z8vsaxz~>8|?hxsA3I!GbJdqITbg=2Hyx!%q@#OqVuUE=8;igPb*X1B-5+Q_KGywn< zN%Vx=7-K*v5_AcI003SW*&T2cSg|+cLI_C`<}3GHSV7F@`AEPC0HTC5c>&A9A`DQ9 zgPk-P@KBNjq9n<0_Na=4f#pQ6iwgOiOi>U;+#7NtgalFIcx#c7zEFyAHkZ2PatA(k z@X_e%G?v8Z%GCm+Hc}fbASuV;lfN}{`6ZVtu`m9Pp04?f@lKA?{`==+4 zduUhXiu9w|pB?Pm)#VO+>A;hvi@eDH=*GDuTYp$bV}zuN*`>_dfUg@N6fdThv*k@x zjPVO|ubmjWbI{-O#r?llHQ@QV^D!nN0e<$zxgC+QesA}GJp5ES6-%!yy|tLuS{_@V zE?;EhGYfsYClN_*%)BOFQ@JA{Z%+gvgdS%Ax_l+FAGq=8xscdMKChNXEQ<15y z!9p>1c_w|coFoe3`lacekDi)*=-#!r-go#s*XmKs>{)r;74cDzc&=N;FAi z7_ROf4+6lD%yJZgdc!W7)V)hnpOh=`v#Z(uF1OE3A%FraMAK|C%j=h_yJ8|nLE(qK zkh^%czi&h{hi0%--F`yHKl$%_hNgb}o!?^%Ikh}mrCYMxH>&IoH#WXj{|Vj@!n00hX_?^Vem6M{e?FO3i?aAKYnWGP6uTw|I} zk2k%%*O1!#3bg&I{x)!(E^AT_vTD!`8mirIWjNh_>RLjqiUJzhrmkhp+UchIR0)ck zpswZFTBf|D!OYE^J_xTSBY~Qf6pVL}of*wlW>#hA%b)W;7E2{FL4PIBf zXv5F=^tGGlLmOUK-oa|cZ4IH;?YXO9s?$a(|6(&>w$tT?A-?TqG@x#&r8X~MF2Aq9MU!0~s&p&2 zz)Q(Ir`NFUSwLg^ZHrKkE zn>;!VdYe{{=E`i=T326Mp;XiBmc>-}*jVc-!bY8e)fzEIHYB$;1cFLgL{z;h!->g4 z`7V~?dsubKRgBa64pdIE=3BDGZmcbBCvcscU&uw2eE2VwWEw%eNp70x_Bl#dvaFac2wdgN6 zb?eS26GUwrS&(ov%SpG{+g7AQU9+Ga>Q;;XB2$-=Lk3(_>9#EfNaXoECmJ=O32C(0 z9uiW1Qyis{^@Ev4Qk;=hD}pen9IjO}z>*kRX9w2^6amzp&a0EzP`AzuY70+CkAW4+ z*}G9y!*MBfpt?`WfmK0LB3mC7W=5sy=Bn*WQ6$mpbCixrv4Rw5`1)tTG&^I^6zO%+ zB+;_lkGfvh6o3ptV`6WU*VUIc;WoG_Te|g+=~>6KEe*(K0xf-@2Cr-FUZai~X2o=2 zs^oPLLft-x+d%>V#&{#gm0q$?-%s{^OqbW$8*~GJDB+t4roag;IU{O3kmnwo`B0Pl9AZKl;85#^SZ6nX+}C;cTyEN{x|lJzewqKL|7SUYCo=DaTMcwMu)KfGSI zc_4+?#qIIBdXpb2Z>(t{5K!qr2|&bHQXy?siyYO0@S-Sxp>U=kbLJhdt1lg|yQ#<@ z8LvyJ3`or<#9;uWn37D&%>)ziIh{1g6!`>G{~F5=k=KQa*HvvV`A<<*(h-!rcB?DX zKCi1ku4*1ffB5O!S3f&!j@PxjL!~HO^STuPRG-p-tWeyrKdoVx4X=yBpZ<5u+dt_a z7*zw*0K-~&8VxYrOYP{+whR%2dACH}W*mUJ)#mDA=tFIpV#cqUrmlY8CZ#phwW`d3 zx-HS80BU$HTurpP3fE6b4H`^=*w1J|+7g(_0&3M{1kl_gBGj!mR~Kv{uX$6N+8)zR9aZb>@SRmrL*9qP6~j~s|V1}7Oi)YS*=P*)|Z znslh!0zFkA$^@o%j#^hLI<;{{WO_&9!?I0f9#nn#S9%jLZep#gZne3(lx%8Qy=z-E zX11wJVJSW~lx@y%{myCec&MkY^$oC!7?qT5Q&o-~HZ!=??fCF{UHw0spe5OKuWON?a_P2b$gG-$J-UVVwyp>9*i zEu*fL_XFumhq?eA>ROZzb-^A%2=$#0d(xpUK!>^(r9)k?K@dtUy@^*^)Vk8JF%-S7 zm0$OGb(_SdMx!bts2u3m&uQk)oXyR78#Pmyi|WqrwPeW4jFQ`j<-dDJ?Hvi5jclgf z;`gy7H<5|>wu?f-0q&8ZSafE5ckF_Jz zX=7BYG5RzY8Va#^i>D10sSlVn0zIUesAiN_FW!!Tc{2`dm_$~$iO@RexQW!&G|rmN z4t4dlwOWj+3s$MCB^~OPq-K-azEmyOW>Qz4ZUxR_7R%D1t|4SAsjI!sp~&+uo4WrD XYHQ%$_WFFV00000NkvXXu0mjfD4c@w literal 0 HcmV?d00001 diff --git a/media/ipython-prompt.png b/media/ipython-prompt.png new file mode 100644 index 0000000000000000000000000000000000000000..931e8f343ca10f224c930e31a3d342d82adef23a GIT binary patch literal 8198 zcmV+hAo<^kP)Yeqc;7Ar{m9 zZ3hR(^$w@D9N!xZG#zGHs=w{v;JB{g)Rv=fpqU86#`@a|4vy;=PHj2*42Fr)Ot`~!I-7!AeV~E!O=y)K^yB ze2{!X(%&}pGbBOYGik*utA2C$#O0w_sM>rE<9;3mBZA1CJU(~QICq3(V&_O?#qcmpHv6!`_^6ZX1A%`o;wn?F2(9${i z3uZ(-z5~B}HRAFlUkU&Oj~sUQ!ptdS%HH15cKFn_ms;J3g5t;4o_zIfM^!B#RCwQV zb)NCa%YRF%>w1H)#r)OJe>-gDqS24vTk_f#Tlu-(9)TbTkyro#0ui4t;6);RlYEU3 zQYfW5eG17VO)d8BpDWcejZQ@ngsH{e@9t5O^n==7Kad2uYT{jw&U$Fi>Af#}ylLU6 zJI3Y|KQU)L2E6mwNBt+nICKAABxUNCz*UKl-sXM}PlTGIAr)ri^-I zm2yC)yQxj2QuL}cj;?U9Vd~h5e|^|`;6yUk-q29KK>3zke6gtD?uG7VQ_L6WRrP3; zI$P1CPF485!GNF30=zi4uG+?>cKz%}M10}YAyeKxyv-Bxjm$0-3q(Jj^B89Ft`i^k zm*8TITT06MrD4a}+P*zxz-$eetpLE6h{yc!KAu=u^2WPVIEfu{5z-eAi~2*A?|mG0 zc>n+rMB#nQlm@-yZ2c8$r{oU+gbx1dFKHtSa&Di}t5N_Uc%DcKcYe}S{tQ;LlB!b!`N%%ZLiedl&Aut$qa)s36_R}<@Qp;Et z+pTV|I|u+uwKOA33jl4+wsIFic#}#n9{KkRl1c8)l834!>k|DzfV2l}t zZE3JXqY2*`5lE+3D^)UzVr&*yz}NK{CP+e~Q>oN4L=ZuL$Zm1RYaxUTMx9(Cal8C1 z%c|6JilS{6clWwii7vI}@r9%3++RHB0d-n7L(^?F$M(YTR#x%FZ~ttosk@?8GM#qn|Nf-u>%&z$cgH^wD&*7t z_b2Z9rjwihi5W(bp`ZTzPep1a08qiu!QcGJajx582_k#SxFL(?%Cj=*aM)5-S+V`2 zV7o2(ZXx)*!qv-FxyGY^e8b()1ONyT2$2NhAw(i{$*C1gQ7n^~YNKOR@*_se=_>Py zGb}}?jV$PGDFE=LVuc~yT3SVi&ySmve4cUk9Sef;%O1Tv6`)=@M;7x-H$vCEr|kz(u#%-UN%>moyo*vmeR_z zJ3bHDT>wA`_{Be5t(`T;Z1t+ zjuMbsotno_sBI`1X=}0p#MKrlRWePQN}H~V{|f*a22D+Mi^b%MMQNoZ=P(mSJo2~``ilWV}_D;1;(I`^2%J|><%+%`gMwi1E z|9-*9fhx7E!_3sI0cq9cO&*sYA&5sI;s=adrO(uK*1dXkO@yj};761rDWT^EI&A7kLTK~?0_ZscZLcZY1d59X4;~yk|DHoGjb^#MA%x>Sn{p;Y(in zg;<#w%zAD1kDq;U`x8$ec;jt`x=8R#o12qr%zppTjsIG=K`52n@$7$z6!I&Y6m+^A z)ivp(hVv!j_$R6XSrWC%e6kEP3;+aOu4AwN{qS#JtJ?WVr@D2LJ!M?+gRAXlYY%Pu z^O^T{r4Gs+zu_T)Oqy(uAT((4y!4{s$N%z{yS^#@8OAKjQZy5$=s=7P&`g+NV?A;h zFg71As!P0a$}p+8@cz4;=NgW_@@Cc6Pg3%8ir23Z$hzjD z<%V>rUVG%FzaDzwFFdh$d@29{%VJZD zy`jbwjl{awy?P`b9S9+fVUXWrJGArnezyexYD>OMNgEIhBxWT1ZtEwnKT%h*k6|bP zVCdNG_x>tXpWEsD#=^m)pKkU!T0OSrqo4e3-UGi$(dU|LPa%Zz$ISECn)kf*v!FK~ z=f*QuKGWR@hK_yx{)=u)BLIYb&PD70tQ#<_@yvdNP{G8-ewXRfH=c^u^}E^^KKh6B zoRLlC`vJgZsXwsecXJpS=F zy%Dz;04$|d(lkvp5R8|H-M*4H-m{ffvK@Uje9cmsUfb#XGT}(W=ih`JuAt3X_xaa_ z_br#|b)MQLKuAA&c*y1`duM0V6L+%E&=m{1H_p;b)%H*0o^s3|81?8q%Ir*g`B^|H zW5TGg(^LA^ws_r$+gtR=D%F52d&M~b2wLoCckLN*-}1~!qcsJ2m}buH+H>La24jp_ zjEG){P9z+wKW74f41-454qME?q4W3zaD{ zx6`Lil>>ms<&Q=wjB)+BHiS??;Q+Bj81RSd&bBfg;eMjSLZ3HSb*7P_nP{HgI8ZN^ z2zfjb5K^e52q9~`v!=3zWm&&RlRq?DA{B|m!cZV_{rEhAhFTNLuz(;ZFC$);xtepK z3AM!-+gqw-3m%!e;-|HzzHqeFcUO0eNh~>-1F0QjSWU4bT z#wM3JnuK;=$i*i~5dw^xj+b=*%Jr0fRsVGBObiVe5$PZt0N+%vS8)Hk?Za%*}Rns_FvKu#{L$w zaNhJGch0w#RQOERklpEN=(_40l|2IAQMV7XnBaHyRV)ysBZ;ted@_nJ6aoMu2!UJ{ zc6mC_E@-hcJ;xbQufMb3!Y&UmtUxM`*A*${VV8#rCZr_fa0A13_o>atPHTq^DqOn^ zFkAZnwuT%%A9z<2D#pZBEEc0N#t0BW5&#hJg#v-FQYF)9RSeCDB|?T_opx{XIRw2Yc)bdz->La^Oe$l|6*AN02C=1Q&;?V-l*9kxf&sa5Mp9IWC#Ps-4|BKwzDqA7!ZoN!CgZqF0q-RAp;*hB`e@mwVUvW$}henos|6&udY-kN34wr0J%uUzay!f=H=A1VRWg(Oxux zG463KCVgE-y*_J2b^6F*HJ^Q{Fl2~R)aFxVNnY0CRQ0eGOZ1}(1#(&Z7iD6-OY!lW zEPhkFqw-wX;~BSpon~-u`>89WJs=)$(84((hx5#PJLzy30HR^vvEOwuC_a zw$`BiWVulJNzUA<#u*b3LJ^Pe+^+vLef4epwil%+3+|ksRy0%~lVXGrLTt~zI`2;C z5t&U~?U#;XL(iK5p{~@ro_EUmr2s5Nw;ei}IewJSWOY7s<4ldE*zYpLX}t?e%5m`cl3?H21-m zQuVo?ZQkgzGyy=?ka08bc{Z5_Fkp=FWu`$OK4H>vg&~BXLr`$ynnB&Z*;N`xC{<2g z_G7QZq|#;=&0Kx#lfNdTAg!*ppKW_~)5?V4x`UpNOFqfgWKS!&O~e;sj8C_mdG>=} z+5Gk^9;#RHMZ$T{Je6w9`tC;bc-V(6b06;T1uWIwA&bp7O7O1uLl4; zp+KTZ3A9@~J;9L6&BS6Nt%{;U2mm1xA(B7@LcGggVBZ0TW>}ixiA5I{u{6`L_h7@` zgQQ3x&rHv|W5$pb3p|aj?)nx&z#n=4oie@d^qbp)RtEs23>sLlYEiPSUhz(Wo;L&T zCco#^J+BmiFBRu6ofCGtrP@^E^a*vJeSP7hnji^6D4@fUzExa;hmvqGcz|~4MIpiu*i@`r=d2g<1aYZ-X8SL#zFy3^Cy7uhO&yS3 zwfC#q14o>V&CbT=u-AvK)nZ3?V{_Q$HjFRU4Ig4DtBhT0EZ-A>L@dwDXgzYG{nQ!1 z$>KLzVxdry!!A<5AN$z4@jrf;>8 z{PK)+zBDl$mh01aVo})X0ssuaVuoR3(k$)xpR60Q>JH3j&!1=e9?;=P*yWLD>521Z zP7qQJ%u2~OB9dStF;9I<TezVPQwk6+Jm}R5>fKVYL zg^9aEs8$eUkGo8$l=C|#C&j61L=v%JI9@m6@rhGZd}-n?lW5dH60wfNWQ5Sbxlp7BB(1ag@qMddeHlOHolq#|{SEG1PgmI?uYBnhQjs!oxKC0$`g zg;J_FXw<24gHcBih+!D2BdH(~j=DRh*BF{{T@XfKSQY?8VquC#nUbndsHDV|!pbaz z<8y1;G*wzgN{U7iZG?^o&uE0Gf9|(e+ zzUt>yhd&a_)DxF%@Yq{yO_lMwRY!IYo4jnnqkkwruv4l`9lvnBy{*R5mR;@5<^D+E{B=PWrN!Cy^tNAYTJ`Jvw7lX0Me!EPTFd|E zgXgb?)B->(6!Mze2TmSW{l(XQhcjb%LDA9$EZrp#so7bYyc__~4;{=C@QuYIC2Cd3 z?J=FH#23!k^tSb2sJ*m2Yw~!4N4A%o>3&Da)6?Wx83-ZuKqJW`wFQHON=4M`bJR6b zk!aBFNG}@RcJx%lH;CO4VDL}QI#9USxM{o@{gu$%%k@gKeVRt{|<yh=tm>k5+dAqZ zgb)yl%nWIojzEMgL&p;ew8QeFzChUS^qXw}Ak*t4x>N*k(NX}Q!x4M=xt!al$PMY< z=5ARK80$tB`v{70@JawsN1W`H5#XmPj(R+ z#+FkRh6%-km(Fe6cSw?|&Ym*nyq$dzfeKbEG#x1sNF{lTXN7DoZ;L5j*L1YhFsXRd zLn~Vkoe(Hwc?)I++AN-?L_j&UATMX`w8sB@AxM8EO)WZn=%$5~>B%^Qg%RF7q`-Qv-u zsR@z@1*3j{kBB_R*y9SM=~JaL(XgU{01ygB%1+e8^LZ}?%d+jQ4t1(RC=wJD=5#h> zF*&1Asvmc9=!zs9`)o7IGNWd#9e2mW3`1KQ%Rbw@(P63q04fst@}1{q-}}pTFYU!F zQ+N8SGyAt|voD^gcp-IVUw`%f3zL>UF=pO_rkWEKhjyjt2X_C0tG&LlZ2!!Ao>gkI zOm!vuwmcW~B^GP9Rv+2@+GA7h+_>cN*E;iU<6bR$u>J%f3`ItxByVzR{1~MpSO6eNuFA7iG?Fy{_eHe|FwSI);BT3 z)Ez!nwtJ5@FQ@YhLuOB#`Q)RWlfpBf`Vjy$pDf+_*iWg@_nsQUxV@x2fBr0=+2Ut2#MVRYf@<()&(!ZmjSfW7M6!Ixg8Ly^<(Y%98V#q5`!Wm(pGx}s_Sw~A~-l5Msf zIRzLOEWKmghKH$O$aJE#YRAVt+-i(%71hQmmL0NW{%y}Z#YCg+ zrR5ddKZ>|L7p)uYsEaYih&9ffIArm>&XM=%$JPSI4SNrs*|G}&j58ht@{@O?Kb51#$t z^RZ7pFmT?qnqB|t^d-}ahvzPw)pqcNueCi%gOeoS4@V<0rAo$PY&AJs8ZF)Z*HAD* zQM7>IyByvN!w7bZTOi;Wj5>jkpM1Q?CA|o{B>&Y+RmQ!yt)dwEp9kOX^H^r!KmHpzGx_zB#G>SdZ|q0^My>!wo57U&B3j^PXfm+4hF!O0n9K! z0Rsr34xg7q-O|e<9)H!=-Ti3iHNex@dgSH5^-I%YiBO@EVvOAmFMX3f%sSyB3D*_Z zrOEvt0Jv%gx&#OT0+JvS;(Nt_L+`mRf9P)Xhke(3pL~Bf-9+7w_1@~eY zj$}!wtyCt-FzDiG_I_W`V!C0rL+9YQmSBuAW>{bV01yyBB7!8YR=|PdrXr!Xkw{do zl%{A@06@j)P$2B}^lsxT4vt$63@k9fFbn`fh$I9g!RIuW<5DDoPz=p9)|qIE1^~W* zXUxsK+FLzxaNJB_jAWIKBg2lInH)Eat=tu2ijBqf6;0lQ=kTR4~Rg z6OGaVhK*uQb2)m_rM4`~wltVS!3ZQ$jx+elZ(z#7!O;oEG!u={0h)JrA(ix?I)`^IBt9}X4qJa4$>^Axf}rJsVxAso9tds000m|Spza8 z(xl!Cz`?Sd0#GelExPYD-gebG<44S_`p6n3Wd$G@QS>A^uY0_!f{1!}`1dF7cLwqmRH0OED}>5Ii0s;FhJ`YMigOa)q?hpLIDr z4y&_2tm5FfiNP#O#aNmkNRki|oaWv#^iW%pB#pV50wEs&s90A>frEpiufZ%!vn)*z zJWg|O5qhYtMwdvl#Tc90Y}|4(4vwo$LUR#GlEQv`kub+Kpi6B90zu~zvQRK$YHsHu zwj3PS1{O0c9pW_i<|d)G2qA+pU9OM<0L!v%&F!I3q+bo=;JD?8Yc4_rNeBpn&m{xh zWF(?RGPyJ}J1ssr=Jf>HP5t<8E)I@c8jM+*iBNQqVQFr3c{7plZ3F(`;crS1LKtJf znEl=_)8^pd_ F(o7h!M90=*95*}(wZ#}?<|cnB5C_K%N8Hb4*ccaExC!9il*7Ss zy%X15#6}5%PZENQz8;w4`Ue#i74^3b92^`RH$PlXH3tU=$F+b{TMiBmj%xv@wj3NB s9M=L)Z8XqwB>(^b07*qoM6N<$f&>E%&j0`b literal 0 HcmV?d00001 diff --git a/media/plotly-streamlit.gif b/media/plotly-streamlit.gif new file mode 100644 index 0000000000000000000000000000000000000000..9d4a19480bfcbaee9c2aded9281458e5ba5e5444 GIT binary patch literal 144880 zcmeFYRa6^H^!A$|NeBc2#jR*@cMtATN}Y8ejQr6CR!8lg{ApjNtB_f8x;DrBo zCnJPW5s`7hNXTGhV#F{wF$p;_{1Gv=44jk_PQwRhR3{~)AS0)yASR`tq@kjrrzVC| z3!BmK8`8)+((g2MbV zrUJsx1%*Tf<(&o1VuXangv88*MHPg_%tfSLi9Qb&6PFT`v=MveD=sM`E@dx4NiHcR zD=F(Lsq|D*$5KXKMMlv_Rt_Pj7$E1EAlvUJ} z?P68cG*z{eRXyITscEWfXsK)JsO!Ad(9+k?%hJ@;(-M`@W~I^A(bImKryYROF+}O= zJ=HTR))(W|4=FNu`s}Hu?o&gfr-siBJu;pti99nhe)inh$inG4Kf`n5m(R^UKaVUo zF|#&t2!8R>?4@I%shOp@k-m9kfu%gBg2#wYPRCvv%^a zv9q_ace6<-wDk(JlV-AaaCC6;baZldR_1bcadUBXb9HlfO)GUX)pC1n>*nF-?&0a_ z<>Q%C?d2El?GxnvrohM7&oAn&zt$7~fI$D?sz5!ypx}_8kmz71i#JI*At7NQ`PHE> zWx~Rd$cX3&6QPJNO;O=t(J`?xZ@gkM@?r{WVq@cD6YAo=G{sv=#m6Ni1iem(Pe`;? zNJ>ghO-)OyZF%cu{Pt5tMrLNFv+}#F;`dFhSy|cH*&lL}kRQ@xa&tfC`Re55<>%)Y zw&1sA5j)FYmHXo`h?2Uu7YUOFv7xgDmi#V?g z)fW$@F)1g~Yc_ly&g6VnVLseYGMX)DI}**6zA^Su(&u1hxUp>V6Cw)Apw(19RjiRP zN1xO5Wv0xaSSw$vx#CCVi$-UP_NI-wTC3hf2JM!r#YV@O)Z>bl>g86??U8)#)|%B1 zuD=gfM_X&xzaw!8Ek6X*ZT7}L;;|fSt2d0aWY8|qX>a&BnggVo7;A6bokS@oWwi%2 z?a!1ytF*Le7d@P>vmGta{a10g)aG-zHvaW$aJegr@UfokY5sP3jO` z#dyI3Kj#`<)+ZRs{%-&Hs*UaA@9Mlc-xJW&|D7)T@9K10CQk9YJkhH9+2Q*4_2M@- z01)Sf>kLIaz56{|`9>t+EqDBxoENl}MZ}1m$@TcsfnLG$aC}1d;mmX{U+q?_}yrJI+KK z89V*72NPQ{sa9dy(3Axs)LZd<1(GA6CnJtea)q)M?Nf@3dXS3Jlt=(udLEM^p?#vS zinNLW3XhwR2r!=U>OSCSQL=c&JiVEXhAoh;ZVP~GOUwjFz=xorlwnnSPs)oXUa+!- zNhd7dX$FX5GclrfpU=lZgfFJYB|fPLq9MDokz?W|or&*?QlC^FHP~-%RyAH} znga0Mj95zJb2FyY%BqYu2vVK>|G5D-rx%piAIB?o1N?5EvS`tToNG0KLZiyrhdd3s z1xxOhNEmQ6Fhoqc%%ex$5RSZA=mar*uo33-fte@F)w5c0r{g7%xPS?MGQf~+R?LBu zuBZ<56ON2YOt))`OkicN zo>c~JBpTa@Gofva(T9LkG5Unee_6W|F(G{$+fc3H+1Ym{?(I4=&rvophpOZ)Bt_TK zXioWZP5@g)L3t3kxUM=FSoM`re1)5_8^Vg;?CiS6x*CEJbpyD=W#TW*6}Obag|)j$ zEKlyvF-h-Ae&m&HwlCu%SYi|Gc65OhRgl$cMZ0*zOTf>s`{KvAI}`*7gMgpgxG3S13(Mix&ze?&ykv%~_B#E@b< z+&Y+W5eT6v5{p_W$HBEiQitIsWYgG%;Km~k&7*s$Cr(uk2{RRq(TNN&lzNd>3ZX`jI(yadFnw9%XkS0OVJa#PGR~VR&5R@+TCk?ZNT@+7!LT9yqjS~57(DNE zLOW&-P0bjFI6O$9a+arH51K7CO+Uz#U0qY_8o4QHMU93^g9r7x)ZdjPm+*dN1;tBg z`+~c1qphSyEpMl#n){TgDEmiW(VpiFiRuVt4v#rVi|~(zl!}&Vj#vA}q%Mq=ink7r zy9b|t+#o8G9Mqif&OOiD(q zP40`9$j+`gjN`pIp>!fUR1oGNPXTo@}p+jq0$mo`Qj<=Tz&3ERUQ|Q>HNstKzVbuXNrr} z8uxt1QZv8rw@S;a+^o*Ci&~`aJ9S*`g&ycYZLDsUO-kfKzw~826$7swhxW^Q(Uyjs z@hVOJ%EgJ`EY`gHDo6F@DWZ(art%+}j?YF-r)yf8>yD3HY_-isuoEpUZ5BsvKBHzm zCoQe$)kBXcZS!{G*0v#wL$AzH^LqZ)cFg#JPqDVe7roYw1>FO`#!(BDd+XPY@%?~a zZOfe0*3Lb-{h*mq%k-MoZ>QsXZ??5x#ZR<$UF+_Jo{z3OowR-jIQ$C7)!BGO+=hmv z{)~7uW~Ig7)(zL&j$+l>gz2^QQ2VdNh>UH1ack>k(p!jA*0HfqY3t*BQfl{X%qFFv ztzXdcAkkK5JGQHBKvHiq#b?a+&r#bTVqzjKN@wR6QTvbvQu%hAsUYKds_D<9x#~xe*Q9 zi%-WHV^aL15eZ;SKMG#hCTczzlp`)o#|dFpylul%VN3@*jpDA(%WI&H-^Spqpvixr z2c?mJVgbB6^BD#MQsr)LuB?54P>pm6asvP?2Z#OwYoN}+w3rrJ-m}$OV^@Q1IJA>x zB8xi#D_qu-_%5IU%H^>NocT<_d))z$DF81MM=EdK8-UpNpoxIB^H1Q=J*cqsG)a+f z5l=be-?r%brK^*$1y%y87qO8`)=`X{oHWp(%jtilzh6A=1E`_YCaBm_xmR2_pOyDY zQmdpX_1&N7N`iJSBU1d<<#z5l6;pH8d@L{JW{h2@;MF~Vb#tSeU9M}Z-cvw!eBd55SBt=dPe z*KU-;x&$Kh;0iqv&}T#iidRU&Dg+EILGa%;tPTcx*Zp^&p;8<~aoOS0gW(TXl0Zo$ zejxH&x?i;?I0zL;(BL7smqJ9h+>(*K>)&kg0F)CB1|T}cnc((b%aBn5IRpBDNKmN z6^OGAhsO$NW)e=8<&>Ne-mMN~Gr_^md#A(!a6F^++eqXVs1z8kB-IPh=uk9iZjLeE_erE9RWFDkLOk#5OgFolDI-W@($s2ZAHY*1PCAp-~e!> zs9?PTfR6x=vjI4)E`ne>kkE<+jKu%s$l{zsM1}(3qyv0fNjzJFl>tN(lz=`Bm)l*! zIEk2-0d7lpKxY#t2Mw*OL8^#Sl8QQjpiMH1dTiJ=zLbPFXe#lr3`c_lKqDA z51oro0Trg)Z@^X-JMn=t!K47|MH1UZ`PeL`Ul^j;pq%N`aJl&GlQF=pB|Lh>Z)V!vr1lbhI3N<3{sNVBW)<#@Sa&bEb_d zdEZHQI2%m*Vd06>uk84w{mi_%obMmtJqdBpq7P#qd~!5G2#V4PBN8h(0oRWCEiZ}Q zT*Au|-nn2GRlsQc=Mbre{fxZVA1C8Kwrgs9{X+F^KL_muAJ@$5Z_lQb_%xaTzxoiD z&y^c4m2VIfRz#2<7yDlFCJhDzu5mdIx5GC-X0P5G{pG;knU;tKFzyBr>NF; z=ifoGpIdnE+Owy)vU;U*I{i_Lv3bX8pLn1-e77lT?ZMendBEX(=oEm&IdOiTWO5!( zu#vbADG*MCZ#e4g+v+^G~x6;EId(0Q3pX@ZhpatEQZUCSWK0c8Y=E^!WVf(KFB!SJn{1bigWa>!p0 z+Z)U|Px4~P+q5Ite5vG#vl_U#RLry#Vd@)a6#yyx@}ODDIRAw;0Zt6{EO9D}O3b}| z0(QQNL?sGkmL_`dy^jgbB(LCleNg;7xTK=2fRHqsWW=-D`AhbrPXWvowj)KyxCzj$ zbh048vs2$O=TDz+tFTWJz}5-dkaXx)8Kf`;bNW{G0G?REl)@1sRR{Q9WwIG`~9dEfGtN5J7_FE^&2weY*k4c{=_IM}2H=ZgWmeFofterp^+3UETPh zgorugFPgwC9XtW5n_{i=Q>=3f&Xid8{ zrj|_uNLO(yfEPUZ!OMnplk%zzKdMNq#XUpB(l)BI?zp0Q6?}N_X~h(Dtbu*~^;uX&f1==k@6%Q**5J z8OW0A)At*#Flw9kzX+jvme+4C3ou*he{t7urPFUCJ78cw;4s$bm^Yx&IpC_(=YBUJ zO+V;u-s5XNNER{}sDlpf9Q?987{=R#q#qiR9*SNmi47V0jr}l`sFR(%GBkBPlx`lL zAv-K&GMqK$oRc@4-7=iF^19$|*o|_eD9_=u`G~#$NIAVjMdygc+(=EHeI5PibMet8 zdi$1;QQfT3jy${0l~L8pQ8c|>kL;M7@z_9~?NHvBSj*TLz3s%^7$4>Mbe_$u`8d1( z_yWDnQs+3s-1u6a^#=U}h4{n{z4fn<30T&|L7vso$^`!9#3{YiS(V}nihv*jypI%n z9D#F>P(9D1xp1Y3Jr#gF1zron*p4VA5o#=6lLT);^QRIlo0EVPvU@==FohD=f+Dt# zqz?)Asw0{4q>5zXVFgZcTTgK_lXN#uIZRC%Swn`fOe71!fLQ8AH)jPO_AWSVoYrc-jXBwv)K(dQb1-%8$0C2}W=W)~L)Pxst4S>5d{Cx5Vuem27wnIMbzL4|AZtWD4YjR&4cP;tw>y}I>P^Q zOJfu)5P)CqDXBS4B#OXW79`Ym!~bVRAdet8Lu!KSajs7xk^l(238z&M#)rYdMXilt z@O?dr`%o-SXyO?RzNGsWXU$elA7DJ4_zecX6-`plu+)^leSZq`Mc|}uY&uqN(%1Y1 zN8s!;!E7*~X~C5&G_el?uMvg8-B@X?!;jopNP4t7!yq{427g`f%Y~SA)pKf%fpUY7 zA{GE+Mv}0Q5xv2lLS!tU^QYYL=nY&HtkMb&K@-;^_K#4@GjJks;TC5!^dE8?L<&A) zl6G0$cmvxc$B<}bz-uD`yGTgoDoLg;SVj((=??Ej5I`dE6*J+LfY}mH;*igH8gk15 za)7ol_}7}1rZD&_{3ov9a`P&Qmld3liG(;5Udwn$@DzH4e!_#Cjd_?Rs}q3;!iE5> zUZ*R*daD7JC$lLhZ)@=6?sttz_nr#v;UbBA5x~E46XedGsK+Z(sEBA*Jc|dY9--m`dA+?hjKw0U;_c)@L@&I2n%&6-O_Y~5K z^~9_ri7b8K-C^+Mjrj{4=*+{4z;7901%N>`oSSd?8L?=^JuIybPG@z-`3XLsz5(i< zc0!V%REUu2lC zrRGvd6$MV(uW}ul7^a>K+A@lKM|%Wa2%n|l0!AQZK>VJKXkp4@P?5keTRha%3S9t~ z7%x!$Xnbti;=AOh!veXXP_6TVW77NWR+|q~w zaoXB7WJf9KYS^Di%#E(}y)#L=r+bsyd(wbQ+3RzM)2QAg z#&;Jf-Q87MnnRClFPC{!Vyjw?wwQQ2I|LLOJAUB=#QXH7NZsTxGIQ$eQYu z@oej(xMMu-V{TB6Jsl^CDK>vgi@66(%Ns@d$?zQ#=N+YZ5grYXBOoR}xgr-g2_h~D zrV;!lxl0B2k=7vKYyazwgmg_kN#W16e%&cG-penC5_dks4s)*40ph}97bA(?Zl4|q z`{OYe5gM`Je12?Dg^JF{!Z#df1&Q9q=6~VsH=2oWFfCDj`MRXp*vz9}%*0~8=d{iu z9N)N}#Di9-_2ojuE)~5oUWzEyU?UD~Pzz9{nBL>8@RQC2O9XWw>Q5ng3>>gS8&p%c z%|zb$egNu4VuQyRcDoP$NzUW}L*7YuJxLe;DA^h!7W|>6WdPU;VH!Mijvm5-n!>xxT{7szX+D*H_ zW7i$4D8Y$BJg?^47FnNhiQUfgE}|=0-_IX!2KLYoA!XwL)mPBhbFbp${1@jzq5jJr zgK`0@0lVJ;N))3oyMba!xG>1yzl17daWeX-o zpy>zHT2h&I4ilU7b`$2;rp$O*7eRAo4UdsjVR2`RQ&q7cd#};W%0HE$AI*ZzrB>xO zo=V*PxJA+2rpm7*kYs^pOWoi0RUmaL`L)XSuaO)z@s_C+Zr=^MpOWg*Q1=wSK3m3% zwnCYcskCrBJKI}o4JFFy^Z=S2W{P$VwOsbMDbaRpxHlS_#?u)-pLf{B+J}W4GBQ8m z*;B~TXc=ZT#21U&b3YGKHmaF^U#nxyV=bj^>TZzL+-J{E6R2%*Ih_sI`6&=1rE`Oy znKP*J17|q9wz!j(Rh>^Vq)@V)gC1?jw31t#=TT{Ze|~Su=UNDzBw~ zwCnk|%;cZ^9hCVgr5`*uQ*gC|kp0uHA9gwOX?J#40bkl6vSsG|I-ac}MTbG`uf{@> z7*2Uy+NX)eM){AL9o58^YK>T$lIZZis0q;;X7KxdW>@`!(9bo@IypyqiP~%1-%h@t zm@Pf+bkf^@`7HmkDNg|3hAUKh*6-|HxxCoHQ@>oJk~Q-3u0*G2B?p)<-0#0Ux8HwW zpEzA6pZ?BFuEMyR*04U+uh?G9MeS?uNYf>GwOh%a*(UU9`$Ti0OG<@>y{XAJ?sv7J z?0c_(JO-UmzdA08BkO-3Ui6=2)~9@XjkRVbh;>*|VqHSJrZH(x54!u870B^8ig7Qh z^)QiU$qh->`NO9Yo0=*AtC%j*m@QUhHl;M-ID=19KF*5Qbd~UUKGrhZeDHnGXkp{t z-jix2SPTRIQTHv8u{bcE@0jm*_iz4capFJ!bsgU$uwTaVENi}VSJfl<$5+eCmiceL zfA9;qk81p6j0WLuAS9fht;CXLf8YB1JNyf`RYZq%S5nn)HM{@(3@TAHHdHX2mDe2i zF;!_sRV{^cV}yIim+pxBIxS_L8Pco9o(dIyGFCu}TOF>sDARygsWpo1pHENEHz7|S z^W{eYe|uh43n>JcFEfv}3{@Z3b3MaW^)nH+50izS$))iwv1NM?npz>bKCf*C0 zvf>TJ-;SyczgCQA?KHlnJ_i0?T6%upVpPwd=|=T-c{7W<<7351aVlNL&nH{$Wpcl5 zzJ7gs%2?EyHhxmaxV)C!*9yO|aK(l_YTl5)zhc23hR@uC=^U zDxb|Y0sG>^cy>31Sg#xnWJs==aqjt0S!wQV}a|EvnKr4T3;E`Ex#A8 z?T!Vc3tJY)Vp+G`%C9A5)|xp;q>NzN-V={je!GK0MhMo=rzB|4!rq0zxWXMqUpHM) z$lWtO)9?L}eRDzaEmXy}c5rbLTX$(T5vme}#jNhuUkToYX2mJ2Odd-8&DIHfm%YCJ zi|+O&EBPU_Y!Y+K({vpu`#{*ZzH{=g`8J~~jD7I&&Y8^hU4hN`0?5h+mRekZH^9>I+czg3WiqA6+7q%sJyuir~%I^UjmPKZdwD@*Mies5Yv z%WETa62EIWqv3B5bZ-=%6Lw1!@vhPWKuFNaLj2ft74eD;ZE_>YyJCDhrWqSWMMn_z zEab;hJn3B>nR(Ttre^YxVm##tr+8c@S;!i#5?z%nH?IhN2rGjf3U3*oQv;Xt9pINY z|6GI8GEXmWuad-c4}L{0mOn7&9kK`5R(n?gyKd-}>Fbr9?Umc~Wduv6EYrEqHq!NWF}c*ittzfP-hC!il|H?@9q;pX*5}uHP*F; z`Aju;HRGNmBX8okyl-JfMQ{|Z-G5ex zrq-wE;Z$B(6gdllMwCS$L`xEk`xIW{%2)bMq|8^ooQ;Ji9p9fiR?sSeVlTFGR%`mJ z_RRJO<5sNtMs5lx;APz?lx>V~tog%iQLY^$9wLoENL!$HWL{~E$57|jKIvfcSjm_U z_p&x)PqdWh@OboCr+L$GQ_+ZdfeA9s#W8lS^CKuo2cx7Nl&c#ctozh?kWMRVb!U9w zW%`1V2zCmuaiU3WlSps+ufo;}vk)@Y2MKD3*4wNM)zy7#P+dnQ5_`jn2E?Fr_$uMX51Qtq{B=9I%G2SquT3HUAkO+ zgElAuCw{jt{7;j}S)a&H9oeKQP#_{US;GKCAxg+D3jW57hmPPw1Middc6Jb?7YNw5 zLP$E2{Nm%F0cM~`Pqk6+Z?7KnQluLyn+~Q=)Gx|#TzL~+bSui}t`SAS6v4tCLC-!# zt20d}`jj>!8Dl=pojlFsI!!}{x2`gM{dbaURrqlz3lm=fD<<1l5-f~A)vzL}RkG-bHIWy4vHjGWqS|?5z@fpB3b)#O#}>W4_bCSO`#f zj_Ju11~>-&&-lLm=v|qiGQ~GSM#x)4%$FOe@~PU$^;`HAdRV1$=z`4{p4;}T8mlUr zTok$>sD~FK^k(q2N0y*m=-SS<)4ss6alcqE z#0%K~(XbIQu0S3~FC^siJogiI(p7RkE_A;h9k5d3AX-HFA>O)GCd!or#xUDqG_!tG z^WP~6N5Ax}l8}He6|yfCi7geYE`5H!RARqW>bF!Dx)f$#$R80=QEl4q*eh|g2!!|5 zTrAb%FV|5l*MH+L7h7&rU2b~5+{|G5MVA?|5f_>s*Zv+{rCP0G-lvw__lZv_+$YM> z$BbMW{8;i?4@O1u?_vl{<~#n1Zb^{?r+K%PD%E*}iH`YG`}y9xWn03PM~S#922OKr6Ft|t z&{!N7Tk>PJL(k8TTZ|uD5bVtI7+P+QKi}e$-3}GoaVy-v*ZttelMy3&F*1%3ssBDpDb5?$??yh-Q-)`uChSmSNhSf3}@E2f3CBc#^9=L z;0>(ytFB|WRxd7A_xM50iFVIwBP1I|sS1<5sQvo{gISR%#R{phJ_JMT^7BVYP zN(|WTnwYi5lC8^<{g>Jk%OV_P1m9^ymahe6ti^7O)m}9VI|dKCl8$_Tyg}Kr_0Z8-fY~YSaEN~R;Ck?EyOBY z%F2T(RoB+lQdx8$v6Sf`Y9YL&;KUk^Wf29Zfer@GBJ1a`5_`D(&oUi*Hd+u1HS#%i>~pK`r+PbD;y;Bg zZ3y&=I;xO9r?0p^+mPt}T5bNR(EF3H1H^*Cdxt{$7;M@)Y`Dma=sdB~jV_17iR^4mUvsD;AgqauDteZXwgi3%?viWW-GDF#%;pJU5&+m!!b1r zgS98JWL%7(+>DGZ(tnZffp};-2 z#(Spz`-jm^EJbEP8{i;_<$FuVEb(u#1&wh9D2BQN1|%?=_~1R|0o#D1(VXKHt9{^@ zgPQnuC)81d_fSXva9rDEgVl*z+$lWdP}BVIjk^obJxEiNjJlmk@eaDSlU&t7~fVYEjly@spw9mZ82Ujs*@!z5H_{56%w6F2f+Vvo}Wy zsYhe-$Bqyrj0fTw2`wJkkZBv%!@GhQXY-73z0DqhgF zW_Qc9;r;KM(%-i&zyB5R7xw?YpX0A!Eb6_8a1;C`HCy}5&F!|=J#OwqN_qv@7Q-h= zsL^!tTle&frKeOyt+?dKU-t;TyFS>VAny9%&YD~2$uT0=+|wz-IvvC@OYrh@KMkQr zxtc?4%aL)v>x#UmosoOHgS+k6alw&S&x4l-k@q;g_Yl8#2cwtD6OTs{9NgY9;~Y(m7_wd8$!ZO#l%Hv(nndrM;>gdapff^;jQ)C zOm)&-?X{bFoQs}`r~bT`L92^4hqun_Gv2Z@j@C2ILGM4m4*4D*XY(KHzrIimxKN6_ zP@cR{QTJmvxjd6w?^3V!(lG7v8P?yLJ^M2t19!T{=uK>5? zGXIn~|5UJl#_NF0R)5;Z9%*sj>Dk^%SN=KSejn2OvOitC!3Ind2fkJJj7jr}6`1hN z){R^jj#_7lGZFthDO~beSXy7AEKRt4Q25I$iHdOHN)C~#R_J1W-btJ;|yCThxx#J&mB!B}FsRD92uKXTf_^Ss*=)Y>z4{jPPUMD`;EcjESc9%79 zH98l7@IHYe-S;WIIv)pp-1W`J#0dhu8T-{BA?=e*OQyllx68AIe_p>IUKXzk& z1l-TZ-7jR{FA7A?mEA87-mlDuVyDX91hu|VRr0uS@MvLw*phhIR)5$rdHDJI;a9-J zu7213<^ITRu8f* zyQ8gqU>Z4vndo272f2R2lHtY!almA}j;BmL(NHR3*S%BbzIZYY!z#x=MSYKi#YfP4 ze^`goS=2LlZ-j7~+>TH;jzT(1O_Kk8b*OSWe=?CL9dLHEf6jqHDc%$CIsfIH{;VYh zw>bFAHCrzIQLEbdg4-a|wAK6g;DYBx1g%sopUWlhQWI-^gWF-&{&Jglwqd@@mHT8z z;MLhr)TO`%Iue++DtRrqh3!k^xpW&dsofrOW7e)Qf8X$POpnUv`nGxd{tCO^zr z#Q96kvqr|H+l#3mb+5NY-TsN6q!;>}pB&3DA8*Lp6PD?AN*-+wnPJ^eR<2HVr^^B? z-SbP&4s#n_TF1V9wL91vWKGq3kiDJRhzWnS-uCU^;GfrJwH}`;Z~on0i4=TV!MdCR zC9{#Z1O1O92^{*~IzpwdnG`_{#;EAb=WVMo9~9e|<8HjJH$!P0)C%LX-*eI=a46xk zB;5rqup|qONV2AgEd{csI)2MxO_RI5W=&UwN_}>dAq!&5(By7s%hWw{{G9nzON#yd zbJHMpYa*L=_H2vb8}=OR3niM;H1Z*q6j5~uo|;H2eIGy+1)0SWnjvZgDmt0_=u+Wg z3Sp?zmA9x5juldXkM6X1WqG(5CyoN#{oyi%8&eb!6O=OdSFT$Z&2FCG+K1hOP-2v( z$j}CA|3eJT)8 zNv8;gw7jDX>`+4S;VBmcJc*4l_O&x(0UDT8M9TeXqh#t zWcV_JTW2Au`42ou3m;oA2qm4wD0yM>2>T| ztV99`=A-|hPIY-`gO73^dwf0X-L<^khZ0`Fi2>09m2^$KI6W0)~ z^z&fbMrgpI^n!@wDZB=-HUy8n%tg7FUiAAd%!BEAW*u<7s{kOjL*geZ!zQ`tmLq?>k!q1lWzFgKdLg4vyP&X-K69&?$t|-P+MBDiWbJ60qc(2)}%?gtPN{kzFf=i*OXFB3?}p*j)NLp(H4y_rfEJq#bpmHRnGuz0l;9RAML9K-ISIjiFA({N zUh9lIkVTL>_6f=WXk(@HWSIiN5~iKt5D52Mu^OznG=n?P13}m!xE&?94p;-T>$h+b zOtz(e0vcUl7W^-XU(g2Y4t)j~1Mr1cR0ve)`@l`)e-L{cPae$+_BRY|XS(qI#yuLdKN{aq8pdedBrkvB3Hgq19bopAI$S6W=U$ zWEuZp1YKXCN+F3{S#}?uFO~f;XpIzs_j#Lc9-}4#7%;`zLOxz<6XOiNcX5+#oEeb6 zjFL||dMn!lt~3*GDh_3}*QR4tA5v*rEqzI#V~Nq3s52Y>=i=t!UAMT|fI zX;zsSYHFrnMvk-x7`2W?+Nz(e62IlU5J!cNRL zx85Jz@0kKGNvD9GxXG>P-bNJjb)!P)ST@B?5ur?*(Rx>p zn|9j~wr!BRdk2sefMW*TNGi)@KY4t5?Fg{}hDh8c*((5+%r@yNmAV7`uzyB)UJV%U z4M>@u-fo1;BW-fjq*1_uUxzO*Re*XzT%oKe37|6(k6BZ48!h|c%q{55BRYT#?;^FC`@YSsF zEm0sAE08-1{O}4KhJtLpf~2Adx?T|!prE<0pfxDMuvdg#D55n>q6riXY6)9I5sO<8 zpP)z%%t;>zjmARgZT z3){WJB?Qm{DF0g+1OOrQ8g(1_Q9Mv?bB)st1^_NdFi#TmUph!mLB@<@)!!XYEn?in z3I9CwmiTwHEZ1qF5&_xE4)S>RQUsZ>nR`2R*-xEBE`dm$a}m~p;y^@h9yQpBK3P46 z*fF^2buWs_B2q__4BZ`p%M#d3Bdj!3>lLQ<&NI$dGgUBqO;cuOXa1|{q<{0j(`}PN zc`VKVkC4Y$lv95e{l?Rcf%pKj++@M|Lk0r&NAgC_LHHUiB5zsV(|Z4Pj8xI{;g6r? zLn8mb2Tk=~&|Uv4XwQv&8GtwuwLx8>GT;R<)cm@x2mvAk8Z=#d0`jBiq{Qj#Y{ANJ zIrWRkHGtOLP<*3AUnlrxPdbIy0(oHFuI>k7Kj)prb0%Vx;-8JD3F%L#;iZ>yj>iNMPT+53 zA0g3r-IQ!B7d#rMH&=RnH!n(dY7+^#`(+pEmdngI!do;r{`UUwv62Bvfd3Vpfq?&@ zvHx|BsQ(QbgWf9|4O#yWGzQZe8xpeaPh}!>C(>-#QBP;p{(qn`s?wc6;Zofc3Ff&m zuFNuhfQ-n*o#y{QV^VQ8M2SWvhM#rb%Dd4DSM+}|YII)hps3WV(d#x9JD@n4Pq!bh zuo$IeAFg+!DZL=b-dkw{A4+#7wbs7s4B>jnr(P(v{1kJ~m?hIzzx_SoT;84f=I7Su zOd8A7oc6}o74He%V|giE_gacc3m(Qg#QJ{VJiCgiHoVkca&SxX9seq!z0|S173Q)O z;F{5!vhJ$rx>N@nF~Kn@ptn0+AE_m*VqCQcI%&btSS!r89pCL0CrXJL2E^?dcPKnc zAYbx!+I(HYtrpuDk0aFlztTCS^$5t5|DZ9FlIeJWP(Kg`CW71IN0}_{nuSv~zqa%r zvTjQ!uxu*?Aq5rxBqGuPEL$$LmjjzBjIl!nDFU=cQMB%X-I2Pa=Dmu*Ue34MmO^LZ z+b=C5;^*Gt1=U5NL*f5T6*`Vvg(!uxW_zx3#f9ga3vNE74IL6iCo7c1(eh09{gD(oL;+pPC( zS=rdxFV}#QTzF5%(b97_hhK@5wJzth96j%vg+B=BZ*gn7SNQqQ3g{e62cGH^^tO9G zBWWZT^tf2#`O^paE%S2V4QR>p^9anfyqangdWN8o2>w&gA#h;Ur~NJY!`JPeLx*wH z?Oc7Z^fLK*g-9Gvd2ikrikH?odYspIN-M{sCMzx?ZE-jygPtZu;SM^g@mwI{FS%5BB!ri#DO;+|wI%{5dD zU~2WAw1W9n?}c~nwDkT=bISa>(#nk*yBR8A1$B%^v3Io%evm1+T#t&d=%{%IUYq|J zJDj?@D*VXufe9fvi;_FY1%xwcqeE`cpYCvCn&m2i8~dG)BH3Y zUljXuu?3_5gJH_ZYwo9h<6_wKWU^?@(OWvi^RPce$@S; z1}VN0F3J}dgtyNE?%HDv&-s(=s8dWkKQtiT@h8PIxtM;Jb5MBtPio*;G2>O6y3E<1 zG$heyruDr+MOw17!Hp<7T41X3!_y=Y`gqC(l@`S8KDZrN(J#71V&IBu&AaA zi77CdZcmMn8Ue=3BLjSK?PkBq9_D?hitHDG=FWOXJ=ODKCPfa2F92bWF-Yq9oLFiA zBGSWkBWKwB7jJ^`Xw|gY`uHTjQ@BRu)ToK3+vf_n-uyv z`?2$y@)2)CNq&3qYul}t*ft-fNsd)tW@mK5MBbmt+>d{CI9}qYFt25zu%GQGHMsPV zQ<>~v$E;qRCUA$&@rTLu+TXg889cg+Db77B$KzU>42sPxMEUkg>qDRZ)-0*~MneU2IrLb=28f#Pbl3anGQPiyGx{yHPb?3}vw zP>pYy_UeIYE6eYn%2*A4vIfa=jmG7Is}y>WNvpvw7yr61o;@c8U(-_W%h zQnHr$IjMyZns4y?*Vnuka8<38p1#~+X&pbdqnft-vDMstmr`r^RNd-^FYpT`SMAH< zs5yaeS$uE(3KZN9((h<2Gi+)PghG&JA)h?(6=!G$B1~ zZNXO*4z1uV;)(Oa#(Vr?TQBWo61N>1=PQAlzLxoAPTV&t&>#|Z%KNhJ*UPHSSzuae zHmjmQJjP+}Jd3V zhToUVPM3wb7rC7m2Y=&}||!)^E9=cdzb z+*-vFBA0T^oc+WPF$n%ZW*xaN9v?NY{`2jkB!m4>{KiXkZ%J#|Df8jCKf6Hd!o-O% zN`ic;Wm7vM49_AmJ_;e`ji|$05#m=t@?56hI_Oxy3cHz&f=_&9P2;$%N;WG%4>R^V zYpAun&REzAwybe0rngU@{kr^9K{5vnV(gf3= zdjGh{DI3<5y&=7PItg0ug)V%%O9ek@TKtvq%hGg1xOIbA;3Ah$KM_;HW$gT$+(Bt> z=frNPf&m?Fes+JpA)Wi9;|2IixqamG1q{1mrv-Sq`JdGKlAv1fFj<_*`1~CTxNY+P zSsX}W`5hMe{Z&{XfqOvtP+)9R0QbHxQonCZ9wn`;87Ep$U9t}sgS*<^_g_rGSAPON zp#>tI2N|Z|)=Go103b+>_D^Xij!%JvS{|R>J+uUIyQIN^P%Mi@EouUzyQHAkmIPkA zULb@J8x%Rj0N^Yb)lCq*4lqQu2+W4}1?vj>qtS%%N{0b!F;(MG!qEV$*OJj;?n((46^HQ9GXjHQrt12-B`xDoBx5Gy0W@ z(?d_t`-bTH=Flr9jp0Ry(P5wQ#TdK6P^r`yo)Xm~%UH?a*Z?;IKQ#8I{a7pHIHHo+ zrNtm*t2n-pID6)}1NV<0Seyb%{14{ucf)doR`EBtF?kF@l!CGR`|&vF34aM=nV7gJ ztrB8G;-`z_5j;L~z!Hj35`plN?>ng6{8otqp@~=}aXx5fZ()hms7WGW(I4cjq^y#j zLz6^GlgLM6FZYw&P?A}glV8gvX;>w5g(n~~CI}5D>cf%+&{G(mX7zIk$$z?iq$B)r~0?mq*r`N3ono zb)QE~mQO33Pp^|NB_6J~ZJSmS-jo)}84-DKozE+5&yx|U?)*bA}ROQLx0+jpkGt!6yZ36QQay3S=RV~Gh#iD_*G zF9yE<0ZX88i4|PCgut_eE52m;XGv5>dQ7WB#!|+SoN=;eHhx4Y;WA#r^1Gzv(zbAj zBUzy|PuaYBSy5|}FP|1iXf1<|#?35O{tYi%FD-Kxu8IyQ z(qI+=%zue045b_>jz=ry%&YVruH3+@#@W@qJcvovaZX=`M2(nr_8CMCYeV1Eu(^u!MW7Lgc%B(wR&^`V01&(0=d?-bV ztYo99MS@G#&f*z)lGLc0RgZ*K=Z{t$YE?=7jR0R8hAm8>{_8 zBO7Vc6MFp;YdwKny*qjGdPbFTTcfW+wm*4uq*ZkPK}Ef1Gx^u1h|K1(nP$`bW>bZh zM6X5%`R0LTg0GqQdXeUtY!$5-Rk@J_dE{&fx~*Bl&9Kr&T+9}Cp4RHa*0H6QTHWTK znJuRgZGn-Q6P_&{@@-B=ZK{VNH`)kwaf+@`aZL4wR<8yp>*mgt2LIO(LPw+;Bph6E za1WfZqeh{lF0)}UlB{x!$)*fx0sKBwE(R616Q;sRQ*S@ECWGS51DsCiY&OP202+$&R)3F zYOHP7tD_)ORCf+#Gro%h99SR7 ziWF`ugtFSZ$=hW_+vTEKt{&Qy+OubMdlA{I6pk!3jw<=1S_Nz?kjIr#e-F46H-!i{ z3DvfSs12G^c$`0YTYKZ%j*Gpd$G95nXGg^J)P}eN+V!G_0_1v~MY@Xsg z!FrvpB7+v5LlN!dp5A3@QGH=qy@~9xPPTr0<#@ifqzUaKXp19fw<8R=qv@|l3v8pZ zM2FtwjdCCi8%vMgL=47ajQL@VxLS8LK7K8tNbuJE*-lZ?`8Z}VKI~OK7N#>E;W<8x zHPnn%)`vAZDOw7pnD98Nakd?fZ69c;n8*~Gc&$58>OE1AF|qaA`}fhvt|DGt1y4o$ zNLBlAO#9&e@3MpT$$8BY1GZM5tf|J7K0WuHw~oPL`TMvwJQL1)CIA?-copbgIBv+ncY~$@r;#SYu@Ve52fX7j`8vFmKm9a7SL<4 zhf%e+nUb=zJ#W1W-=;QnGN_|52{@q?X#O=JnElPS{Z?Jtm-MPPCofU zJCU>=ka!?I&wJ~c_+gz}DAT)c$gtnynq5U(?!K_?c-Xfuduq=N8rYFq*t{gkay4W3Mu}O9Ex1-uNkO}uu6^a67#y5(I#Hm%00nv@I9nLIs$Yb0yYj2 z5srE}!9NX=!vUL3XVKW3)!~yzoDW+&C*Wx+r`f8*U%p`-Vy~7?P5?DhE7*WlWda!I z!4t#Ibc`l%kmj8I@ggU9?#pR>eNhB2;82W5mHHHo3ycdu+o{dJXQ4(irpBKFcx^D` zf>9B$pX5K+;TUKl82nXy_4jr4 zx#GJkc?WjHxXZh@AQ9*VQd0ptD-D4$O?v}s3N;u4MkVCNQdPz12P1^78CDQ(vQFX? zbYI&WfE}xIoegM+X~ExOZ=C!A>Hb(HXBcAGml8Mz0S3444Q?@=ZteW85o>P&&|6m( zur9$JAnxW}PZ-8Swe-}U?deq$^=47*eQfS+doEl4J03JJ7FhWnxLMeBi^keZ%lTeY zw+3SX2iYI6S@N=+mU%HBdjjQrEK_kDgyTew-~c#y!4vRDq#mrgq%C5RYVn+_C;KN% z+{ZqL>w)#iA^6i~*AtNE8Q_SidbSPVF$4et0Z2sj%&K|4L5R3Wh^CH^WL-ptwZK8e zl_nY0FSyr8NfFF zg;x@d$YHVCr$xtB?z(sc@?jPzUY5k7(;Bp{98EpHyA}dMfa^00vP%U-A&^M5f2-Xb zG-t?_&c3JD?k>~s5(Aa2^Vuy&%}Dw;MpN>=qVKd5#M(f6ZJ7kPUE>xXZ?Mrtp@s%w zr56EpIXII9!EKt0Y-Y2K(YgW-J3XPq@1DuKFLnW{;7n;OsjC#<7R|{j%AdYR99;{Y z98Ig9pJHFWrkfPp=_hx5yW6;L&+yP%H(3|(jEUoaj)pYZT{rpZOaR4$d^!|OMY5I} zYZeXdzd%FE3uqt${PX5s_wNHWxZD3bA_i-_NicQqcej3K0@#3I_>C-UuHu;P+BH2*ZXwKCSy36?7j-VyP zT!0Rwk#7O#YSdAjrb93Lcg>D{0fuLyZ!D2uWLD@+ zT0Fx>P6wO3sSk7MjtE5c5ZjSeEmjQ{JVR4&O@gTf^XY7)FS{Ph2D332EtQ@X^yg9{ zAThxBqvUEB+r~wORFAuX*r=*uq#rj@z8f2!6=+?YQ2wN}qWXlo(nBZB z6HZ8uQq$u!-O5BFaRAuYT*AXYWN@gbk5uUi46bE zPnRY4vuGmT?IcUmR7A=J14X8y}hhn9S>6W&n1@UNfFMuY8Bo#pHcYG|y~ z4H5aq{q?@FYPHS%?*V1_`$I|+e?&wS2;somzka%k`D*RJSkiy}bY_{KE0{Ub?&|*a z({(l{ZA?!8TeDwvKg$MyDM*x z|4_(PeloP`)s59$pX_KmN}MuqfnO=V_~}N9o3Q76J3Ah3Y%@dlKwX_r5Bg4_1`*_4 za5&(3XW4ftnt0;{H3;HqBE2z#1itv`@}ve}yVPFz<|UgUD4RyX;-5E+et)M(v7`;{ z$S&E6z%w4+isT+--j3p%x7>~v+%4IT5xw5ujul5?*@=@Rvf7E4Wh~uEP<->^r&E&N(xe} z4@ygl$_~mZ8V?T2YX;%0hZXhn)`ykNyJd$}?bio~)!is;M>YLKHb=F?|M=;~-y9zO zgi5m=*Ux>nIc``qFF$Vl{q69$X(NQ~qo6sQje$sPXWm?QD?k^krk*=CtE> zxBRs8@%r$z3xLXg){R7Ld-md|t2pb$5;!{R1Iw_V_Y-K^o)3^%RGbe|xE-AjQHQc$ z4AZCDUW_moS6qy;HyvG!aSyTo9p_uH{W~GJSMhgJ^ycXAlsGEKB~+5w?sEFYPj@+^ zC~$l^`;VV)PF>UP>X(*9<<-2N+ws+cVJOG-qG_t#^^#?A<@K^{)A99+;}FNqZ`TF8 zn^pI{%9}Os8~E|fx<4xC?M4u>{q1HLQ`PNOl)%aDcAO07-Oh`j?(R>TMb+JImfOkQ z9we0We!n2q{vK9RTy=j?(R6ZuSTn@=a8$ow|8U&ASM_kxesl70+KtNfc-Bws@OVDV zRQ-4{E^zwdr<37&x}4L5zeXjyqa(T&u=2ydG4zPVy**EGh`%*Re}{k1R~k$BK-jWg z^@!IKOZddK^a}r39ma(VhXElU9yJLOs)GDEd8pOFw_xOyu>cGsh&r__9(q+!pmZ(u z2W}EhY%$C^WDy>gbH_ zZT$!i92HN}2IlDXmeg1#LKdF^=pQ~OY^(*5#bvS&ir{ggCF+nwwR6X%TF8qc=&2hB z(^8`|a}6g#Y{17Brvs*vn%pNWCh|3!M*F`Y)yEl5Wrj{cc+n|X z45+^ia}&YaXr)MI*Kvz)B|`ordd3&BTWOD3b^9l^Uea&{?~k4JTyXd9Q1Re2jF!7P z(_~Vtvk9Rq8DX1dgp?I&RFU?W`y!`(4QIUT)@F7hs!4uBV}YFOk!nd6lpW;Eq_GnY zkF)&}luIjNp?l;pB?)t31w287I%riJO7LlJDdr@Y(55ozU4t$uN(Aun)FhPnScw_J z-f`f4jO9yWNBUDD;U+W?(ddx5Y&!OVcxGDMhk%vAZu5Pc^G9C$BpQC?Ii(N#GwC~g zA*51P@>Z=M%^K@ds~*ih7B{Oy-VoB!@ms5zInPC3&SkvwkyVBBsTWZ2mlMEP6--(? z%HEh(__7|VO}5V7C|&v5e?`-KpkE-i|LVv6#H3+n72k1DS}m1lqnXm0vb9N%{9=^jXO)~kn+8VtpNs1n{4=75t^OwI#xl0J)p^!TdB>UEtGmG7xWH=AVeiJ4za~`cR?DA$1g{r~pQkk~qAjh? zIw99F-%8DMGvoA>pxqF}C22|ycJ#=5Sh_PV=yCKsa|G#axG>&&5xuc9ooX6?>}+B^ z|8o#16Syg0wb(+DQWGk}woZuZ-cLAvsxUaF^L)}YSZF5~`2j!kxq?Y5(ZlH*UHc|! zW|Pkw&XG8YPo~6wW)f_&=@N~OOfiOD_fw_wCdazSni?-P=)^cB;wqZ_2)u*S89!sG zP?(a@X-bdm@Sg{G+;66|r}wOEMtt&onY&8AKOonusD(w!U@p0NX^}A0rF3zSq^kl`BX@ne_8w_>K5z zHqP(d7TNC_lbrMh@C45LpAKKkmK-NKW?KFB<#g+uT0KsJJ}_N#;&;wgIt2dpYI}~k zPy#9!1sK$9;JkD9!>2OM=k`{_&VAF*&w2i8N_F+U`HiHjtv$bs(DD~JN`5Z_=f!=C zm(N*_e8hH>a|#{n_Vb$iq=?v|$9D=wVq*MBg%X$izZA4mj~9P+rn(jSb=w~G&1Tdot1R8ex*9dqWEysAK zPQUHUAP$D5)&{Qlh(|#MedtxW?$#cjRJ!1+Zv%;C$v@X(n5yQ-8e5pH5ym=q7V{s! zc0$~%|bpI6U8beIL2}ZUx^wCsBjCOW^E%_}>(-&Jp0x*n6sfws$=wo|^ z#D2!iNP-vM~P4JW(hb$*sFM;thm2M38K~_OSZdI?r>;4bA$jv2u}}CMKwf66;bAvrIOjf zjlkt&fO5eiF25r(F9|XyH*3ef-xg|=+PNJ38eg0_$R2{CUW>PYrC7WnE5l<{t9X43Ozd!(|i?c~SlGd^D>VwB2wE@SHcwcJtkO3D8-F zYJw4A%#@+^02(zjNNr5cLd^59MHWFEgG5+};CKFE%5NwDSPh1%sv8xJWynI<_GLuQ zZFC}uyo6DBnpU(FiCh~BfWsec+!4Ek+KmDpZ&PJtExME_7XJ1fY0~?2tNb@f(jG|> zpOa)+l8VA2OwJH#9g~`+Er7T{SAVQ^00svHmp0rqYBMhC#{LA&0KfEeV_2l+E!8Lr z051-u?F^JFj=o2YLYikiMx;o8r<_^*o$U6VJ|W^Db0DW<+%9e+q9Jl!H+CNw#Ssa> z1_gbUBWB)AwrGqsHBG1rOZZ`lPX!L*O$&=GNkQQS{60eqkpLr8V-n}tCTXYN4aFLh z#y>5%^U(m`iwB#XB{b~Nq5+Vv5K_oVGI_6KpO97mhDD$>N8CEeE}vz3w5X)PB6|em zxz7WdOCk~8)24Bwo*`t3h6O+wJQ{k%9BT=Wa*$gzn%^op>w7GAaQtcO0e>O^)XoY-< zOCf!q45UGUI$}e`Q;|H~GEj3?r1L14@%*(zkmb^Fw{rcVAb&$-uQL$sM=G%AH#{;Y zhqQbuiLkk_ct%=F*B+2A3z!?4C8z@-X!t>~@B_Ypdr+L)DpX(^f(L`9*?M3j*A&nn zgekYWsA7bW)A%c+C$l?~RqRp|FVqXXJrB)&Vv5rCAmg128a`YN)q-pop_9bR)|^C!tp7TZRXi zwG>Qbl_U0^Hjo=~8eg&&R_RSzMwkI+7Yb77&OOb@k)g)fi^E17E3C4v?8Auvwp`+F z4OUw6)nulBUIK-PBZ)cI;<(oc75V+%kHRc~AUdTWm*n9^f@j35vLoECh4XF?egFVz zNTi4|fuV)Px(TIHbLb`o?34vi4Ys`J6l9AOekc$v2d`TD031V91Ia~c5Rw3(?N;DTaqVZX z%1E6GtQGJvS?PCD23rN`csg1{p@LL4>w&D4 zv?cv79ItW1y^6)%-u%A)nJjc_ERPw0oIXv8D`AP~|J7cAY^xk>m)5am)uusGTd&iq zE{A^G4f?Vpg-6q6tJ#(B)WzZoSqU@dvJA72%k#bOvN@z(b<7}=C}2|aydEo{{?mQr zPDtC0$>9;2m{Cpa4ITz0kb4(WR&>*8S9uCG8Xpjr?4yJ))+CT8ssbXO6wpVI7 z%dUl%P)B{DeT;MZZP=>I5E_KF)6)&-A2YfeXgo4_3J14hjrrO_{C@`<){f>ckM_5Z z)heow9EAo_jB6*1LA}S7to!N?2*)dWH3KIG+XoCsC-!wFsBIXwep9wrRCQ8hb!SaB zAJGyx4*i;*6u6vRhfU1?rmsK;BoRY_`lDFW!>f zpb;9h26X`d5CdbGud0ywh!5Kk=-c(U>RAGNK!i1|DW2G&K444AVe8d7ucx^rZz9ni zkiBpfeGMqJQdPTSI`YZwmC}fMIC>8hIP+q=bDY-n=?FiTE4Op1Jf7kqMfgWT_F|S( zooDq~U~OCSq#WtsXhGvyIu4jZj_)!phfb_QTcwHFHj424(KFyLuHDtak?e(=(fOdq z#VQ^wNdUC327`B;az+U}cRalNcH~)<))gV0&=LFU5mc-XPOlv2s9c(#SXg|U&g=w| zgrFA!00fTMEOrZ969YRFbyuKK)u(w~N9hEcDp~#FpRF$Rj)3%?LsPZIy*FFWB5_Y2Yk#gO=a2&chH=g+g=)Hv1S$*wtVUhtg#@T#PUwSBRX{TM3PkC6R@ zFR(&sQXX`G6D~3L#+C->ti!5}wwR^|c1X&zmCuQlPky3i42j#bWZ}u;BYU=E;9y$l zZe7K$rRH}18e@9rphf2lf5mTD(bih9(O?W)wb;5!>QP7V(PiCHZO&GE4CILRxYbu` zl2aE-)%oK@b16o8rBi#AlWS3ILrn7+r-E}&`G}bB#8~6x&)?&4{^J0&Q%{D|vzZe@ zF}vI6&-d7km(SYQF8xPv9Il zcLtO+xRmz0l+C@A@48f6zf^`_s=m5XiQO_TXQFEVXDNk_%SUhhs_Dl2%d6`zIM>Dw zUfgl4+`&??XV8VnHNoTapok9AEm=)V8It z$)4wG?MG<=+0dtL@p0igD4u7NcXWw zDO)U_xf>A) z*_P#8r9Sy@1=ZKP3*zv%^K0o>JD=yjX}mj%*1g?XOtV1T6>Ya4To3#{#vXmicd!e} zWgD7oyxrZYe=0+I_2tq1;?G2`OzxK_&+B8i#?V&=&))Z!O7lax2Jq*r(>pjSclT}G zp>^8?Hg8<_uzmS)Yf3(wb?aoAje-OwTO>#b6n%Ko`-{YTLL!BlK)!dBSx;6HNApqc z!;YYL{6LsGJ=#EvC02NUu42LXV31=Hk1P!(A|Bw?6zfMiN>l~jGP-CoUU`zpCtL<)1(rv$Ix(SJ50F;V?s$yfvW)>DvcaHHl5FWMes?DlK=O+J!3urRH!ct#SWw3c=n$-2(xm@b53FhS1QDL>lG>+07<2Y~QLj@wlW} zjAK=boHeba*5XYQ6s3iBwPHbh+9LYc=;rBeU($D#?5OJBWP31X80C6=WnE8O>#*6+ z&uzpsZFl_K3TG(t5h1azp8jNUru#ZL!)%=_Pdx~7FMo~KP3RCGHwnCmQG(yFKKkh?74eQS3i5i{?8;k5fa z5av^!-2RB@D4sk;h2*GP2r`|=`kr7K0+DaU0*@qm+E%BDg3F!(te; zrEq^7?}^nng6-HD1A!<(8(Y$7-FRPM-*tr`RiB4@5#}cYxD{#sn7eloCHx7Zc8x}J zb8n@J`4cLLm4^~4+e>zE%0kSiZxhrk`H!DYv)`ELA3xo<=}3cr{B(lSytLK;JMou$ z+%(P4e# zb2vGEKh244Xe_t&FvX!eQoznR5$ZV|H3GHldopM0911jA!X>a=U3>!fL5w-4Honqw zZK5aApI3-N!|#EEi9Qkx6tDTlG>LvjDa8W>XkX$cY0jMKo8#myh+_y8M)7=bZfq>P z+93sud{TdQf4(Gt013AtHNl27@*9XE`#2E5mKGvp1DvqxMalT-s%BVV1-1dcIHSN} zZ{Asf9RfdP?Ic-8?XR7Pit$BoF+p+RsHb?Z+N`So?G zXh#5S5q~s5Z&sWCdosXMh(-mFGzlPXL0W@42i(AS+VAB6iwD{S^^}c}nwx!XTam|e zp-H2Z)%|p+4esO5mZqk(`3@k*9LTYIwB)T!|>A(2|X@l6ebxWPDn}h&CdkRPo0t%R}YO*0n zTpSnmKSIC*v~)sCU8+eL2Zg)zIDrOF_HNYA$lTP(iiU{9lFeSS+yJ5@@cn0!V&Vbr zZ+5+#8_si;@RvI;ruRlC!5i-01_!Bg;hifCWUvhdfOQ$}pPKafHs4D^oO`}`{jL2j z5!5i`P3Jip^CK}JHm*#(5vmUO4a7h)lE!4T)nroO9kex^DPQ+ zeko+3*&u|7PZ}ZA0EGSd`%61eP%&PH^qQB8_M$YhAY>e^WC>$j>vf)PmWr{74owk} zSv0cop*oNkSex^;Qny22@9;hk(_^~?NB!tMrZ(g7+TXfjj<{_x-T8X+H-%2E+8=e7 z7enUxl)#X1KI?pd8_k<27jhEuOB1qXs5BWZAlmjtb-&duDL&x104E+0)Y3frKeo}+(wH6N?GhU zEI@ye7DurGWNIGQP_|cV6y3sz71H?=c~Q1S*dh4JNc{gK*OvOi*a==JGytvW9|kSx z*bN9o!^hyWdmF_f#tsT1exD4w#qZ9}!{GSL44pGp$q_===}0uE#!aBr zKiR)ami-Kn9LJzg__VRm$cbL}%QI9`4&VyjYR1^5Nkd>u!_HDrjrs_2r{&`>Q^kUE zy5Xbzw;baC$kqR^3@DN#U;+|fb|L;hAa?ZgNlE}Y3KsSMu7LX&vAtgve+A zR|Q;Rf+-ZgTcz+nE8wJ1p*(j4{|m7zeBSq`6#1O;4`P3*fLkw%{-*-&1+kkKIMx{k z16{5#s1%!PjH-Q5uho~XYPN@7GKARS+XXs_X{4w*|5m^yvWXCek-myo%CP?l{1cJi=8~{?Z7n{LkyO8umln^}?+S``Dhl@W&94clM zKaKrXvw^=-=@hj%Wb0a&;96^csen5a(=g^%x}Qd=99p01f-mG+C8eavr%)E;`n{z2 zAP%X?(yIXE-G#M4g3p$D3Q>fTNcPGS&1>eQUzoST=zR%{Lj#MWamb<3|dku$acUk_i0&i2eUU#P0BPwP;cObp6}y^yy|JlHEN{fgzhG3Dip<>HgYEX4Z| zHy+2p&o>IfPw2C~Ql%DAAH{(S;Yr40sWD6O4da&c_tR6Eg_AmM$v{f*S+Ij5W~}oc z0*wb^3~`zCk-CZV3J2<<;%SY350l#94f0!C{m1agLo<{V&u$+jOZKZN<;}Gm@OKyh zsCtnuauFLTG4ez4Npka$1R*=G*Zgk&3ndF1vDRRpt+t(+U zUs?*>SiNfw+dwsenvq6O2V!&67a3ZYYMPg+na-#bn923v%|R5n_8}0WM=SR4o^s_e zg+)e25(KOVA#AQ6V~rV#*j<1cV7x0@^(R?S)!8_64ItWSbyu%PcC7s36Z@`YG5K6N zuo#%4`f=dJcHzF@7$}7VAhZN`mvwc2OR4zDSFQzRCB#>)FDF4hfY5p+x0BV^SPYb@ z%Z|>o!3&bYaw=u@jkcBpjv8q?j?t`QooBP^jL`kAh83E>IY(xtfNxo7p{U7M%>OBzf#~PIJB^ptH;dFL|lvL(`_3U zl{GJ$BEC79Kt`T^r57QYVTPhsjbco=Q0>?v>tCy(Pq11`KT+d^$G`oE8a(?8y^T`p%G^F{#<7yG=W<=uZ2pQEMHpaYF$#0QRmC( zAQRL+MiM2=`ZMNZWpK%Un&peIDkUs27u^i)qi}^ir*p1mewK z>+5#gYQ+~>r`(p=oLynnRq4^DZF2i`;hk1_GwW_#&XTZqwTtbQf|87uYntWSJD%{1 zW;I66jZl0N8rQ~sU0B^QQ)xRhdlT;{<;U)hYyOsRr7el}%1K#MJBw?Tjp9`uTA)Lz zec^wuhcsYe%k6`+v`N!2F@hgl%YS&O(9EaXmwLqCGI7fy{Q_Y`YtFcgQg#S5_pDjY z*8Lj1AR1qCF%E9PK_b)wfEI$czM7o2)65Av>N?n@b!-=$BE4+npp+^FuB>dhObJNk z*aC+IpBdv`$&!mZN%^HcUzVtJ9B5A6|0iPS^5U8K7qOqXO?j>S{Rgpko*A8btz{+< zUy*cPq;`2t1%06|1Q%^=o_vfeKRd&mX0Q-*NZdp8Cy|kzfN%JCTV2?Q&@Ja;-B{ou zSlWK4gq{V67a<^?fATAvcSD~ckMb3;g)iNjTG^WVewmhnF_9h$&~Kw!AP)N@FZ#g+ z9EXYQsCWIfjQpRAeF3-Xz_6F`BLG|yuvbefIzx&nXy*_TNE?ESNRh+aZo5q0S{CmV%+*+(W;W zD7ZI=dM}2EmIV0=ewTCec;oIUXo>sj)>Z#D^xen6EVxskfK~vjphH+%K+t(`HqG~# z+c5D(ox26Rhdm>9%kYTd;Ba7g2y=Kmv!jq~gv4HOWMD+PX4p^nFv9pSdxVfE+Q<)K z9v#C@P5TiJ0pT&dk*czhU6zpq0g;!8k#WXR!Z$(FB*Az+QSTbV5`ob&H{pUoJ{U&P z#IjLKi{X<4(Kx%&=m;?yG%?Bf(FS{wLnToknWK>RqtdowLYSggWP`wYF{(W=H?lE+ zqS#Zks4>}Cb)(pveXsW32!&MJ{wBEf?wP!=hLyC30oowT$o(kn=AlJe#eqz z1WO{@iLWwF(U4326qJZUlk#dar3RSl5}qPgngTLPm6S}W%ul6Kb0@Wm`x|Bwc$Y#= zYVNF^=Bf?$FMSu8o*JEQ=`ECOc$aERnwD&pu0-N?CKw&29i2@omCM2w1e1y#$;cc5 zC*CQQ3bB=s;D(SU6_UpD@n_b5%(R}%Xe3QX!p&qI$mF8^>bn5!=LYrFAOsHk5oq}m z?c4rf)*D2pvugT=ObwFv2XJ=-rdT5Q;mmgB?!Lc9#1_Ko^7at>Ysfm&Z6hxO=ByI> zlX8UcJnd>Q%KfpDsKMhmxi4=)m73l_9S91UH~d1nxQ(C;+ zV$1l;R&-C-N|-aZ%;85%>}8*;KI5l2j1NKbw(_1SChzY2-5uHVf<> z)jXIoDK>B{nmN13zBQ4h8lD3+sV$k4^L0upPG>5juPeMf2pyMQXM)7PSSDBJS8fef z##s^iWH=e}e`uAhiV82d4XvsYB84y|*aC5vRl zBI+bWh(9RQ!&#juFw5T5ItmW}Ct>v+7!BV7gT+7oltIbQ(~0B@a9T>Xn=cElAZz>> zNh`Jz>Z;q6X4&MP*`y)ZFq8R|ivxK(}KQ{=l&~_Mxw>k|M9sth-V^Ea$E%7=%^8?n&C}CK8Ogbg zSrWg}i6_x=$I!-X+EI4jDMj1`vcb(4u~Z@LT&wFs&Fe4_!mVjD0v&bj0ef7QyY9-t zZIQ+ux=GlI~krLD`2vpV|}FJ@vAgicD=8mxRE3;vTM9_U4(z z0@FAOS^8vf;uw2T#;F_7iPfOdsFAQ5l6OtX!s4(oo+n;6c276fj7(m>=xEssHPjMx)DohH-@5anuIi?m8#3SW0n%U^K?|X8 zayk_8`&s(?^%(Okkgu8$R-wRA3V(x9aq;u<4?O*H6igZzeq!P;uoyH;jq=^r;~PZ< z@8*PHR8J@CNHRu|5WQ!@DsT?v37?+loi;Y{D%4Q?z6@!A4fwIK~_;>)e~3S;L)K z(#n~bk(nZoX>^|sRgQ`YQG9iu9!k+Et>|>OaXgcbMCoiPgX6Lj3VfRh>Ccoi4%t7A zo+cGmvIpsy^i~Rl%x}% z+C4ZHQY$}v1}>YvuC9=RH~GP`Q~dwqNz9jgiXd_5Rf(SOiz zLFxqO*tn4I6km+w8!-ky(SI}ra#dqTqQ6a*W<`{z-7dVDxj{~je;CuY#M=LSSp7p6 z%{0~Y4*{0r9COBol!@*&HPyT4?0I(Xd9UsH=J@(i?FWkOyW8&(TJML!pS|j_0QwvG zj#OLU(TIY?U`bVbKs8vJGR&IlCpw;I696<00j-~*$xo`9)oxmP4jz*H`D8pE`{jV% z^+4sMEio&u0-IsmyAXJOpvAdm6malRcF?%CX@<2eiExC*c0}cRILtdetXw?GX*2H2 zJ}Gv1MS9%*=J>ny(TDRRdIH<5=aS_w?7y(58#<5rpS#W1mUq8QQKy~IA8l)G9uI^c z!v#I1yO13J`Ri&fv?QtICb3qB=xWoovJnV%F%g(xqXf^UHS=7ZQ1wmcy6Tpv!LBOQlKZ>Dp>g z^rZ&P6;tej*TLLD;8n@f`O?Xy=JAy}!Zi}t&XUa;-6^iU%GG<@t1jc~W~Ix%$*b0h z>rZMomVT$!4hyPNTWHl+PuRZ`d~PLjZpk~Y1iKdfxd;QNZuU=ZRQ3KJ_U@`F4u9?U zbmLAM4ess|9D)RQcL?qt+}$05ySux)ySuvu3m$sNf35Y@Gc|kH?3%OLGcSMxPUxcV z-{<;1E7(7WS6`=f4@UnwxO{&WA$%E}dY0dPj_ZChBHU=FJ6-CMv7IhpxMFZ;+;slF zAH=v;R*ha^d-rMOm6PugALUKZ>n;-XD}Va%)#k;E|5)c>eJnrosJg$J~WMT5OYfk|92ToF7r?IE ze@^U7#DM?HiCr`rpU)c-Tk$|Vo?Pam=8OM4NwCqBUx8eX zNECrcn)2yfl&}cA@yopVLWq3n*9`aH1&gs7jowhWsuwG{WUcW~r@zlMDlKLmjMnci z|4zWMI3YaR40lNHD_*v%?R}5-gCZ2oz^c`c48-6uid?vv8wsN{t$0(vGntZLRqA+q zVx5^07yCtTedB1lRH@^mjl}$WueKf(F;r#gL2|X+=>;+wY0tgt>}!r@i%xPKIOxgb zFXnS--8?dhgUF7?cyYd(PB1Oj(s}v4y@MP6D@&J8_q=;H93D(wXe+1ay?DROnWkm(YZIN@D1oa0F(Rq-k1~%YJtjk})J7W{K5=5MEy&4FKx7 z_>n{rtg9Pi7*T=c*g!u3@OS0aCIxFQnMC2I|*J)Ebli`mbE zb(?FzZC2b+uUe^6OhPsY&-O3?>@g5H$XG-sX2Op(fyDBA0z_y=@@^s$KgmPt4)vq* zwq9m%$Gl$&+Cg96Lh2~8pZ9#@go&ff%UJc!Q=H>obf$@)_p=^*D8IsNeWHf))acxS z@qK|~1c^EM@4SW(#YK4@5Pzc_g_n2G$KX=^ zl{hrYWD`r`PiAx?IvP8f8Xp(EQ3xlao~YhL=N;c)I5*HVF8qS}v-eGrg?Ry5o$FV; zZvrC1U!~aEj1=iVR$A;1uDO&^ZweSvPwEeG1A#eAXkTz56bL9N&Z1w+rcya(3F%vq z#hjz3vWhGRu;*6CToBx{iM@9?J_nfeAwg|2?=}v=8&i&MY}sJc#AE|*Dju+%si64! z0;=^);mUzFDr58<0I+z9H*G4G!V!Yf$sC7n!Czk-!ch86=6~rD`Ty6x|1Yb3IX?VQ zNS>3B#>##7zI+ugs|8e zER5diO+~SLz~f6Mn$AS+c+8kHQ-wbkl#e5rQtZM`9GFYq`-J`id_W$g5PV zFlxJQutk^ZAUN*N*9_^U^hIk9M&^g^rV<-q!9%Awurtv~XbsYMeXDbh&8DfXH5}>c z_oM38NaKramR5!R&w<9TF;g8cM)A|*irXof2M^`*l@Xxo2%R^Vg8sn}LJ%|5$Hj4f zJe#m~yH?q1gD8i;rQ`P!ZJd#`uvphN!7Uzruh%1@EZ;Q(;7C|a;H&{UP zgh&Vmli)GVR~O7|DR2?vBnM8!b$2LO7hT^!toB(AKMExdE7=_bhsqyWv*Sb*TdJi8 zESe4eGqF0id*FdK-x#G3lEOi=J~~^Volz*Pplg1h9v^jL_`Vac9}TCicL;;PW|Ul< zorRJ@kBUXi#EFiGIXG4qGOjPqrfbzWV|21qKH<9pr=An_+s&6k)kV)K{967exIrXo6W(PPrPa zpJror)1Unj`j*FkXBnk-$a)yu%eRRnJ}v!8(_SGSs=H_@F@1|kuTAm>JczKMLxE`W zvuM8zJ*q9ktKoTIGyd5is!!X#eN|+Uduy`z%S@qeu@}J%eswqGqD_mj`G)(oJg>Lz z=W!O}5GQFjvKrz|{9sV~dW&Kq5VBFYjR|uY-vg0xWG>7KcT~jBf*e;pxW=KMz8gnr zfLJcWpjUnnXRyMej=Jv~-QxwTi@-2lL#FU&Ho9!@uOs#IjF)G&J?cmksFSR>w&5B|8OADE8GD@w-ZOj&>n)RSf=jDki8vAl|e$ND0j-B*|%2u{NF1EVs z6pxlH^`Z}AF#LXwwZq6qkNdGO$k#h}m{$kVpApRI5wd)c-A@QPaKG$+71WLHziq1kmvf$Ooco{E&d&m_XsAIWtjV;q z;I@xDAL#8|i}JGs>?jL5-2{j`(}^KKmL)x_KdYQEc((SEpa*2TWFnpB#o+^Ed7KIrqAZQ}r}dJ4 zo~Q%{2rI*u1Rg+p=|jf2Es!oeg<|k`(MBWP2p~p_mIp-@QpidhJ%LjX;?4oX;78GF zg;P4EhU`4j7N$P)u!`{_A z0}oFkTO{PuBz`=X^?qU;Y%nBYO|?eHV+~Q~K|2XkMcaTQsfNo?DGE;(b~_Y1(`WeV zbQQBiX3ARMI>ABXz=7h4LSIe-`sVg>m;GiBL8u58jq<#o13-%6!bKbMSUVE2RxlNc zD4qCajg~&*cOpT?J$rN#&x(|3D$3C?8~s2Y-hO`oU70`IVz*FGR8fM&_%eFXupq(6 zMlC5AK7~-1Silfu9&e;6>=B;G!2u;H%hNWG{;&|SC{gx3iF>xl|E6@)Fj{$EY%x&t z=TDkK17*K(rQEH<@?*quS|1#R`aY;i#KAM;p*7X!uO_+hDwd3mlB$JkzpDtH%5>*P zm*U^ql7%OC^t>e1`U#waY$G%YUz<}aZ|`aoCnIqw5mrMUoXS!zt$fMWMaG## z@jkb%&V@U(m54~Gfx$0#faV+vqmarhVsJD>{f8T(!!C_XUZ>Zxl&iRj8NLO2jBMUw z@^$?TC*>PiZsTq)^02zJ{XUL;v~|;lWn9S~H71kpom9RvSmk;?y1IBZ)Se>EXoI#s zx*p!x7X6b^AHrjCPza;DZSj})X}aQT6(RSsod(F zK-HUQ4Fm12z=jTL%$r#K<^8;-<=hItUj~V^(-`DG`;SIB7W0wv&Z<|EYj5SG*wSwCn5z>OlnCbDRs4t=9KSYAuV83+cvv4Wt$Z{61GBc_R!3OF1`%#HT^>tCyf~B7@ z-3393aN@>M{KnR#JQr+ozRx``w?wZmRB*c^)-AdiFeCl3X2EqE&KL9vQ{d-&=Zpo=f$OkGxy~uL3q@5Ic2dzZd*ZV2p^syIoLW>*p2FxB0e2Yx-l%QH zx!VR514m?#e=g9(Iv)?~h5m=leg5~f&MGIyv${%d3AbbAZ_PT3O8IxR0eB;Hf-ax3 zul+UTe(HeAxjR0VRq^TzwstDO&~h32TX4Ou7#XE^@P)3=Pj?_0?K8IRkzKDa4;MJp z;0DFqZmO5pR-FiV`r~YNeF@h|NsGV7<>cQCmUrA}4&Ut{p#E@-3qL|x-|`U~7cnuA#a!)aKWIz3D2kjM~b)1fksg54_)PYVZe2Q$VY1>+Ff`W)mdJ zw5$b5ibuOd#={Vvqi!`@XpKLoRm+c1vM(-zb-6u(CuXo{Q zo8D$`V;7U5A;W}WN}*VA8&kKnM=xX-ACX}<0#%nuGufbGeb)-T{s zQGi*oyQIEX87b*;oPP^D6&?dxZ^bMtq{FgX%iSUDzun(B|*~rfMMDoLtz<7>^`%MzngK#?|R&*4v{Ua_L zvJK4=U(M0~m}gJJ z7&Py4F%?xmNfNo#maD;R|1iK32@GffCqIRkgmW*8a4*8mt+fAEC52Ne_>#T*LU>VDxJ6Sc#)*2? zCU~b=%6eCsfK$y;SDmR@{VTkZFs_<#^oN>8(eYX_3~kj&S&dt2sq=H;C)#RM+7$HH zl#?FV$`4kR^4W>valC7*9d`tjQk^v4lE2>CQP&*5-c*|2SQg%*9p2iA(CAIun55Mf*Iv`a(;$W0 zA!FGlr`4PW-%(E6(IM5*CDrPa-c6Rcb9rGX?~u27J~Aw0RSCts3gCj;3 z%SISCu%asZGd4!E-bQoq#y&2N1=?dp7v>)ZB)}IUg&9zFF$R7!217g!xE`yL{)d*d zgRDY?p0q<~`sY%VLj{Uc2>p*QgYY7xhw1;-bqfeqT@n-##8 zig7U_;G`$8UwZ;zH!<2V0iiH;@HUQIJGo^wxf(fn>p6MPJ1vYd)&4d$Wd%I8ni#2= zXxf-)&KUm_IsFtl3C}l;NKg2oLPC6~kUfBSuMP7gy)8v<(Nv2rXo{DJz z5$vS=#J`_g=*>bf&w-@DHbDQDC(*HFrnft0dGIH`PR>7O011%*f0;_+c^JPrn#nl^ zqlD2)W5-JD~Lnq|2h(~Vky-<;jZnBAHn z30y1=@frC;BT& zio`8jXD-^(FD!4YBHt{(f&pUbfze2Skjxc8%}SKc3OMr`#O@l3-|EZ6^0U>Pm(Kb( zu(irR(}iAZ;gc&6yDL?^YbzD&4V|l5_zU;5|8^nueV3mzW<4?&myn=(_yDn&V;|Tg zCaCl8ac*z}y1WK{L;wyjv&nS1=Ha^qxQ4U0Tb-|5M!uX`oLsff+(z=-to}27h6LE5 z-vS719Yt+{=-2e4b})Kp7Ie1P>DEVO(BC@O!Ed&~KDt`3t<%fR{>zV#^UX*6y+{1r z7kWb2Shx{i_-dxf%88v8>qQ$R06G&A4{&_ldR*rk9ze8X4?x1}0SxG^LiTR`Lr!il zThqSuIg`q>EmOb}6cWC_00JWF%)o4hAh7%oZe9T+X*p zejc2SlRL_+{BKeeh~bF^ib0at+=s35`}6)Vh0bK*7`a1!YQ5YG7Qhp^N;Fz$`miOM z*(hsT2mF=$l8qYh8+8;jsF?Xyya4|JZl?bg^6`Ji+~)s5c|v^?J&N(K?|}=)lbH<1 z{+1^)K@`6}YQUYM>Fob1PpE%f9fUQM&i@N{WTQeM0jQ=Nj5d`03wM-yFpBG`>S`nN=(~zUL@RE^1#$qGzy0D25v%7I zl3;v);zcYKpY+HlP&b>fA0!I3$iWDTNW5?k-7JyJhAL{ddLorcU^rpzo=goVklw&D z{Qed0Gtb^&S|kdjBIjs05hb$zmC>3vy7wLbEpdU?LK~V_iOuG>Wsx>$E_Di`zvp0j3ET^pL<= z{1BBp@(@xx_9&WHM(aH5nCL#{kpVr>0Bt|!tW$VaO`ufd8;Vb~a1lM2Mhf~{4+6xE z5Kz%hx>?vaMO6=)iLzh3RvpY~OJvRa8B49VhT%|Qb3V#kP}ioPYuTxQ~AoIOAtKH$2 zxJrR><7p`}!q0(Vv?3p1giI{8K}rQ-#acpT+Hrvxr)hn0H{hKg(M?5eS)UcG1w0y<^y zG+n}6jNhBb7n1^iLTn>3YB(X#0X~WJ6p-6#VRLKaYxlPN!bl1T0@pt(dh8BzW6$_H>~dXPb_}!rOl8l`)=qyP^QQ(Cba=SF;&+Xsl@u7~ zUhh{eb)xx|^gD8v2vQbdlw!aT0y}Mkzo!PPGZ$U4$Vqhd&K99u#5l);Lt1afYH+AJ zXq3Flrg7#?3wPPAiOBiRPl*VUaX@{1Ij`RNlGltEMs327;ZCRU$tXZnBTy+=98zQg z>@ywl)cfzGoLQ-HHqx3&K#c?NEyH-!qHPwN{7bQY#<4u%3Iwm}y=i~rDOma1Qm}JX zd4i`oMK|0(6ylmMq7lG9OY~?zUq{i%5L|JgfPgXMgF@7Y5csFs%Bl4;&=sy#>~ad^ z*N&@sfhgk$1rMI&rKD9)2j5gjVG-J~229OS>?AoBs8AW$oy;w}I6Mj*F-1w6fv-+A z6}RwZSn~big5^tM&w@nu{Z~T{?flkz6YcS~PxPsEL`?QJKK<>03MA(?Hd}I=)c$tJ z6w^AP!El$h{&vL4!8NHP8>QURjM8x;HWea!pW+j|=gY|ske>~9Pk!C9=wdB@o;+t^ zS|z-{LK~c~f%lsLPs%R+-NHlfRO=W!M~&6!nr{b@&b}`CpBD`u;n(1jFj&TwXbIZ& zc=k|ksJ@H|p;|+x&i%ZV(LBaNcpPTgWZ=TT)7&b)Um&u^F z>lmL0{(8?@->(}+j9=6(zCVS*>n|xkQ2q|F+dgt(jkBdd$Fw_w2IzS*__}U1QbwwM zu2^;-RW*EWwovRfg%?%2fU&r8@QI~xe}chy3(+^c_Q40L60IQ=OHf%|jqzK&Nr+tOM;Q31JjpoyMVQt2j-U#OBJh?JO$nFW1@HP$!@_$sJyj3sv#uM5Q(k z843zfa|}DJ3-xOWlRiK#BiGS+f@G8r+olLV5em;R3n#vjX)4sSAqulDF%07jPfby6 zfJOBZ)}{)Dq=B?5{pr)E8;k~aUy;YurT`;n)SMi!!9YKK^|npX9kR#W;T z%P-X$0RIs3bLBAU^DeaK2MNlQ0&A3N=AT+P;~4qu7>(`5p|9P~5pV6EI$#IctPx%M zkiycN@j{wmjOy}3%>|qpiHRxG3l!!zW{$Q3r?j?8Z#5d{^NezA?tD5*e;yX!W{&a; z&g5p)Y~k7c@)YF}J7dc2=PR7&pH&o)Mk*K$!<|L~)EElP8Ai~m!8>P;x>+XkO^ymm zE?7xoi@EM^4HPU3!RJzXgtQ#q12kgE6jB_DjA2(#4is4N5KMS9Y8nijGFz`YR|Xts ze46h_Z76K;sta447Gz>;Dc)T9jJ*Y7&z=S;l=7MdjAsJSRAN+PzBKT~JSCJr!i&1Z za?_sjadwLg4m>Rn3rtx2x0aZWm$YU zdW4cFnK%-jWs12p+4(Peh1@8`lKR=<^5tdO`_v&;XQ;JjiuLfaUhs_MFXgT@r6r4= zF*wDD3uSl@WvI2~+)L%oG!?`p71To&D7zKnA5HsM$k)`;$&_+>zskd+N{g{dUhzsH zlS&|QmA7zJ^IF33S><|5DOPV4vS|e+O(jEURs3f(<}u)dWYE=_+Dmxg+nIU4MOMN~ z#nYNXqhub8mUCQLjV)UZ@k7ljYQ@M|wHpmT=D8x)s|ZTDkEA5po@ObWWtAak9S&!$ zR9lUEN*N4R-FKlR2+%C}^%um=q5NC;*!#A0CXebw=Xh3EVi)QUPxPNcDMy_5wQ5l# zi}4l6@|rK=L5%(pDCOXMd=t(pRiXD(%dj5fDP;feKxwCh$-Nj)3oR))m&zmY%PTqh zf3-+PIHK)zKJS_#(EtMLdI*3w-24MnUQ-jxAVtE|JOs)UbB}pb1jkFdij-wtf z_}FVe{9$cQ)NIxjvj2CNlmqE>CT2q`$gnG?z?E|It?P zD^9yBty?OqXD)oaR1;X*ZaP%gveZflmh8}~3bWL){Mi+^y_#=5b_ZmE;%Bbbqv1Wd zZYRN&D?gsSON$~HlyKhCq3Pb(wblv!+DXw`x@4Is`lbB-++>E9UPr2lTnlBt97-{) zbLOSHL9@oLr3-Sc3+|?itF@yg-St4Uhc=>Hp!DZ!M5GFW$ZN3Y153{}cN3C*58Oug zRD?Teh6g!ar=eIUTy8XJVS+(;{)uJESwumGRu8m(%oRrR^GF}PbRV{7Uk^=xEX)9e zeUDX1k64DUL`K&pd@qJ%KRYk<5Y^x}%kJs(o|KVZjZ~j9rx+uVD0Zh_NnSTFJbDVN zL5qi|IIKagi7XzvT(yh-0}V8-jX{@*M7NGyKJBU&ZnV-9T@H|Xl<3=_7MBxF$AD2r zI;-GttJyGdMV!h+KkACBFHVU%ZwcdWn7mo!ebT5b*9iB<=$d{(BFb<^1!@>?ROH0a zJ?yBpCuP<|qcpEOwf^Yt%E#=V4vQ`I%z80<9XnQD-qb#UQdXP)9 zc#96ZreYXdzaO2t`)#Qj+hRhM#gFHu!P9dDlX*&5V?g<}`pbPE#$;~7Meb*?LDn z{!EaVAx@fO=okfLQnJ$mP2G~La4Wr^7l;Cvgp6isE-A%mfyXted#f|hBJIJ$^KjIQ z{FPH+A<5f4%i01+qjGUC=(bDmqWHXX`FKVs^&BEBER znQNjP>8=tGxl2g9qcg#Xm>s9-hv(JKQ9#;Cp`U!@Db&C^J;}PxRs)n8ZJ9bN(M3BU z`;QC|cLr(T%f>nm<`8~(0+MPc5_yM~%NGH}We^jR!3Ucvg}KN#A1t#v))^c12kr1r z__B=9Y7`ygCGaw8?pJ2}sZ9L&W^IYnwmrr+Ytyz~gl%i4n``D$ko3j^enY(1)=K6! zGu%|$*iOskb|JzpIL(5B!uGz!F3ZQ8aF%VP-rdlXo$IJwc$(c^$z4?C9g>PAGW=>B zWDGLodA9Dw|Chfj9a$95cQyRQ|0hK^ydMRiYwQsA2^560*%a$P6UN zHFVM66_ACAbm>&OfO21FHNK)teKnQILj67^$RP{lvYFPBrPHYbnqJN7Tn;J83LDF! z+B2BwcO_VVrL)Zfx)C&aFlc*K>AQSI^#ke7P(*JFbS|*Iqld``1zZUS5zzTW1LJI_ z&7*stBM0EVZZ>!wmT;d6;c-Ecp0;gn)SH9ZSS<8kgZLuHgzbV>!Ipy}B!DNoMQbM(;tk zzqVrvVRCBQYRfS9A_?b$aO%u>ZV9{>Fr$}#SatkfRmGIK(f>~2LI1bZL1)|)@V?=X zSdr+wvGq^+dw&4lrdjSA=UzjCdM_-I%aFfQgtq=Y2r$TDV?Epn5Z(*LWPbZE+!1t# zRXyE8H|#ECucOz>JDpm#*&-ElkNWfX2kxkAd!LK6rpEt3K>1)K_mDsf{I6IiTfh4D zYxSe|_@L*V(e1hl;UmcAhCi~8)$@^Rnqoal0=)Jyi}-P3D#r;Fn~B_ipZ9c)c#X(- z@bjHE{!{69o@1h@$JO{}pYG?8%f;3ShMetT-|Yb$+uL)87v#*BfsU8&n+#R9(NWoB za{Sl76kiq22WsVBrSMP1Na#_rn|sFuOrhhXLWBV8*jUGuZ7z${naPA zwr}$w+NYUphPmv)uJ3<(s$Z{A-}9vZNTGzy)2-d6&mUbC@1mjMaLuS#AKmNHfESx{?S~ndGyig3;o5%;a6dM$XdfmbSd4sy};{^V|^#= z2ccNB=i}g>ZAiM+`)%v$33M^#aMtG8ZFndBcR~&PQ|lYZUQ4m;F3QLH!^x~qr&(lg z<+ornY9F|x_yby}+K?PW1$f}tSMbMgOoHJr0Vn)p$lBHdw~mT6LI`dK*TgWC0kIr# z3ar;cC}MQf-$K}hEBaHb6q!qa5`oM^QPNhhgT0!(=l%1#iM3*c7Fe=o{oB3!~EJ7N`){+|zo3v+2tQ%MDB7Tc& z|JZhd*V*o=9NSD73F6qkQKe}tQ;ITfCiVDD-l7-qNt9DR=(9bgM`WkdT~ z=GnL50CH-JxGfrWqTP=D`efTK>bt81k}QjI1B8=rrdskyZHoMG{q)2S&ix_Hj}E{K z6u`l-uy))4L&gNY;5IZXzUiMdS{b1srH$$KNwH?OjO?`7FVcP!WPV7&$ zTCPekqIAtIFu>3Dh$g=1qXpOva|#4NAQFj!V{i(vXbKVKgns+&8`21a{EMQ((U=ShbzCE> zBB^=8SdgkjIs`D8(g%{(A&y!F8gKUCu1+JaE9f1`jLVL!s0CWntON3z2Z^50>O>Q5p@@*FwjP+8X$ zBU7Sn3bazi#TY$&an=C~!5uk)P$dJLGOzf44 zRU0suiAQ8EEwsk9H@~V8%?{E796fZd%aYvJjEjjcm$nwcdm3x#ZS`|$b$%vXjNZ>Kzesj^NFXLYNph zpinZ*Q9Be66AzAzy#wY8C?3j2;F`gMWha{oGGSTc9iKUuZ*U+k%WO zqM8hHLzsfvNxtyyf$YU3Bl%4$p5yT-JMgStcu*YEK~QnOyHMd{NdPI=$&``^yT z|I^>~f0OPA_oK$4`5)If{UHEO0p%0hyuk=8B*}>pX8plvA_N;miMj)^k9%mD_CNj~ zP|1N8uAV|Dl^uI-ViZUzm(Iib@+Q$xGMkSUqWN(iFH|g$P8UstXDu5nR<5_$#6dm( zR<6zLP7nWZvQqP1B1>eviGHmSVZ6;6mZNwh&*>PaLrSfByIcQ`U^>TE7J2jTT5HaJF;91r`{-l|M+PRiQ;qF%y@e0q z;7zSra*M&M9!gf8)5ag&NFu>mSTD_Txef2r`%BAB>_Db0Osvk%?^CfhL{LsI5&+5u zgWWEo#;fqxm36mE;CIC?)u)G;PXay2g2^i2lLjIlG@Z>l-dMAy>-JA5D=09eA3wtk zxDXr#KzO2t1mHQJ?1m8eA54dKAQAzg<}c)P$+7(F^g};mbK?7dre0ZeM(Rre2J$-W z1Pj1ILWBxv0bqORcWv@hIa`O4VNtMU4)3 zP^SunB~ClZ_tJbcRrSMRqw-5IFg`8B8!a)cjZ9$wLQ@)V3|b>At1rc&w$2s0 zr>T${bJr?H=6WG2;5b?;6KTKYE((owAh#+VFo4&p!XhuP_*OJ^W>to`^@81qr{Q63 z-nG|8t#EAjS#yWU-i zB#qMCg7LOg%Sc{fXMdX}b)GPbe7@XEui;tif(_AelZyZC9CHLCCenHo2_`bJU%*X^ zaZosn*P-by3(;&$2rBr80{8cc`l0ouHS5|FWH04ectUH3IlT3;1`SybD5q}4;S1Jc zfnf{uan1G#%6f0_D4P}Ly`PP$TK(&6mR~+W-&muztCf7Wj{)&KS~wBjTg|9Sy`rw_ z|Mt4vE`icbpF>%XoLje{uANworIqKB-AU zUOR;-+&Z5NMmTiW|8Q4cn_1EaA1)1owlsewzY}0zwr|R4ZSh<&w5=ZGdC@FVRaf19 z3(XJq%p0r6eOu|L9PGSV_v$u%`WY3Y_Wbcj{@s!8EvGBx;`0!%%T&Lr-DA1FA99{N zGzV6!JHqJqt_`uoKdA?*bEGoxj@NhiJ34%Y!h2WxP+VtoTWF&-!i#73YGhL7A8EZ8Dc2&g{e7pQj< zOyRya<($$=a5NBz*gp2APU??EB#0p1;Sbc_@e3A50T6yk2lp@(N!OcoA6zFf7ryo< zG4n(EY!rYQe(g^oBplB9MWF;*Vnhh%Ha1kcfaEjwfC%?(Tx?_k*$=i+NzL2%lnVt? z*3nT}?tAy$l$C>NRp z7LKUdaj2x%!MQGQ6!-W?*9`p+V(>_CM#hsM@`W8payTO*ou;7}@;f_zJhCAoLvVP_ z8DB&7J|soo9%uqISBrAB=dA~6znW_}#*Q7VFDW2!{-*g%4ag0S(tN&OEmu+0RC_3l z>d@G8*V*76$G6aH@$M8QoG2TFC~-SbifzPU{H|2O%b4;6L#%nKXnV?abAyb*%&u9r*vsj`#hV*vZ9W^5=?-lDP#RwX~PFaBlvG}r>XKGIxgN7Has z^){73%|3Gk@&>Nov5K|&x`28vT5=&~lCcI+KNkVvHPGn=trl&QmgV)OYs?6#4u&`n zMSn#eKZOV~1*60SZCrf>d%`IPLtKi-T`(3D{-u#r+uFn$p1l*mRO8r?FSck0m9qEX zJ|T^3D=~(t#s2FD6qqrJ=<_`D-tU$XokRyMo_W^8M4y>UUxd80VZN@OvK4DN4lgN% zOTbxsqn7-aLJLW~qUCSrZ0a7H{nW>6^kjz>M2MH+Td#W@<(K<(0<{#wc_s&0dId$? ztL8gw#Ogk;^fN1O>%cK_=iHMDx*%HK!Z!nzUUDlUPp3WLtUqUPQ6p8@rmKD@gIbo& z!L@MDoMJXkYzr~|@nFwPq!wZU(ulxNY>S3r;}%w7?`&-V9I7^K6U!f8p0BupMegv7lTA5>cEyWE$ zzLk7}CTXz&KfW*q{DV~v*oX@MYhrJzp@`#O6MKnA$p1|2rN1m-2sW0fOzfV1R=Y(Sg|ai%dPN4tig#aj)z zam2=tO(hJ&q-~^pSOG)a3*X>RAEY#yWgcL!tGOw|OUWA{jf^muSmk@p$&--F5EF~N zCyO>=TaE`Y1L&cIdiJFzCIC;E#Fk-{oN_8@LiNzL$+m{<(LsW3HJ$1~-}EKQfl;%y zYANz=N@wd1d9b6_+<|@;qfcoU*|iV#lV!Kn%Gj4Rt@fv)@Gid=3HDOR#Jt2Z+y}Rn zYy=H`Z9?&ls8v%$m_OlcFmMb=_y+iqPaM16NfMPfFB_u7*nR;jthiHAOvYd z5r?7UaCtt8^KzQUv6RN#kHin|$D?Y*O)cwu(nyeo4b*ZGf%RX#P~?&#cmy4T;m3Ne^ZTN3e|jUtAnH5-S!He>DcWDupuLCb1{Fd#)x2 z?R?20VH=aK)-|u__&Zu38~>Urq654I~}L;7fI_j8DW5 zPA06A(S3AM!48T`#rg)3Mkg94IGR}e97K|8sL`KRx|>$5VSif^?}%-jXqZmF9M}pM zfu<2F%o^VWnL$9D)-PfB-OUxd^sAdoh)Y=dB%E>kX{^X9cQ|E~RangOvnMym{AWF! z^=4~?VXN(KY7%v6W@)L&Nl^xfJmY*+dzCApb5+{JG&4sb^|yw@v_zoADjMZuwA^YO zD9kX%+yufMEg>vx8!qu$$S7**A99e%q=+l4L?a8?J&VIFhj@)q`^fme$U)`N+`7?( z(c2uxge;?GYuzIVbbkS}(sbos@ORG4df|Lli+u3ee?JXRfVPreE67^1l*K7jOtVmG zGp|>*{H$D<4_&CaR#-VysEbq7O99-#{5LuXQJ3p3o@MYGqNzkq&JOYaVDBxP;^6l- z+lI!qaVNMt!6mp8B*7)PL$KhGZrt77-Q9z`2X}V}5E3LnAMSncz0aPSdgkrSob!By zuBMu*-}EjQGJIb*wzu?YbZc5wPuEGxeNkUO>$axODbgBm}I$LR#5yrvoel# ze3*YekDkf5U(KUcD+SV-nBQrXQ0MsfXOfvXB9%D){eoE`ye!EolK?A{df6?Z@8j+Y z@k?6n?L)cH$!AQVlt4K;b3Zo;72u+4qc~Idk)mc%e;j`P=XrFQ!!p86};%A5^6w4hUawfOXTf zb*&0@c+7chs~k_Y)4VGSSF8kdQQ z+QOUm(rc9KsyB(v*7;rG1#`}Is!VO0k(e6vcKn(as(&cdY}+)lP}UBmHpVElz)3f8 z)YU%Q7-*r^-p$oNKh$4fxfcK#FNx(mG`Y92jmqeE)XQ&cicN$ne#2V}?xXf&L*UaB!*G!&Hs}yNC{s3DySGs>IvsqzI=JU z)8!`U4pM7oeQH{yt|)8m>i*Ib-2v{-=k%F<5xth z&#~=S@o6S{eR*+J^<8~%i=lJ%fzz22~0F=Qs(N^m{& zk#rb;y~9+0*xq)iGJlwwsm1ktn9^t1k|oU_YFFo@KN39AHxfTGliG)_-y85Wq9BCj zkttv_Q4q*7oO<5fPBlu>JOVE?{A%Wekd8u>M)8W0$|puJ>qfttkEN}Tl#!0>>a!M} z^ETTJo1BldzsB|K$g-Y#lUc_5GkXT@SiZ50*{%=goey4Rh|xApC*r-y7n1Got&w(o31`L+)IJ}A~JLF zG2`|p*q-3J-pF(yN@ zBgfuNdXwLNizrAPBwbe#FNi-=qO&txg!e69b;yUGdS0I)+n5vC zm^av1^xas_+F0${SlvLPf#xpyV-J{(54HB%|C^pwlJT@-!M*@$(%Tn}GpCu*nZqtf zE2_R{^K|@D-U_ncl4qqWPInaL08MOc>NgY=u&#oX7m7rE{sLtzb6_k zrn{;Cs?r#~KM*0GVa?u`h~CK>U)1v3V&guXAJ`l0={Ou0Wh6jeb^@k$T`rG*W>jNTA16#5U(Fqvcpej;OdqAs%yb^2 zIvg2fpSWWj+8CacY#u6CvpM+ndtXv!cPGb0A6sUhQjs6dyPQFh&OEz2`d?aA{1|(p z`*Jao!@5r+F3*ai7fT%u%cssNt7l9cPQFfMbiBXl+C0Usz7Rw`R^vL0P&*@wKgaet zdDOkEV;dOGW;ne}7{|!U_p2>LzfiDWRDb)!isjt@lJW5J>+uw^K9RJ_{*Q39t9Z7n zAEKMrQZ4zzjjoNJ=c(8`X+GVAdfqUoq<$xvXZm&% z7kGUSHN4pLyC}k#=b4|YqyCBN_CrMF^y)nMiEX~H|0ko&J{#KYedpXu#ZRH>D^BuF z%$yzg&&}rD*Ky>(yvVP=`26C|`K8(YOS^l*5c-oC`iu9?Ej9Y!`Bd(t!^Jel<(d9( zS?J_>#Vv!#oGZJlTg^Ah$tl~<@onU%pFjO{+PX&Vx?4W~`31Aj^V@7V=2YbLUG%%} zkgpG^IS=XI9x}HcvY`*TZyr75^7L*DX`_ga9!lfK0v~G6ApB--$g&3_<{aS|XB&-fe!_$y6eiR908XqYxE9ybcmA zWGE$K0Kg&>MziNi zhhds?QNen-;KufbP<>nmIDZ%#hF=ox@Wd944~JL`*>Kx&s&#=p9}2G~zB3Sij+)9> z`E zBmvYgT9Fm?yIea!rP5d)L3C<+#6~cJ3X-J*NYy*JVB^GEf=~QA>+uEv)bqtP*bINI zO)D5AeoEhmUj*CU-u8q#!Xb&*Q*PXo{EMMKi>$Z&pk!?`yht{6@PRmVwI9A%4l%=8 zH5(%mzd-=)rQ5a^5!D2C7%cOOJ*LT!*v}!MT4u@L2XpaY3HpB^vbqfL0%m0WHa^Sr z1-n|MNi(aQ>(dGfo)mTY3EG4mR6W`N>Mhnn8k61wg&PDk7f13aySy(lzD+&amsbr5 z+SG*D8WUO*7vS`FO=CO`{U=9Be%0{s|DoY^{u>Q3pfKrsTy6J3fCvnBNdK43nEjVv z=)Z--|Gj;$zlfITe@V2S#6ON0|F4M_2Ym6q2UoFj6d&c{M4Kbse-JJ95JR+Z*MAT# zQF~&p^1-sdh*mi6-$aWRW%1uct74Sogr00%xV)?WIEo=_{g)d zsG&2>R_WIAV~arr_$HL3&^~#vg*-)|v+ZYlUj}_iS;xao=yZcEJ-P4wZRC=oAGE~F z_v!af^$sB4XHK8bXOt0FOcLL^pa0zdJbNu#eS<;)b0M2xID9K3IR~23ZGSZ0)lTW~WlV|bF+jFVb*7RzvU9`GG0!0DVx-UU<+9vQl-qsC z$hM?Pw@N3eZqvvWi}SR~&tfgNCkRfO z+ldX^F1eSG@~Nf|)!mFuRGeJl7WujfHf|Kku7E9$|J z>aGy+#9Ml}pEjEg<@NC_Tj$P(pieY)weNr;T;;T%bQ`5*xij9%@_Glm)OU=Yn@ve+ zDz7X&F`co`eaL8TtW>U8z3zRJVDMW*Tu`c#s89$$<_m%Fou>a;bM{Je%$%?@-X3&qktv-Po1<;jM-7q%0(xqq?U< zg8860iaI~YiWKXpOgQtV+J3j2ZR&NZ&`2fy_uAUL2mr~Nr?jXuA~P+@CpKoG=d{y=ta@J@+V}WfXCCuG<+)|?lY2$B&*#UJrP4O zVI}@R=tfiR$olq_ITXJxUe**;Nq*qWM~t%{ zMA3;QD7TwOv$iYLTl(HUf3*PJiC>^f^*X2^Pzg&}KxCEQGS0z~3KyLqUvB7zwFqs3 z5$}#fxqddm#3Y{mYg>v@adC21d=wK-A%Z3oIzzr$@hzGFhm#Grx~M8=a;JKR z#Gb`?=L6RqVM4+PoY?F9m$Iu{LVQlW*)o6|s?7KCXUqW;y+^Y3^q1WPv&T+Sqdw0d zryC1%V3no#tea{vt!uoiX9=6x^v=Sa@P2UePhx zT^U~RrWhOtwvM8~<6PX7dMceVitgJ}cuLo|B}<)X;@;(C@tbs|%X10}PRlTnJ|DA% z&6&J1QItxX_qBNkt;y8lHL9>fD;$U{D5E4k7HIMmfAY+HXJn~KpO=(qXiuP4{OCW~ zi0I~WVQkRx`@3a*f|W3`t>UA^pcqDS^fu%~3GWm;D!R8SJTFv=j3fib!;K>Qxsq@= zeR|X+k(SXHR?I%BsK~kbZ62PSmFaj{2ee+gDwa0P#N{T=WlTLjKdQ=#USm0)JlTP% zj>W?BW~{ptzZnQ%wa-x8IMuytUtS>BY#86T^djh3d#?5vRy6F3;%j0%7V}(MTfeHm z>$*Z`l=T-{J6>#VRS~J)60BeAP}Ta})5Pv8OQIvxeiM&YXNRTKvsMI~8Vf||ar_dr zRej3m0TTbA2f-Vyz_0G6Xl8d>NSlhtR}WJ(GV!m@1=cZHl#%;Y8Zc)rb|SF!+I*ZL z#Glxyzf>&Y%H|9^a5Fw-lx5=`Ejsnv}mZPXj3ndo7CJh_Bqn*!k-(&9K| z<&nU^+UTZA_|{&XwZ}#LN}g&Mxu}n|l;S>e@H}qHb_O_qmPashk!`j9hFhUM#Xs$~ zCHbUhhd~fT;cctfu@rf)?A0g0wZ+Fq<5j^E*AKjOhZy$-Yfite4f?VgABv3eVAFzL zE``jx@!F`rY}Ohio?FX*n+(^Ur-FSuYoQz%x1}O#mS~WFjK2q`RGb~x+ZIX5{vDTz zvyKH@Dc73t@^;N08pb&+^xm}dWsUOLtRKe&@R^@UW0RflVa$HtX$)VV7SEkC1&NI? z=|`uS$h)d0c`E1lufaeFkD+y>-z^O7^MK2t+=Qj!&qWEg(~N$au8Qoe3dNO1eB{Td zNP=H9bV=uy_7C=XjL!H*!iCeUw?jMKWDPZV7pP&LxK`CViKa)9o%nO}9s!&Go|*RV+@X_wLrK zy~h|eXY!@Dt@7VV-OeN2oR3f4$Gkb9$-L`4bMj*w=r_M_Wbd9{x_}Vt?<}>Ec2fI( zdPwLZdt8Wq3q5U6zvgq!xvk3+yk`|0x+0)`aQoVIZu+_TSBB_)5v#(lnymqbc?!4* zcXrNspWjD*B`IISlDv`g;onif2Dg0LT=Inv1@Fp2IAFdKy9hVayB+gE5ElIQ?y&!a z_}XoMrA>i^4v|eQDUe%15JOej^Q>O|w%jF;f;>M~Z4-)Pe+meMJkFnq5b`r6K(#r5 zLk^qzHIxvV^U%_SG0vJ{vI2~bTHoGWo9fca{07og2g^cuKo4D{4b z#gb3;?P$amL-Kx}gIFMav?2_`5jVFV@P2z896}%Xi!Vgb!{&Sml-UB8V@c|RSaHNvP~?>(;&Jdtj{7iKbLKF9aPC`KpCN)7 z3VV=cV5xd&$cX-UtN*tY8yh-MDHvXAAnZvB{V7FJ1vk8n-+yxV??`EWJg^BB~c(v#S~DAA-pl+q+C20eQTZ6Z`m(FCCt#pK**APFR+pE4V9+ z1aoE4Ct4{*5?Kw_SqTsL2gqKS+Nm24zUDxaOrq@FhinI|9ER4cM*fsDtDLyeEWBfq z6;Ho8|Ll&D4ES(u2oYft<5%LnbRF4T%y!6qNUpMu2jJ1aJ&oryE$_tycim(x1Su5$=!a1)heY!gy$i|HM1g1%%Ni3H64>OrdKMV#=F6=r4!LBe z5^4M)EVT7XF-><~+0Su5O?G+o`I0Wjp@1)3R3bW7B6eEx)uuEE1y2VmQwpzH@V>M- zY&9Q`SOMm^6p=XJTDM4kF9LQJ*5EB#KyrFay8~``*;}UE6UMTon@E5vU@jL92>|Sr zEKe&}!W`izL$L@;3rb|7|G5VoFk*ktB-bX0#Rx8^&`tiu2uaWs`loewWrOQkMMD#} z>?PI}?7LiEwMJZxN>jZrC{D`x?qB0d@Y!Xl+HREuy|8jdF@`;;G@uf@)e;stxu3v) zfVnFRYW&i7ghl91ulimZ%i#j zaj+7O&4;PYUq_lInDQ%6TSMDJT$6C99DxTOI*j1f_ZcnknCjk*x3QnLwGrW*OSZl= z!nysf5C)cYx3^Vx6ei!}FoNJRXx=L;;{F~I*7G9DyDl?v^!*U zj$}Z1A&P#91#=ng_TFuaP{p#Eao3&-3Kh7f@U^B$p}HN^42KbHDvGeoz!U)!-+UAsC@I@|*W~Wjin^%V%^=IubAPCBJ`u+UE18bq7 z2;wbniZ)rLgTKZH|C|k4KXt>-!pLS01ZRW`S9ITZwA)N{80imMty#sUcBgfeN%#z> zjbcexz%TRJgmU-mK}iSPSVpAKurx^EZ2*9_fiD5a!{~Me@aH4Ed{}f~xI|Py2Z6uK z)370GcjnUwirR?ap{LJC<72tj)8k-S|?UZ+Llw7jP-a&IDd5dKI-gE8C@mIsbdKZo zUo-J{PN>NDx07@DI-q(n(XhEVrFC`6Nj>W4@uSV|We@z^jzUH2=NBE9gpT z-j#GB1C4|E4EUFn_v+-SGF666d|>GL9x;TN$=4s0KHIjq)Ks*EH%~7-MNKrQ7r*#@ zaM9yJ&$DZZa&XB{B=alTG9KkJL?jCq-{714vfstxXY|>hEKBSxIe-#hu-aA_^l_3Hj(XvZ15OK4ZKSO0!W}-#6;| zpsZ5^Ssg=Jd~3?t8zK$DBkO7U>siX1dG`5B2CF-hy?f8R2fq17tPJBK>lq@m)2#A$ zUGWdkG+V4Q#aT)5223z7g}_U-wn^O%<*C=fw;vnDlB|i72E&t2il~OTV_BO|1`97; zJ52^V2xp;Vk;dMN<2VaDQr9~R24iQen-}(5bloLs&&xlv`hFSkvc2GN_>FRrZxKh2 zt={elW9@TEFK&)c$W(9ek*}qt?1~GGH?Qxi8J2TauTV{GLY3v@vT+o$M?OwT(Y($O#ZQ37<-yYj+4DPEa`WgPkw?c1p13p#-1`dpO0jp)7GB}_?^6>FosfzFU0(Bi8W*kEjehw#C2~vg=|>*M?eFYcy014v71xRwr?1Q11#G`qDi270+$zWX z>Z$%^^6t0Ur{5M|e_Q4Jw)ytk4$~Kx0(Fi8odFq8Bnm3YKFt+G&ll9Q#@8)+ulGwD zl+l(ZaQ)lq-Q5>9GC~_bC0SLe#{LhT*%W69c$*cz5fkYo(i&iMplw#T+j$XY&cPgWh zp4_AafQ0KB05I6dPv#5y;Ncn|mX8PnVm+R*=?g}1ari}q4^Yk1icruPn`fL4w3@7@ z(Q7zctk(TD_1s=-vECvRS8R{6Z9V_Z7l)}$QI zrb3@o_tq+C>o8s>E1e#<*_RqX)rP8&9&HcRtdfvH?y*JqsDeL`&dF>x>`q+~Jt~-I zz6mh(oENw@RHo%#h9P z0fA*V&us?A!ky)qYr7-VCwaFDIiOPlXPw;BBKDP6s$_VAoHLI-Yn&q~G|C?-1x^}q zR07C@xTjeAgzaaT;92F=Suh_H)zp4THGbE=(C5}7LyVKQlNR>+gg`LHlsrhQf$;{-E0!^|nrp_U3Q24>toAGeUCpcudI3G= zi#ndHw$wCtx?rx2N4Ltw^&kETd_x<3O)2_kXb8t6`s8u9sE^_L=6P+L4mK;E1F7`;IR>3U=6j2Ht!a+N@${Mw=JkD zez*w#ksO+8TZ{z+|0lCb1ik{>S84@78vX~fs@={CV18v*a#!1A03ZTKCjSiOKqxLA zHYKdlU~ecPw`L;)sBk0><42${<5ivnGPX`TZYXWB7&e!lLmOeqfl@dlyT8&;ZtCm; z53%%2LPTrQNZB9^E3Zb&{#*hBeXXUg-P& zQitxeThpJbJ*_-ZDC`h3=jVw4>%nBwZME&8PQI<6z&w0+678f5ExE0Z2GZ`XjY@{UIP~ zh0NC!(X0H#ZL>a7S1=qyAsJ4J>;xW#`JW~z0q&I`Ve6ad)Qo>mP|77Z&^VWzkU@l< zcr_H7$`@W!L^d0`->tus0hAQ%6#^?(8mzvT8;mE@;g;~LdUbthuG;AE_<6d~(bOkK z?3{H&rqo)y(;v#5UC03n9(}8Tt(dLUR&U-wkJ{Hd@s9~gjclKCfyR^Xr5`FVnD27; z7HUn$vo|zZvW0|SU4qGuS5(C3DHGIA@;X5|lHh_{{fdf?X3&SOPfdHKA@6)WqHwx8 z?tT;>y@&EJ_zBiw!Nf@+JKArY8FoWys0zP}8Ere6Xlrgm5XG638TKOI zVk8^A!s~`du866zM-uQ7$aO$SW$EL)2{*&aJA+k=p>q0@o&exX{8Kl`c7pv!T`(D z3W2xA-6Q_g3dbi!8Li}FjI!PnjBBLkX7hwb1dk2RN3j!AhgxWffD9mLg?W7`Yi3D^ z3}6-JjCaP}M}>C=GE?1riQh+~71@^NpyNu2ST7Wt2$fk5y5UNM6C>I37!$@XjCOaW zWuh-rfSlLG_&~BLlprp zeI)_6;u!R1+l5EYo=&`GKc_k$PKQmbkFeMao-7nl!lDr>;rXcXf;$dm*Y+o%EDdH@ z-%hK?qL9G6nJH>c5|BWvG(u$727rFohAN+f@Wz+>y>by09jOg+RDoFhwRNeJcEIOZ z$q1X@4GgU~}v^7y->(7vEYZgYUI96>KF?~qK?=5U_x|DVs;tm8(!$TDNk(I08fE! zqI1=^Md<#rCbLapxd^3EMnnu}diOVXwDmk|_8&S{H(@RNSgy zPE_GB6&@b+TW!7F16fAtJ?x6QX)c+Tzv*&aJ}@fz%^3^)ma>C#U4%LCl6I8eR9uyo z!H~XXWzstCCjQ?t76QfjzJDp#L)V!27ro|88bX@B1wbr-j|vR1vZHuU<_H1zR&L3A z3vyb#kH-Tm{}Vw$GK9sV-Zl{QeGQ(>rw3ZnDtlA7q{`5}r34YQ|Jk^TZt0Xp0(-9g z*}Qk4un9|yB5F+F_rd*gEtts#9R!fj9baU>t!RJMe z{UNP^CMM^)eM{cU1;OC{TmJr)gh`#*nyp5Udsc(wQ}mRlVIdqkVqE=Zsc z@=XF#u;lgt34Ukd-?IyGE%Lwb^;g~XZ&7yzH5&791RleLNSOpQ`kS`>a(|=@mFa_> zGGpe4mg>pHT751Jm2(cP?1Sx8HP1kxNGzpMX=Rd>1}A6-8uST1T>&UvmH|(1RGOilIR9WOf-qf=}WZVNld(nQL|2XYSqf{ zk3HvqU&IxcMU`YHo|LE#%r=XDcfz=J%xKbvZzj(uILc^WhW}ZBQJg4QTZizA0HXpj zlS>-DHzT8J*qcfOJHX68G$BVjp0wm#lcf6{+aAq-;s-P^@z*eX2qUBZ2?gHk)?Y0# zU2U4>Y+AgDyx>gGtlGb}{$?DowKAHKF*>)UKxP@8D;eDn8OXzqJp!2svY9_LrG1Pt zDW#lx{^bR6N)Q?RHV1wDz;}>Ta`UbTF1_b(BM7?foZw^(+Zt91Nsq@)IaT}D(jSN@ z%-EBsC_I{o$vur+`OZ}h5%AZ>A4f(=Z-`z<&TEu1FW;rDkzxK9{=Lh+Y z=)Do6^3rAG9V?cM_Xwd2qva}1gw`i-7<))PVExu9C2ncPpl`B16mcVVezf$@hz`4qSFd=v%GZL zgvz)WVwk{tJb!T$u}mIj+w`(yf-=mwz%NK8qJ80&y8&C*V)>dvh0t>{V)zEt4?{#fX9tf?F-t3iC7yg^fiBW=35_e%0Mh z$W1vlr4Y-(Dw!u^DZ3)eHB_OVLQiaMw{)Acfk?e!jH;H)yXsPo6@`RMbUaM#4-0n0 z8+oDdR&6#C?>8zP0n+2F)QU~i{`JH8^&;bxiXE(+Yor>sZpP!Rd=*V-T-9fN4Kr%Z zql8VrsT$4xywTTVrQ-OIBiLBs(R@7Dcm&f@=hU*s)%1xZLd%w2$Gi3FsO4(6=`)E( z*f_hXEvbKpT(lm$^?0ixe;dqR^QcqXrBv%VHeBi>S$>6D+8Vp3qGF~{YXvF?IHJ*0 zy8YIqwF{;UHm=>%xZ|$Awe8I7?P$jbq7I~=uyiP-)moqd)YSI&I67(#)S}L@JB`Wl zG~!XNj5Ct)3?c_WWg8Twn`Nb9*V|`bue;a1`o}|)( z8rTDv0iZBYezPzx!};FsT|o?_NE4<+ngpP9WaKb%cQmLu0l=`|L5OH*0KfzutT1O0 zvQjr?ZwCP0+OZc@l1b;&$3W`Tm)6IkFTuRt$MGb=d7e?WjnFwGF~JBj0A*970g%LC zSA*Yk1KY~goc?_kM%Lw?`_miD2ohNzc-zobJDa0=1O##p)-;t<0^7gT_u`p;^QRiZ zmF$6-4B-NMz4C`hCuA|s=pBSPd)9^wg}Fx7BE7kWaefXs`wUZ?4tn+tV*`gAB}T9% zhkT*_BUk}LK7Aut{X@oRBQ)Q8orFgcmAIISKDteCdy-Z=!;WI_4X3Vi`zz7slX3=k z(v^{NN;tN=&5eQfM%<~!LDZumnWJ>3qrs1~&1jq%k@Vl5ICAvI+kLnSBgcmAxJsVr z`ky%PzkJEr`LNNhBJp$VZjET3rE0u!f-V8pL8@}_QRB=ue$$TY3(ZuG))du4=Q*19 z>7S__yy=@vom>6s@Ily>%E`uqH}|AIN2CJlW0R-U#BbC5;K^_XgJzI7W-y*-KxDJn zBD1&#v-rNVgjuu1U9$@6sfhMOe_yO+uZaAd{<0gscYb?DC0@OnTLln@mZe5Q(})qD zY~hp%WoO`lV!(ByIod9ms~)GP%AS`$L`PtNfHGmCby{j0F&(G9qB0>63^)e^^77!8 z0K~XASNwp1rWDbpLU7FswK0yqJx9O-nE=;vTyE>@rZ1kvB%it~u5hA0EhrUyu| z@X3JawZLNpLk!#ou5A-!)%627`XH=CBKF!FwM1DvnKO)8s?ST7&&%fMfRD<-Y5;P2c0!`6}Y{eZ494L2eUD= zmUW$dEs#?I8HBD7{nezonzP;}V&y=aQ|--+BBbYBN)ZPRpn>O>@+M&fbG`nDc+7u! zCHwE^?EfeBbLe5jV5DKHUk|qb%X=Ot%ILrEdGgrQB!G8tZVdkzGkQ(Rd@MCBp3LBP zIgM;9G{S|Dy1k~w8%xz7oY71MV~y71^yUaM%BPKg-SZG%Ncj?Ecy|3bQTk`21{{tL<;FL*T+#>AD?Y{S3}@4S7J=3DVht2b0W+ zXp#j}7-|F(00lGyJSdA>aj`cIeoLV-lrt2ll4~P;vc8=x-FvUnGyDl6gs`Ii4uPi+ zmH!2)Y+o6MSAqgjm5tF{9{G?j%LwCrS&1-F*nZWvO{TUP@xXG zKs6)1v|MZ0UZ%%;Git3Gn6#rD#9vlxdVa7rR$;?f9>@7;S@Wa?vG};##`L(vjJbAC ziHAig*&`<@S!Ls*%~{oJM*OV0^Y`glO%DR| zdF=qc?Rnh@UB!9*1n=2-!;B2`MdQ4t?M2hFMa4z)y4%@B%XTpHW$S*j?Pc3>am8i( zdGpz2$JG$?kIvgg+aF!`hZR4%pMIbH_y#~^x$1!IccPTo2%C z*_|#Ah^DaS2Qj)ma%J zxN%kybK~ud${lIb)Q2s7o=L6Y%%*X@nsuJBPbs9lqoy(X%_Ei}nY<&mU)P(5Kf9Ci z4ZD2KG@HXk2hna~!^6M%w(3ns>j=LT*YY5yYv7V#d*^VS3-YW<0$s+Id}>6O4B=z6*7VGOTF zUK@F{9wm1LpuWNA;JwZ#drETpu*W~!-;<@7^S-O<`czZ^(W!yp&-C$Te+2Z+)|KEx zXr^?nQ~&OhRLbRR1kAzjMPkZlL#hr65`I-B>NP)s;dd2LI3xT#YuK ze7GPud~en~nw$2N=V|2s&h0oi!($b(#MeqUlrl>Bkg?R=duoY3jLtCZAU85ttJKGL zh<`6Vg4gE6HD-vwI>vO~+A=pKSWvI{QaYW+B~g>wHym`n#{EovbfXTQ zZ#@A?kW|S)@s{eg2z6Gl@>-Jd*l|bW9)D4_PKBfMdK9q;6o`LDTNDJ^UiU6m66CzK z8)7J!@CWHK3-kD_Itn%BU>vs*+JoE}~y`6POVncRL3b)7W z2WvSJpHyD3x*_gt#RgXqZN*&pCln`KRw!v8vWC_aeodI=rN!_YY6hN0s?81jQOTC6 z;uHJyTCQc22vA2}^*8fAuS!%jrVGByr$!QUVJwaV4uRmt(E-#GSZtBuE-AD?0yZx* z?G%#daD8ud0c^q$avUowNoZHF{WtWs{lgq~-ObIKX``*L%)hvf>p#CE-u>0^<}2Y5 ze<_Tz__OV%9a{-6%&MhJR)@sQu6xO5?CUft8s;fgX~4F%ir)al;DqZq6ZZ*ht{UNw zG4fj+Ug5~y;mT;lLRR7^6>Ql`LIRISmvv-Z9o%aS`3~(V7RFa7b6+^gzOq6ZSXTOB z>-53!cl7bQo5CL<%DBpZazi`Ml$|W(XfU6XC6xk~QSE%l+u9Q!-pnwn6!1tlZbBhev2NYGa(u}oCstT~NO zTYt6*b6rbuBpL^LgpTGdS9>7|=F*S1QoZ4=O_W+8Vk+S6l|NOJR(N`Szorv+LdI^x zyiQiw$6v_Y9iM`O{Dxp9SAyEVF5Hy3fK4ZCBJed?V9la-DP@+*cgPt1y|P%c^mYA< zAqcZ9SLPi#4ZhlSA9|E3mhOOc-4J{{rb8h3vKz1V#_&27!FQE5I=6qYkB+K&4z$3rCth~Q!*aA?$fu7Znjd(1`!Uj6 zf&%XmQXSq+^1`1-s>63S{U9^c; z^7S06fU(ul9PCS`a8-_#$(e8bq!49Ov9S{;DW;^)#HZ z|5vKD0l(vx=y?hH2BDqYE8Zqh`wolg*bWBfL92Enro8W>Qh)kA!)%i+^uAz%bjUsR zr!S{ktL@HxBVRdZYhCeE`CeWwpBe}q^99f%b8g=}5?06VT-GlDtCg669n57SIBq22 zgy`pXdT7}+kqkf0FKk2TkUFen(eh*jHD*kX?u65<jS2Ry|)dl|BY^1iQ8E!JaX$1+S^!{BDn+ zg4O@9_V(&BzVk>q@spO@+WsM5TyG-mGdJ?h9F^IdHhee~zlVN!;d%gYXXKbIU* zq0u@4k4)@MmuwDw?=CFCoKQp8a5>WB8ns7`w9VTvBmKRbgI2TB9m<-IBCPY^65%GU z3|J4q*-L)f;7T|6ojm5oC9XxwXUv?APy-V4k4-@l%9=~Cn6U7=LOdosC zF8ldCogYLUz%}KDl4r~NY+I)m#=CaR$?XN2M@pD?_xWnV>p8AI`x!DfnV%gFvT}$f zsRgQpZiIiyCS0u5I6tl-PC`$F@SaC31fHgxM9S4wJmCsH2{uFdJg1>Ar&rxi!`6P! zW!ygQ)JlK;xRZ{_%52{eKN5g67H~M0Kl?r9vz7-p5|~Gh0?4ln&yUO2 z8bF*6R!s?Dqz#mSh1^@>wg(0BIYU^E1JAxg6d8ihCH*z5g5VqcMT&z|cwD59gTh?` z2I+%!zX!1V3a~&@C*<<bT@L!v%J)$n~KdnCm7o=qRg8q&(k zNf;b-%wcxy8@9}01wGcWSq^QI2wbKQ!zc&@TZN4}hXj^}5jTW{9*5ce^wMDnuiy%u zvIs|a2~8>uzp4)akK)jSYAX9>HC5jwHF9T}p=UYr;GTJaFzSSm zX+%5n!h>-l)b(1MdB)2B7X#CLXvo8{-v7hiTQ|kME!x`MxCV#D8v+Ek5FCQL27(0$ znqVOiAhCFFF z=k|P;4v``11s@%%c_fo84Q62^n=Bp9Zsbco8iGfLNFF{K;yGHIx@e|}$OfbsaonhO znHX{J&>^1~iKr;){+RBUVQ8qal(^Bt#DVI&6tDPVw4JH>%!T2{V!0=x4QS%HI~=F5 zA*ZHs+?-CKUI@-O@n87j?P2yMF-?ugc$fNkn0^jy9M6~q4-$>{)lTq7O@JmQ1l1>m z%q4`~Bt#G=M)4)aXeY)wCnh8&CemZvzI%d-j9CaXHq=icV{j_vDP}oeD)}1h0f>4g5KW662OfZU6_~Wx_Keqt z`UxttCsR=WF;z2$L^<)7Ev}3YKwyKp!+`TN@tr~a1Q;Wd$R`lX0RUvVbR46U) z6{>%hQhv@MO$26P!Z0HMh2k~|h8Zco{4vlC+vh$`EoVSCT%l4?$pRds2+mWLYomR# zNyUP|Mzzzi8d9HlqgT$0Jt|mB50<5WKTq|~iKw5l7}5s0&wwZo?3gu)NE8!ronXwv zz-%nebmUtqSjN7X0jbRSX$%{GFKH490B=bA?}w}ZMFiu2BUI)WKs10aT>AgdCHKF? z49#u4WTWWS{&KAUv2;DTnJPf1JiXZe&r9z4`mg}t%QO0aUUD1G=#^5Rj1+%dayd)s z5anT)Tv*J|VyW`^?wcAL7?zZ;wHC+MIBJ_6bYue*)BpNo>Dn;Uxf@sAt*&w%wsdX$ z&1ln1bRg=bKoD4d*jsaIdquhZ}14XSibF+Qi?jSitb({&Fae!>8KM z&ghg%O?3wl9ti3CktXNeQO|NDN2TTlheo>S{2rI5n4!M-`$uwK@}`@!9Y4k&9)itx zSI33}(_!jg?_n`RO9{pI{EiO*Bzgnc_KW-}Pk6e543F0FuLjQOQuI_VPFhqE1Wtf} z6<@NiX3L)_{OQ*mu*05=6nU^qF7x-DwP5z1r(lzf^!FrhB-!a4gBbJP}I_;;= zFF74xuKjg7$ll9*HpDe!bvDeqU2--ec=hXSR0Nsjd`yDq)A_i}i_-H61)hWRNfl|9 ziz#)@PZvM5K9*ig>pC7>%oqf)T+W)rf4ZDA%P+m0x2iq3T(Ie7xmvWJ`E<49v|W0& z>~{5daP`v*ne}?bm&p2h75bv=dM$+K@OnK$n)PNQM$`IcGvQ;|%~p!z;mvkN0PF2e zPQ3N)Zb5$8?OsXk;q87!FYDc}Z!^|+2X)(JcZW?^hj&M9$ZYq=T|}SnPx@Yz-=7Zg z9NnLdNwYniPig+2mahL}%<%E|{n-N??gJAP`!FBL8^O?1a|{UJ1-Ie@R?ra1pwA>k zS}Cz5Fjeb-h?^h1;TuH37EWTAJH6i2PKIDpEinvX_SZzPEn|4%PF(%AwrgiFk~|nn z6tUt>((~EZ6a*!D3~Ga;Y*9ww0f-;~GyK2_ULLSjT~dS&f2R932O-Qq5_G8v|B+;LN)?_Ey80^?}h=GToRJb!}IPA|WP2V8s1v zVL}wDFgdGiWUXCcq6BO|`Hbv){^M3bI1zu2V-ZT*gg%br2>59AbSfMM32HjEL{%CY zn)E_pmM@W*I(5{q#^b#y-J*g}1>3ntXGB@N-o$>hrzGPb7Q_60>__h=h9SW|a(Xi! z?~0#yZ`8J(WZb`NKnI<@s-aC~FcNWB#qU#be2>a9P7>@c}&3T~~u}Rnch4 zt~k@}l#B59q|wq%AEuiPe&L3o(X!P}rt9-tp%$0X@+ElYD}+X&4vW!>IdSGod{?0! zozco4u#a6D0igl8(W>!I=5wyQCZ*G0EH@GW=N%FDztQ*q_Wb)B%m0fsCg@=;0{{QJ z76IS!2swZh2?P9(SH~3D>Ze!7k478}DyAdp|JEXqfDPhW+9VuXcqPu-+NQuwg9%^%h#?q792bk9W(iOs$Om z!C;{L@>7eTBPLm=#R@lI3-;<*tbag&Od3Day87p@)TSHl>#a*NGH?DA0x*83LN@otgI$dQ25 zZ07T06(*c|T{Oy-LzVZ&^ty89Cj^B~D_RYx!~=jJZsxDRgj3h!Mu<4J@6@o0@`?Qk zVaGd^5Yk6w@XpqhIuLfe8$m`1&gTOYn_M7Z01E<+-N{6{#02tWH=PCvS#9&9zRyx9gz@U&v5 zTXj_YkO^n)P4ySTtrP&tCcU1llEt&hq#_ejg6R6kAzg}`IQ^XMu|-*s6P#DP@i8qU z4l0-Tv!09|-)wGV3+2yicHl9xk7HzvARqnc2>*?3DJF}N;Ab=`Vfbd^vbRdnXkAeW zDLZlxi4pYBH`&7LW(I;uqZ&b6`OGW@^2l&1DW?kg&a1nut_+iDR0M2tEL$AOE>ju8 z_64A&Y*kx2IC8-nR+O$HkqY7oKe*}-3}d47io8R#+z7ev{It%V^JK7Kv8bpRb+^JK0HH}TzXP$DyrduCNWtju8~cTw~-@_2?29=gDc{( zkqw57O}h~(DB4E2y&*}6scXUov9SSIZrXj|{N4yo?8EnZoMcPAmj#Ga^xUoJLxINY zLF^qQ->Y=mez_5&#EekXmfo@?n8;dclaqn!$>`)PsVv#Yqj=Hs{cL>0tKMB)qJKB; z1AqF&WQ-_gTF*T~WaF3I&WT^!1Y4O^|2AmkF2vIyNx>GSD!5*hbCrL&cj(yJh(NS5 z!&-k4>y_5NO>#&v!P_RWQW8yOEFkS6sv*tRS##KZpr$*N5Xh~3wp$>=F(?%2B>^# zpKM>dFG&&k_eX3^N94-uaZdVGhShU=mtSnG25ANfZEbw$u`>H$KG$rjZdc*XM9jnH z(mBCzhXi!{XqYcGs;EzxN^G@lI(YNakItcTt6^IH!}Xja>X|hK%OEx~`grUsmWFmg zgJlz!nf54qQ=w0mbt~gPhKXObKw?FObG%6|=oK*fJJET#)`A&m;t0cZ+dOLhAm;X0 zU&PpDgc0g$hknmmw1$!!1-~=KdE5xE4p!uFphQ`y>;aWA;2%Pyhc*d~c%U!*?QoVF zmq>WDMrCPiGNN@2#2s-;AZZmj3o6 zonAk?J8E1-9lYXS&v&XY_PB`^*p>Dup7dCKA#nWByzZqZHdNq}$g3>db56pm9Nyzv zQvlw~p~~3H+utiDA5vzl#cyC+O6XE@=GFL70QcJayBg#WSpd}Mx%^Rp4D_}34AS#a zfSTTbM$66fqX2z@_b%a=N^wk>RSElrMyZ;J+J!cAA3xWuSEZc~S^>WdSm_nL*RHRx zf$683buA-a|Ct$nW)*KRNC0CN@=Xoil*?37Mt~y1c<92X#?H@%S3t+iyL8fz!OyQE z+VvwZ(S)XdmOT_&;9K!n?JqIwDP<=Aeuw{ynbbQdzaxrt$Tgu!UBJ9FwEQgK6N-Sh z8Kl%0y6-FSAt5jyK5&l*QhVkvXeRJQ3(1~7@N0rG&q`2!XF!dXKu$rxH@l$NgdoGZ zpxVhGuR8vUo!~t2;P8*Z)?UG5GW^N2!NYa@ZM>l!DEg;0p}ISMSv&kiGJYjHNb(|b zZwvTG>B9=2hqg(FPNRh9M~BYH@GtR(|J*@Z)e0&%4%vi;BuoWbM?$|DtL-O*XPt!s zoV{asBTDRo>l1t$caY|0BbRr*BP=0z1mKf(3~FDabusCadA zl74=F0)ztI$RApf=b8fi+Odn*@3rgsK`2%Rd||5CF=987B|c7&xTxK_2mx7sHsWad z9uI4;SmAnp9=`bOv)C?Pfw^r&<3fJZ!0629P>XuPFfC~Od7Lb9Jd3k{LtsLNU94Xs zzq@l>QeSY~4WCb9Vu4+P2Oob>eSFb++e8l+DShcM}HlYGEkqw&-J=4+kqB8b%HN-N;~y^4L?8o>!JG8#kthu zv(y!sOX`s?Z9_Y4%QS9t?blq|;Z2&B8W8Y@Q9Lpe_X(JTiRZ`C=fT8(0doMc z{Yv^VnB1QO@W~6K4}gN?O+;XWKo7*i0T46(5v|4{0d3omktY%TlbM5xaAC}x=oWfD?u=R9%1_rejbsZgf}{afaw+TG6G*@hB)-K0LkLc*^9Jnad|q}kZH~vKRIIl&3cvfNpIxb zuQWjfnLQBAcK#^~>>cG&Jf^QKfzyoRp`Vz(kk6hMELOmsXyKS4hELX$`FMBnvxEN! zf5(4CCiEm(i2lFBBMc{D{RIC-vfxK|1OTzGz*X1FC>7t5mAfR4--KmronmLqJ?d> zi~6@@;lG5k|Ci&D{~%d-{C!Ed`k#E<8E_BCUdB)_`2QkV5PfzH?`>e`^PeRP4Jy8H zeEzRLJV_Rg{dtEn|HLE50bCf#q>qF$U4P&aW--{4ia(KkhL1`}7R-Lqjr9fWo4P8( zxR`-ND1qdy(M4@4=!D1o(&ukSKS9Dws~ihcs&i*oV&<9)J%;pIz~%6(_l9)DDr?)4?iwawDw)@b02eT z-hs$4zg<&KS##{yaBm`dCANOV@X36jpot8&GU5JMuV_JG5)~Vg$6cIC2?C>GkyF}i_=`O8w*J2GJv=8;JrsVHdZGwM^&G5|9MX-#c<35yE=GMmsfxB* z^8B-WjFT74?_4I9fw5FbOSJmBNsZa8IhoyEW~#JkYJuwbNsfkl2Pp#)VMddzIuGV= zUl@6F`q~w$Eir<4*5D+o@Job0kt6oXMS|RLOE-L%5MTGK1O1ogmav(EzpP07K z;;soKEm8f&KRNcuA7@+jDd_!s*LPi;gp7Whr4|JH1U=vVsy**YHED|HD%&ot2QY(C zz8w#3`6JeUefLRQ=~z0v46*Ucr1d+6cN0gK+)d-5=;(_LbK7Z(O-`9Civ4i<)w!DN zjV$u+-Cuuppsc2E4KvN(-htNnXPUL1+n6NC|2+GG*^-uM?SS=brI-Q4wb)GOhnTX0 zp6}nZ)@1FMj%2t{GE+lMQ8^*#MtWnNV8P6)lWfH`iFS}=QDCU_R>GEM@l9ZS%c>n6D$&iEd^7X` z36M17){dX>>Jd%Z#18)l^EUqi->~CIbsC?{w$R1a=e-F-<~T1+}xpTOo`yyE!BEgEDUH$_1tJvXA*tAL~LE9=6ZZ_hKw}vMqoK5Rstopv!tfx`Q z_p3CIuj>ai(>g~%Dc~xU&UpS62;OVMrC(bK?WGmRnD*I-M%3RO0!|NtBmpD~2FP4) zBJf7K#w12yyedcjw%4m~RM$p?=Ftp~oG8=Z2YBGM*kSGaHw!E*%{UOXk^fr6b0zL8yS~p% zT@HHhc2}0<{4m^n7(0``>}TY3H2xhWbLQuY&l{H`2>B8;x0N4n8!K==ZzrMrHhcWtIrazudBO2|{o2-x z_VMU4gd?t%h%t8W!+~3A)5oNDUyGDt{py7xL#CE*6%h^Tf;fR>ASdGvaz7vxPNY#h z+TrV76F^I?SGv?7O2E}y_Bt9nO?~zPXCgQ&x&j}fFA%;y8dA^;aVfLLFWx;s@6S~x zQUy%R*W@%PFJdp5lzGV+%sfmu&8mTBy4N55ru|@{?e`#m6Ri)%TK;Azk{@|RSwSDo zq5kQae&TUV!P7J^XX#?6O{76S54JviAL+gn1Smm$d)s}?I?N@c{M=?KML_S~K3ea%u6VK*>CKgM`hV`6*Pbn`gjrq znGBxb2=1>5S+foH=nQQDSD2C*27U2TAf zXdclMX&l!_gH($g1IA82rhtu}^caRw^I5wZpuz#slG?v;X-DIIjOKlG{=yI+Eog2l zFc&R?YWq4cy08t&O$AGI&W4r8`dvgMzy@7qjCqBZ^0>2>1xN;nd{Y?JGaiBj zqLGfbmq!K|fg=)Dnf1-dZt8f{`YETOJeKBUDB3)D^|S=CJa#vcYxME1+GNagVWl8i zjIH=7E$X+0@t)db2HN3v)d}6>ao&6hZzgmCKg0((Q#+vYIPTKsNjQwfCcePcjn<}v z5c5Qsllk2w6!s_B;#=;}CcT(Y_1xk9TnOIi4uk)ij5?tslaYKxn@nGoXgQf^c$!Fd z&0QKumJ^sX=uDRTA-N-vx|kt#(wRE3J8{&R?Avb2j5Bq8Kc(FxZ@`REit$=pD! z19bBym7ZGd43W}UD(#>?wHK0d#*waf;(yQg@!=+&UsX^4w^rP*p znNWM$#ctXQ+|(%?XqrFEWgwXh9fdbaCeA!vr)H+&PUdt+GVMgFRdnWfJKX2EG(F=i zTJJQ5qO3k(`b)-4ZtwK&z-;b`l*az-S7Mna;@P`03avybB0^ic7 zH?qj%a$Zqq%g7}f8f9zCz2G0n(P5-3+i+LcdBtw=TWb2@Oo{n5c#sZ$xTsw;b9?m@0N0mI4$$XwD3;p;4Lmj$L zMR}iZ$>nde5^u@B4iv^((7EgtDB_8_#lG;=0T{qbq0SeT>=gkR)dF3lE6_5&=@fr1 zfH!S>UmH~XdA7Jk$DcZ*XhE~2$EBn%sbrv`WN5x*fA;u~CGu5OH7= z>$U^OupUlsxkW9sY&_p7Cf&Qt9Bvu;wqgD>!_9m09 z+7OMTQ!Cnleu0$~pS|lyf!TG2l6du&hx)5GM$$xteq+d;uZ?BNP*Erj*so6HsbC6+ z$~iE;Ezl^ZGsXLN0iwTE1OG3o2L2UeUG%UrF2`SGTuJ*Ck^lHV=eu49Wc+6xs%%wG zfAqiQl%-Gkw#xt1C;TI)JRc(atzbM`Ci;&uu3DV+;uKWo4;|_YT(^Igaf9tqNx511 zBlL=6*XC>g%qbssKT};S;K1o%o$>MbGst9!qq7(yYskyc(ep&=6cTe$*sPnN1sHhj z+oKuc!GtMUA<0Y>QpM*bPdVj^;3}1MI=Np_NT2tYhZ}i%Kvs+3lLro-CmpJM3yyBU zm(ZScSQ*#-7Z#6|g?c&29hOsGF=TygKkRV5I^LNqzJhA9{oD(m8BA}bs5I(1)}H)1 z>Uq04l)R~_;)y^A)iux0rCZTJ;@$yURsZ;~?1iOaMrGE9%0uNt^mQlGaHxKD@$0rb zjMUlc#V`3=XToyIMxgF67iJRTdcwitl$asreMDO{A5o#73EXAK5$0cV`=w_hdvYWS>Sjdo{q0zgQ zpBYz_l9H2DWbxVQkXJ9fxaYBGAzhu0alf>bScj>ssbzYntQm=kB-b9zlGzky@cLC1 z>RiNJJ%+};S3RyFPgFFeQ+%LP%4)X%eI-b;xHiJyl2xn0#r3ek@S%vc@%W1*bJEH5 zf_l~Yd@M^9rChD-{ttw@9gp$M^Jwz(^G{a|YTJ)`SIhhQ51cF8Uli>|e5*;n{|xMXcWGzI^UQiaqLan>o3-Zh z#^&lkX8>v8R5iI$O27gHxw;a^PsjdI&*huDW!csKAll)pgI*G0-orswR)M2=;j+cF zHcI)M<2a&l%dNi8W%reKcL%p;b!!g-7ehVE_vf>N76N@s$i;UDtHpbFmz(HJZeP0c zTlY?Wy*LuiAL>22zb}?z6S%tmY$0^}&=`C9tG5-Pv*)VtGNY(R^ChD9o*ROFM$vRY z%B8Hzo8#h)d)C?fTk~TNvY43P-!CCNWJ>ufU{uN}xjqmHC<39;hVK#Chp@J)c(KoH3Aau6Nbb6PQU;~V7 zP<9jri^)ldnL@UxH@$>p;)BcGd*$$YI zXO^6*Umf9Bmq=vr`2^m12b_%5sT@U}H|aoxH>KR?;CQa6Ou_osD*mU^3?LuUZ^uA` zR8B=Yc11G1n*ok`FK%a=_bibyR3dv{;-xIKsXbALC{f!ZS# zvaDwM{lZC9w5W>aig>AjmnAu-JdwT`+TNd2q=QsgNueW@7o3R)_L1zX#G`n&2a%&C z`2jtXj|wiZ37CV`9Bx$JM$aUaWVpgS(a-1UHfeU5Y>fG2xya+Bg_G$74r2mmiK_6! z(b?p*V?rDxZ{SWQ6Mr!m`oYN!2Nj-Y1or2Nz2D39|9+auRT?4Doj8f6ho2+#c2r7@ zWD3qbraYHoGf*d_}7J(^sRa+g;JTHc9tq&h)q8O-1n+4XryA`6)$u z2jEiDBor#D#+FL3qh9sGerP;T>#HMYhnKo5Wmnw2-3PAX)r-@^JlvzEhwg7*E|nkh zaLryEdA?rPJHC`^f|t^;aSL2T5T|Pf*dLqC7wen z;Rap51Zw;WL|0qEF4tn;3_T8x_vvdKabm%bI|(KAF}ymgV<*!%3Ezh^qQY`!eRy>m zxgKRS%R0x#qH!8MgS(Eeq|J`~{WSKWqvl(k)1dLLtzSEHJXj!c$cEuGal9#xrabX+ z*w~!&(<)g!eQV-~L1ERi6S8>bqr}nAyHyZp9|Musl0*F5Tv|hdA0-1MheN-fYc7(R z%Q{Mq;MZ_zH4SC~&G<)EWhHT7rl2>;w^Id5HAR}kdm4?mKeB(@Yw2+J=)jiq-p5>& zI0N_f?`~(>o?R9QmF^pn!j|)tzE{N$|N0+`R~6yU6{Zr&rMpg|2kz&?X7_SZ z&Ie4Wz`+@`c{vcJz>h&i9BA4?QNRGeX5KTx4;)?u3fZfDd}2gMBJkEQf7{|?K^qdI zaMWk~#g&N@AV-^;4Il#!eIZkXhlU+sQYXhB=*0uDUiI0=004i9h!AP0Mrvz`(%>3M zvnP!EAAB<;C>BAY{jPS5rn|njkl4w^nHhLszeGByltluV_u+{1bY|9d^)@AZKHM{Q&OJ07+T>@p%>e|5&fzZMA`CAJNH7qXKJU_u(S8_(C*oSH!`*ENF}p-rAL5S@u3$ zOh!K+jFXjWm`({>$IlncVJN3!hEG7}>o@3~DWY3|PyEH#pSm(r#l{SqoMO;lP%sGV z@g;6oIK~N`Bv~I$AY#`sB5feKwvl263V;EvIPg;?wPZmZ4$FXVkUkf#omOY|m_a0q zVF(J*tEirMFAhbcz;%$aUC)&e2mL4ee$p8(sY?9Sa4(D;FtTi)7|Ce_R3V3&s2}!; zoD~@nl0)-CwqK5L6+}&+u6J2L$A^myutv$HmzEuPlXMzWppeU`**~Dsa2i_?lFR&2 zc2K7$3X!ZYm({UtPiCQWmNd(? z@w~c!*xJP|Qq!iBfNPFWDb1W`QUaCjwVHIzMkN))iVvy2O|&C-M5v7dwr5oRqx|T% zmn@eiC~S)>elFIy>1OlWHrI*ro*tutBD>PWi#9&bhK@3bQ46A{`x8Acj{^B^#ECg& z@j~;uQXJL_Oa)yCqv^URDUQ8KeQn0SP~$5-B92Wd6Miv2pI>AiRka{)@ z`c^rZMZvi8jW(cDy|*9k7x)5V(u$u z3=`UQ+*9n|N`ox0*3_3;zLxt&9q4<@$F7o?6ze(2e%?k~*yy?VHsz522{~)p_Pa@g zMAL3YOfb>bv`r&iC6m5D-9n((Ozq5Yuygd&7CG8|n|>sNalAH)>w>520;f-n^C%r1ii3*JsLB^2ub zIm3t3ud1}acLEht)_n16ySMS!vW$i%f5G85BSOkFWjWV^=<8GjTZ+O>b=Q6EiFz&h zIHT6(*Aeb!=s@ahLeg(GSoW?vKpLkZo*1kCi}8I_{xb2D2>u@y#U8=<5q?}bw!W-% zd^Pgc3=x=OEB*c^!*_R_i3Sl+9{3d$Jpcf+u04`n;Ome=>~N+*}HjiLtoxd?XK zGX$>Nk>O#x@WDlFEY11u!|rc+h;WETP6$)me&5n$mm&xr=O&&3zxi+~VxuX*GpAhy zR0Jsg`VXJW?`GRQ{`y=Nn4gAyE(fQgapxE<4D@i<^(r2I@fls*QM#%T@3e%#J`KID zU&g{S?d481P|>06MZ6E)_upv{J&|CGd^bVMh)WT7!P({7_^yVa1! zonycIJ2@_%pkY7g8A`ByhqrKW3?+em7KYxA!GuRVr{jGp64BJmrr$&W4mQ} z1}CUu9em0bm-RmPg?5g_Rz@$aNW8x5%{RlL(iG}_v#CCpdHa)Ta)}yaRA3pe*s)H) zeLq}DK=7!+v_m@aAV%(Hcyq)-_Wj0Ym}c+-?T_=MOQDUpTIk5j^tfR=kE5Q4dw=oI zIC7ef$K_Y*+gQae_|+}cd11|4RIlwilbbK!{uYq33e_!sucKZt%68me;sh;u=|$!#xwkd)6b8d?6q!@8eYV!E}S#&SOJXH$fgJD zjwkCl^*oT@jvo0PUZMU@>oab!XE9A_h;S_TxsjsaS`Z)#Y`b$`icOcxa&D;?{X9L$P^x=qz@; zF{ymGGd(HCA#P6oy~s=sb$*7A*Iv#jxb#jwLeha%6Hr^H00dAVSk%WuD^P`(DZwo8 z8LuTB6h}lR=u3fXNS%j4L7)uChq2OE(FxnL4?B;@yNuU+ZN@(zilbHFmp&Wt-Ha)! z*VIbuoiz%s>8yALZ%7R;6pRvVwBrK?28_sr%$bE`%V1wSIt>;CND~DG?Lfz8L*Y(B z#SNj)Ay7oyVD!k~BJZ%bF(DlU4&)qx%hw^@1xz~yVPfrJG^>HTec=lUOiL&cIz(Yq zkwJF_p+~b!*#!|mZhsolVB~sNG&8yfRWkH%!INet?AMZPI3c0=5=g|6H@>*(2r3f= zK~pG!RoA$~DB(mjP`$@2Wi#~vd9qBtig>u1$W$sIRzuT*x^>sQO6x{oM!Pj zkl*yiD4@vgZBRY}B%P@t_c?-Nq+H=;U;#W%2&+o4Yf#|`b$msAT9tW58b9_`4Ukl> zD7Q#Axu_sot~i2LJ4=VaaxY1pyBO3Lcp;13Z%)t%v%c*VuR7-S^J7mG7KibtocNXW z%@#)SW1HWKj-r)PyeQ4jE19&wb_v4owqWM#F0GX+O}W*bpDC!&5j8O_yNWMp9niCG z^VQ-gdp+gtYnD=^Q;GmAs&~P^mMbgg(|S&fcUP2wG+va=n1VbN`@1a;SD>V@nT~OO2iHN^r zsYGVgsdnBuZMlSo(Q1SE%RvcY0cX~`s@?tq$@c2k_TOydznu)Ipcodyz5CYrrrHu( z79^(+NXA!^FH=Ex&mKM^j5-Oi0?piHA%MxAuJ+Hq! zeo$C}sSc5t71j=CiL6k&4paY76Pz5Gl3WM8X;8ZpJGrP4$NA31)QB$I0ND><^!x7K zm@@yR!J}BZ*|L$3wl-+W@baT7&v?Qmmq)L0*v9pBr!mPhBNX}IRw zz@*XLW{Ru2iQtAGVl8N{&0qONX9y6jD-eLe6=?z~^ZU`qjYaiR8szK^*MlunYc0i= zE$xi0t)?D}#c89Bt@7q|pNrd;@jPSEL!k@713Qf|^6m9B2>zRm-vhs3V>F=XW>5?@ z^~tvpsCR5HwEo^}=V1@SB&)w!??BbX~!yQzoKss+1GFIeaCRz`GCTT zq?@!#+U}YwujJ6ml-Vf7)HU1R?p7oZr`vsV$E4U)|H3WPDn=gTm(=@TOoqRj*cY3v zyMcsFEo%!cydfRNZdto$?NowocDij23Oy2TWu_$^q%l3XH@!|JUEYtnJugG5m==3k zLb^Y=v`eO_lC5-_4RuUZ^~~ON(WMBVcOl89^hY%HLlts^bQ@K4><4RC_5kmO}n*=2RVNAvkl>VMFg-JD0eh{kGijhlnhV;JM@oJ zBN%#k?uTUL`-AUs_~X+k#)sNF`h)w1C+=}Vnc-HfwCkFfHmt%vSrvmh9Hs?v)=FCE z$!fM12ctmh3>71!wxiN-$e#K}*q;keMj-X0+zWvh3qU~XsH(HlZz>=F8;AnHEDIt* zOAR~`ET^P0xxm1I6B=Wd1uhwk!@5MMibK}-;{s&3OFu$sA6cZB`2c^GhL~lgSy@IM zLk6fbO|!KoCD$nbDhIJ=!oO4r_4<^*M(O1>RxpOd!ZQAeboibb_or@vlp@V;;a ze&%`1Tpsz{*A!erW^Y5qS&Py--K8-`(P26DikgGjTA{}JrD;}MuROVl&`_rAPn`h| z{ftzQ@|%T$gZU-h`5(i$(CerPz0@i9k>tnbLDtOK=F)kW{`uVbB|XdqFJ`cMcku6mt*qKQ^mz5!Jo{wJ+ARTzf~;;Ed0DrO$wP2|H-hDRrj;ias`V5 zuW7iUqGu(3XNBBqY54&cArBtynFS#Q6T-7DlC)(uj*?WOwGilPzkBoo6W;K=J>zf2 z=Pg}U#q!qK zj4|A3H(Hd_hS=&W8+)ck_FSSo3bN#!_+fXIn@ZT+F z*0ZlfH)1Kg;;kWx9&M4VQzC|gG6Z{6yn9LtKcmR;HCeZctQq~Er9nM5p5bhz9|~3f zb}tDVE~8iwsodI0mTwkzZyo7Lel{mEzDkuN-z&^mqu-#vy!{GiXPvy#mqNUMxxc+- zSqj+F{HgMb{?3yANNvjjqv$T%dF8ZH?}w4r!Lm7t)m^rWxv8{vS3T!l{lnDevN{xx zcp-*KkD`a)huk>(-iq${tt*fhH{TZqA8>vU4O-D2NCrM%WzdVvD zm(N}v(Nilo(s|%tT31MiA6AkcdFrqI{)C^6E<(V_D*t+sw+z2hNklaMJappXN6U$f z=n0xc9+C3J2uttV_XOmh&!?C~Oh)NHc&-O35zr}LIgBpOMO}$0@2N+o;NpL9#4>(` zbzOFUDci0i37#D-E7WbhMzp>__8^EE5q*fg4x+wJc)ZXM-2hAIr+FI2DX;PTJXenl zqN6E}J-WPjIEYFkQ1+Tn>+T#Uxf6Ns?GnD4vn^H>_Nq`J2jSD|cO|Hxp2oM8o#uvOtZaTC2JhaSD4MUn4*V;k~TOTEO)!|?CQ6;Kj??R zhr+`fY5b-*G{f6a=;9*a@kgs)G47`l*jag{ezuh!E98mPj6J{v2?zK|Db_zXo}zsF z`~%C4!+uERqvb?T>cVGVOENSJwXAoSa;sz?A8VGboos#kLth3^EN$R?7)z78Y9!0H z`xPx}_gLI4a2>MNm@b{3R_^S-F=MHt#_^7<#F$ztk4yZQI zCW=V35zdQ<-n8464IWbL@TE6l7st%(v;m_B?^onv*`ndp;9xS^iW6v_mvrIT$&a@a z61hcYfV8_fdYg51k9#64?E8BMyzpgY$ipRYX(=f0pK(2>dXDS$B08r^E;LTTMlLK% zPwH3vqxZawhBejdw3__^E?R--r|(N8zU`c9C4r-^m&!s{8`a9M9}&1zM3HH~ zsfc4qay_a_B7TA-nETI(Gyv&R)xmOD4fp`L7r7#Y<~e*uZ`hOSO(%f}MgS5O1Pho* z44LGD5VA9tr{Q!cGoUWd^om|h5Bc;$(~tk*90g(|ME~P0(2U@XcLYHJrbz@}Xy*Hu zEc9AduQp>Bti!1Zr;KG4HQs8F``J%wG5p9OHn9Q3X&N?%UM)y!GmDVWVtYY=vdXbD z%X&cW3n(if1ClIjD3dd#h=`k$`1Wk6_PsYK?uV2abzkfXgrjt7N^O5w!@vhaDuEQj zE=<1`c(Dl+)Mz1zz*$p^0FpEb(403u$r2`lKY8|`Zu)9k*O>+aGkCWmIMVQgwEjAB~_`t8&yg!2808uiNWmFUB!rr!06dY*&U_~KdzDG-5 zu9W`mWSI$!@3TTc=t%xl3-o$t4cH;2Gx*7Of<8-oXi<&s!1+JC?F>dSrAJBeyy403&`goCE7T!pu3xX|fNy={%fH zT91nFCkj96-=+}>_Wv)RmfsKEh4T z0#C`L3RxpQxD(NY7@~X;x?~Avo2}9uZIkA0KTxKoT!h?ka!268t@wJ&8j9j-LJUPR z@w-+MBn)K4i9fLD!#~$iwJGTIK0gissZ-_Z26!oe;R(uj#PAqEP4pTnqS*|JHCffA zpdbu;fQSgYQT+EB+kL_@1Ap$86BI7EHZHM6DuCQL(qUw1p!GLHOoI9d-Xa_i2tphA zSzWL2Z(BcNc!?SnQ5j3(DidwX>}!Ru(Ng+V;HatRl(Or+d=r)aLuL@tpMC97iK>!K zCzv+B9s1fF#?(=qx~n933lYZ*U4?ZCSUt0SjjY4{y4a`nJqVj#419?TY*j#EhfOqo zcxK{0fS|-f$q>O+A_lJJofXU5ZC=z?i<#jH;s!Ec+fqlnG;8Pa>JdQ*+ro*xNGa%l z^2)tC{0Nw;eD<|uSAr7`fc=mlRXWjD`Kbb)L>S!8^Yyzh0DR6syd;8(hSC5Q%yfb~>`MZD=m8uzIcuj=2{%0T|A^mz9m{; z#0J7%Qks-#(-|}*puSsPtpBDwl1JCAhT;r5w!bn5~tIGwf4{P#Xs z1B8Zdp>-#nwkzf!$^i1bODebCIu3ti&!7l!fiIMSNnq{N%iW*+!dr&x!t%p~Q z1QouiM!S|!P#b)!tPYf=+koP540?CI;U#pPyDwF&S(mpKzj)n!#p zRdV5TT`e~m`S%ZWTzgRbv+g4mwEdz=t#khP$ztOT*BFg;@@^ZI-ZYHEe0b80;&7^9 z!76K7*AHifaA!p-)j~`rCyFoO-=2+O3o{prEm-gV(D@k^!cn8b#^}(Do?FZ|y(L`x zs!7l1qGkYnDY@f^Nqniwq<~N=_oO9TygGhB%OjcUG}m}(^pYd|ux;@(*Hz5Cs`)t{?RcrvEejsE|!_f}nTw(GiW;SN=}I|P@6 z1h)`8I0;T51ef6MPT>xPySuvtcXxM}1lL^|-!*d~N0A45zT)Waa5(d? zS}Ibv<%AeA@O0d=MENhnk@e8W2;h182N3L#-s>$0V^EJ#o4CRrzFKc%13xJG_ipQ> z{d5)xNurefsiFr8FC^aAkqx2a(%oh079x@7^pjel!cXK$px>(ah+{B{`^|*-Lj)%) zEZ3+WYGEHc{Uo22`?ko*eslPz$_VZreRPKfF+p;rP^?-hBp4zoCP;YH<+~lKQd5c;(;p5QW%`c(voAN;4fD@^dOgyVemG=r7Vez?0!QE#Zw9NPn#0y zPhweWNcLNUUoR-d8@?Dv?mh~y~9V`=QK z@>wKfMUr+Vqufu(rCu1u-pk~thK*2ja~qEkdH#q#)utgTv3r#l%vbTCZTi8IIQaS2 z5AjrDI&JDaX(}UK@rXX=Y$n^6 zed&ednE}1nq7M57l@Q`D-r4XOU+S3fsx(#ot?-Jk(dlI1HDjBfam(1Q4kYcsH1RyO zWmfO0HCmWv%BJexwGW!8#}g;E<-hm$94$^&{y3Gs7tb0P&-gv#VZJw?Hs9HSScb-Y zN?!SERWc{0f;crUzU^F9I+>ZF7zs{pdw%T&|EXSDu_km|E5WPk!8+RaW;uJ{eO5`E z<>$`g<<*zchGaQbc}v;+q{=!r-AxMH-rHpt#D*r0CT9B_{_4Y+n}}i75;X(rg{|%n zOl$AY<@SfPMOSGNoR|(Bo6O^`UdozRTFc#j`Yzr>zuyLd-L2P62@*C(H3DZO_eHa- zrn|1DIXA?-pr*)ialWG#gZ-OBaqNn6()Zft3(X5Oxo1qtH$BfB!JKs8;bW7M=x@-H z(uZR?JW6_*#xA_Mwdd1J8u~t1;Y7sWY-#loDvP3Qd4$mJWWMxvVM$o}uakU3uTZBE zL#!smk=4V5%j?j@v=yt?PNFXPJy3!QMw{T-B1Q;#9gzibSTDP6Wuhbh;I&c>*+>Pw zbHg6pKjJ9W4lBI4Aky?qpv@$pjl;c77Tn;y^4zh|;Tu+GKk*4d@L#?n_+FlMr@<2cDwW!UYAvs(E<3%q{DW|=eDuu;x#;I*&JnWt_+F@B* z)&U^_8An!Wld|Dgtm^kU7A$Yw3_ds6B}M8?^r&iu%*)TI2%MNF_n=1>2UauPZy=hH z9=aX{YBpwF#Q|9kQFEEO<;PZ)WcCwheej2LuAc=g`1Y0sQn`mpf17=J2a$uvqNp@y zKG9O6o2Lus`G|3LYR^uxfmMKN^gcp1;t^q!<5iVsGX3`nSB!SyQv$}2bfIm9rTB7R zenUgE2Wg}h$<8SGZKfcZZSWs=Ih^?meIm1X@%E>|ZdX^8dH#K{Ry~ujp7I#MSd{6u z;T~aW(^3yL?0ak3BhAx?N!h#=GIpKZ?@Di%@QQENz0-WYkI!gu2;Ig>= znI7FTNqIcE7@W14we)bP`mw6vzfN#cbbOBeO?Tgzk-x#V;&Dt(Xt!hERf`zYJ%gy@ zmP20Xu-DgSiy&jEzo6+#Co=2%@$*mJ^MuzEW=n^;_5ir3pD)Kw>qaxV>FbIv$3Vfakyrhr-hXj7ZIR2R2{;yv>yB$0cM7?ej`6+t*wHg$Pko4E> z{Q&^)uZ{jLn=bn}KBY7P@LArmlTzwZflCH~!VG?JqCPUt0S3W-VFi9L2La?Jj+6{O zB6kkXcP_5T!4}*=sVI5}!eEmF|Mpj;fCaiBI3JrY!9o^<{#HqX)`aiF)qy7}A%QhY zG3wq5&fZD`eh6K#7DmBgJYXz!a}pliat0uTASiq$WLphfrLI?l40yjm&0!n3&E?&K z>;O~`?p_Eb=Rg#Q4SVPbsvxw;Ck&b33DVpT%T6+5b2b_<2@UoY@C**OP!Eq4x0!DI zR+t0~DP&9KQR!hY%)JZVS2u2B0LCpu0I$QB?~GT2BX@X!83&Phxsefs9#O#&*9^d7 zWJ_}%B?2BLKlQ+8!oZ+HU|le`;$=j8T_pHJG)8g+>SZYV$LL?dj>&|ADN-?81;F70 znoRYmvS6PkhR9wX3l!7v#@C?eH-<5w`#|!d_mtA_H<9CrilUG3!uQl;@d@Hkt0E|x zVilZXCSqe0?jsRwA`=Qlu!`dBkwV1>e7+ur!2gc9bPj#1k-+X8bw!u}UlnD#!{dK# zt1K;`DjjDb4J05E@pnj&Dzg8^80y3e>`+JSLQb?Pvat){cPNVG)&R1)z-cgk4PK0e z+{K0wCGij?e@Ecv7z{UaF>NFSQ4oS{LU@S^L%jw=lR|>QCP@&(xaGivbl%9!!8k0R zcs*6f&~)0v z?V_|2ULX}m5(7tS-z!3joHK+g8KOIv#4;Ebm7G#>XdcqU7n+=kX9}`6Nkta(o*eYj zHc>cYjI-K+g^I}@iUOWc(#)@h4|)GcLsm_JBPdyC0|InRyl;*mxMtD0-Pvb%nR}*Dwf8CSAV5Ejq-u>g z;`{6XoSab&K=yfQv6N^T=-g- zlZBd)bL5q025gW_2v#d7F1AYI%Z!3x>oS#SBbde-7n$0X$Uo>XZ^rEo{4hr<)uAc1 zWD@7#Ebyo^ZOSVBou4O33}Kiout%j`<}LADEY8-@8)GYIo#4(YDZAHGt0v$AC30>;av$Ds=5oeB=r%EqHCMo>vCxE$HF zREw}Gm#MPZ%#n?<#O*ru(|mcte&JkV38#MPzN_b^WW^hU3eV;gE|@Y;B*HhLmEy&f zZC2^mT_nY8lGYH)VU%60A?bmwa@{?w#{E4Vl*MKf#oNeHFTIAlVL z3kq-^%);JqTdFX#e_^ib2>f0^T%mO=rNhtmt)&bf4M$@iVUjO!z_ETVrXE4oMU={& zJ+m(R@~dqqi~VCII)AmPa!4DUlt&7)m-*KUCQy?R?2ncP3H!$4m_|jC`fq_Xk!Ve_ zdsPES)k*U?6r8oDi9|fKO=%ySelk~!Y}V$;HZvGDNBTCqGM95l*R7#8{eWrlp>9bg zY2*^EWOuWM5{1#Jt~)}iV*wp zt>AULRRy+f_P9m04>6)eFHMqv%ba${ttG(?cWJ4_lI!iM8_ju1`#=d!wrt1oF#Bx^ zHB?Pm+tO@xQ461H;f>Qt_O{c_KUYS-MJd1Yw7U~)tCJO>`3+1f(FyV7_bwy&@>0!C zk*rp%R#J+vw&CKoRJ6hzBS)9zF7hWHivcPsSoQ>D0DMZmY-}j1M z=6olm{c(~ZJCbICjvI+$%-K*4f)tPucc||p>WcJ}YPBQrX&J8cz#2Qwh}1Ha7NWcg zRQaCt*^uIfEFeoM!pCV3Cb$nKr4B+`2UAxD)3pcR=%+364%t&-Sy>MirVbUi4wbG9 zl|Kztk`5Pr9&&6omw6iCpM)XLgloMRY=0W=Bppc#!_Gd5H%d+CW$8sgt^XlYRSq78 z4Y68&ta3&#@E-wBP4*eNj_{z5G98jGeJ)&;318EWUj~ig9gl39^}c5qW!3goEp-arZ?xs^bHXn`?|Yx{M8JSFl)&vphDz+>G(wjh~WE zgf9HVmK%l!%t==#$)6`F$)>0Ur)YJi=sl)rMPaHbF{Z5HVPOzQt>)V-+EK zMo|#3Jc=QRvHbaTrkiZ7M{W&PX&oT)FR4Z4%7;Ho*_NxwotVg!z^@!jR1+93;eS<< zA5P(VM1Y{NX}F6GOIBc^H^M#Z`l8$_#o7#=CobCB24G_oP`L>Z*~G^L5SDLZpKavG zK^2ZL0B>|E4v;D9>g4m9KkH7tU)#?a5)U9>z3*If;i+gD=UgHt?A zls``KJhn^UbmKSxT%gzh_6OJ&rz_!Ng_hv{r7TDy|F;+Or_};E`K+bl{JG%zrOuWV z+w5ZdDZ=LIhSl_z{Mnu^kWKgB27@}exxDnP)ABk0wxi2-ATGyw#oFmQ`PsJa*}nX_ zY5Kq92HuN4Iv3|Jn`h)3i=HP{r_(oVmk+v^3+1Q(7)EA2-wM8ZoFW6!zrI|+{)*QCC2pWklh1 ziM6Y4a*%=okd5t{fBlaz#g%&G&596kWCE59>s+7Wx01&Vt-^xJ_{~@LD@CsxKqZ2O z=dPmOX;nC&LUA6y17P2|bt```-wA`jfiAOg$6|E_5J3+iI|+-pbv(Zc&A5j3xrg&P z1aaKQd)-IA9+@iM)pTBBMlXLnyI*L#GJFMs$L}hv9^x#gixln?&L89CZ@+e;JG@@f zWByibdyHh;18h7-Q#_SK-j8Lh{FS8WZM+wqCec1NKS(4*Z_zk8(p7eUf3%t(s- z_XYlcq5|^&PNDv1Orf};xS{@k!wp@2$T&>e1C?1Kn3zNlp->Tqco2}?%!0=zr{AAQ z7))wfnKKaeSLGQpl`|O6!CD`t0mThqC~goivHOb~oL*`d-kD5fNyyUoHrks`hDxQ# z%o4uenl56gqHhJ)70*R#GrB&@+-#_a7@DTPC;oc0RQpxBJ>b!St-IddW)H#Jsc5y$ zX&09K^F@VnHwDJ@3G`b2z1^1r&QTz$>W5#Pnx>Ge#X!G1cyVt(Lpd{FGYRUE4DZhx2Yv)d$7&f3jW} z`x`R*H*RouYMxS2er59TxXxr58O~7Xc)6V(UuU+c_;%zFt=4E0-~o?svfhP`WSeZ^>-=oNJXp5^np-&43?< zJTY$SMUB~-ZL1p+MAWJWI=v(Zw;SHuAJ#;!h;k5h&5 z;bi4fhVjH!GfLjF$Qs#kXgkGqflwPLphIL z38wN=vmx2VCE(d&5g}Mc^P>E{Mw5W>y<+A<1lGkJHwFa$-AYV+a~72W>>b|(?XUBt zHFAazCdJ(HC5Pp3S%Vf<^r+^?8I9nUiFm~1OvCiyx*p?(2{wkZ7St|t#VnyZ7GIn1%7;x_NDL&{L@T-( zY)pA4o2Prx-v}5Fjg);>tPqtKcsq!=zr5bgLy-SYbm;6xrS~0L8O5YH#r%cnyw%~K z@sueG$f&Qx^VuZ4_@)G;7^C+}PSb9ryieEf!?md6mc|Du|?quX4an zcG*DHRgP6T*7@z~?M*xH211k}){isF7F(=uxdzuU9R6shKw#ZV=rJ`(!w`WH)6b-Y>?0;{4i zf~Ow!AFsZMy;xpQ?!=N{%MvEiVU~p;xo?RAkb2&;=7(m1vRi@+fuPSvHcBxlc)YNE zW5G(=KU4>>M2vdpK>cpt#B{ehxye|`X&p-ZLUm$zI{9ueLvgOQML#7ah?ZB$S+

    p%F3GPV*wI?CjA#;*vPTD8i1sCpyX1j>EoL)bp@n(fjVJ?ex!&T zoJzgawII?r5zO1y^60Ln3%gbVK$mQEQ{S4euiq0slPn3KetOl6>dNxPt2SKxgL^h^ z-;IdhylDEYvyOG300Ka#4plvBYxIM`*G#4@`FU;T9QZ(#)+pL+ryL5Ve#fMki{+IRJcO$`hN00mCb)UU>+TpY3zxCw&rNA2G zp6f2Dt}MUhp{IZO*mEuUJOIo%X5s@k%(`gW5f9B>FvrACM1c6y%V$(qmM>nj;o_g( zvuVd3K=|gTrq4R<7@t<+lJY%Fx!_Cu@)^e+KW6yHd+IN__5OM9e*g$4jvx8pb(fua z_?TJKr~dA_*QBMJE<7!pi5{N!)>r@Vczshd0uJrn?TPC@f8_9iSDbj{Z=Ze5Q1l;f zz2DH>dc^R7eY@6f*}X>yciF& z3I#rUaz%L#|M5oa3yWKeF%Z$A!?Ks3UNw1SZsGg+6&s5vSwsK;ICgyQxi?$qzGY+8 zlMgRDXKKZnQ!3tkKi{0Un(p)?%cBUEtSUVEa&vPl0YSG;c-1*ogL_9)#^hdE+6vzC zTm-vZSH(X*XA;1)@!1jmGWCsg|MM+tHpc`oYCv?^^op^AGE>K9=e^?$*y)pVQ3Q)u z$B)j-x3m%gb*sUv&ng?-E1Ggh_T{B{06?I3J}k84%Let1I(2|O4I~(jADRJxWowH; z_MyHpHk3E?sM{BJs>(FCD2?WddkI*5Q!@b6cBsVUp9=5mJJc#c{o-~(*jxJHK;>~A8w*Pg7CoyTbf2_% z9BnB&8-*#$1GMz(26Y7GFlf6@;){42{-IFrXG7vr>C;f<2R~`^e9M;l<2#o1%w+&z zW^Lu{-OaByw4^<#3j({<08m|7KJCzv05Izp_ix<38vuyt=MO(WeexmwdvuXL5%Kb0 z+<*Bm9sq!BCe!frZ2(Yv?l+pPV~IfzAcl7KFEve7l;y6!_iy<^e$JBjMN|I$ z^|v0JGyjTHk3I3w(R1EjVHVMMs3@N{egpu_y8VHT+ileT^T(c_K5=ya?p-+8WtX#r zvth>pom^jh+#~?F{=O&Xy}!ob{NnOeU%B_OKY#smmz{8gHj0CLbOC^0J@sOJW3yrN zwOe0M_+Ea;`1e{bqk6*V?n?|}gF zd0Mu%aKxzGgrV7&m$pi`6NY2~V99DN_yhn;Ru>kpY7lsSJG+U;CSo+4}gdUVM|QQf}%E7on4iDUqnxAgtez?1+j zF@Q_ge5Bl1jAMFl-6jC&SzCi~5#!>3Zk;j_Zr#0i>&`k^PzHz#S8V`*LA|;f8X-Y* zOa9q6m(N-9e$e@s&c%#LlzqW zY&6^QxGy5wx+?~NnkpynyZ6NaFu0GmDz(0WHf%5Ms`sV<2{?bOl1N-){ty6luSEc0 zi)i47_dbgM_wOx_%_|rpnzUP80|CI0UI^rtOw~8g#%;x2d-+ro0svUFssI2JM`VR5 zx_8DNoum3jTC=I3z_jwL<2uAr7EvLmuKe|VfNI?R#YZW{?8gTzsdZdd#5O3*qQ;3W z9_PX_<^@bKFQwtdX6^z2$h=qs)n-3W-6iy2;ywcNI;+MAbVLXMU{=;dWPggt+bo;x z!fGQ7`y>9BWaSIG52)}{6k?isD>0Bk@7zvkeiL=XbYu_6!iorcP)r)&;EARI1Bp@JHGkuDY000^qn}Rzx-}m^vPrtPM z!%fCe>}h5d)&dq6e7|b$A>#P%1l;r?mZ)1}tMr*z>f8~cBh=_MTKX3Bz&)hNV zQ&*ol^_>k{*KFOf{G%-|zqh8LsTHh#GeFSX<*Rq?+ke!ELA`2gKCat`0Ow2|3jmM5 zv8)&;*M?x?f`JW^K?WzI-qe~yQ&C=UpUWWd+7SMg@&)=}vnXXC9^Q^sIC*rodu=Am zW74Zj1Ty%_djNozJj)lCe=KNu{hj>g9X#Jp@Y?d$fu~enIIZH?ab=r#7Pr^Y<{gDK zn~N=KMN6ri34xFim_G>s1S7j57YG0gMfh-QtN}%U*WN7*JhAM;<8sH2$!y*gZ>yut zJBq6}6F5zvwf3x(f&%~`5u zvZ)kqN!44fdGzmlMqGmE#7{xRwiUfY#Y=PohyDTMbFV{%)@%SoLi4`s7yv5Eawg%K>{~O6PbKm6xT}G=8Wl%3{Rm+n<^~W&=4`nbHdr|)F}=Q zCg;3I2?&p!P&VVZ^0HhzoS==iA{YX|<{k0o9iEwAxS{~ieA*FZy}L%eyP9~htTj*1 zFK(H$IG?JDwBjH@bKEMiRwln1@jg(S!E*~F2mltYECS_Eo19g>=UVgh{Nnt-xOZb| zD2BJ!v?&{-`}cnOhhHo8>pSZ<&A9ouK6JX- zghl}HX4GvGCxVDVBN4EbYE|-JVI9|X$bY_FP*)WGLYDDk0HnAG03UAMIra-bh@%X% zui*{?DzXQH6NdKt-)k-|6pOQdb^lWf-rBq0#-P`pchWDu@M&&b`81TUkqQb__`63f zZ2s^OZ@5+MhCZbx00Iy^`0~OBUtTz{dzWzo`;6?{(9b$tWhgsWlG(RTX6^>)kyV-7Jl- zEG*}i$iSILeO3bO+atR0q>4C(hn{a<_CaeiZ|6B-V%f~&D{OZ`k?>T56jp$REAk6h z2tdr$3O%ak?2_lAu>AMy|cE!U?Ko4UR5}DT<)+DxmT9wYbtSIuS{J7 zt=n3lHe!i1q!sD{G66tkSq=d9x3r>k>6-O@XD=|<9eIY?CQfvh!r>f`+6B$-L_hO- zVYYlsMRN?Leesl|uY2=wtT0C_9tfK18h$WN3h6r$H)wuDU*3Yp<)iPw0s9|f?TCT# zoCF;ms>rxhTL4nqG+n|pr)E5S>W~`sET%{G2U@B#_~ZVa-VMPo!Tia`2qk` zm79#5v-?#Q<*t%wrc&O^Cyl7e%X00lK5f6ChDympZFN<1OAAIOETh_v9RQ$3?Nc<% zIIAkkWd7JZTvbugc8|GiHeVD{52e3$$<+7884JZ_g z3qM$|Fth)z-@a@8_Fc~`f?H?L{pA%izkJ4V=N&ojnZ@sM?1=!dVD(2Echwy|Vo-_@+GB~hDRE*)HkKL4tD2ZKrY1iKP zU4*%B;rYjvO`DLLFeD>J(Uf&ti*@^GNbjg)2OK*jivVw}&IgM({+-glYb^lmsBe&! zUFN=T*HQ*Cl?ciY5zQagA*agR>QjHl8Q5>M`BzelsdQZ61|Et1aSlvT_W!m|E41uj zkZsFv`wtfMq6#M)+UWjYl%%ay+D=~L8a!jywYZf5euM7DclvbdowKtX|Jd97uf0tv zb%Rd=mQ6eA;+T4M=@jg*7&o|2$%gzv<6}t_JM%OE38N)@2LOPjYd7HZD{%T1IQ{cD z{quOL{#-ff%eSOF6QU5{?8?z&h9O4gczi^hI(`%Ye6)3kxLljI?}}sU)wOf?&b7L! zal;0rwr-|_fAqym8|OW~<)05u9z7gW5DV^TqIs%w)An7(IPP3sHC9MX1OPQvWkY*+ z>)E-ZRr3fnRh0m+b=TfN#77P21G+_mO*?kQM7=t9>QP%QoCHK_G&MRbvtFxWq22ut zw(bCcJ=vT{ZLQL(e^Oe9+JGb(;a8N2eP5xHyJHk1bdp zA)a;kA*W9q4FHcVSZYPY=n3^%^5I4Rm^yl}@?H|ovyFDSiqUpS`V(y569d4oemO7< zjEIQihvvR-hOIr@cubBx+ns<&Hf70K@ubHA%(|%6#qoiccL^#wvxX%JHya z+3`a&*0k6z$Rv1csuB`KxMWQp5ylP4jvJH#fW@l|3M~}+K}snh_Vy>JsVpBqur~p` zy>6@ax=TzEhL8dI<1f)lbQJ&qAOJ~3K~#HMny z;v_lF2EZHzAM>v<^PS$JC#Oa+z#)>BA5di6UN(NWaJaKMU*qUpyB!T^} z={4mv9U>=dpsvZQ3jnA@5*ZJ&=Z#V1jh;VV?UpIk`NHy(HYc z0M|e$zrVTlmF24e;MQv{C}R_Q{GlUGnLJiuBOYt0+&zd7U=FZ7_|%2t%EYg#lCK>Y zT7cF<;kxrrIb={@BMavpKl$nzrvSjyuPqjTy`ib)mABsmfLp)zxm+%1=zsjgv8Nm% zXA~&x5CEWaP4%}gzc8E0^zPRAhD$%?KuEXzVgmvk5D^=in*X)*Qzlp`0bIUr69Alf%BZ2{&hcZ1|N09T0Kk1OE)dxx zqCb53Gmm`pitk)_T18pT+#S}t``6An0RZ0HuvM{(wIq+c{x$#{J9_Yx5rful+qGof z78Ym(jI17u5D=bT{2l+duZJ9frYj2~K-iJYyQFf2QwzgrMM6plNw`3!x2)?S~TUh(-eD^HzVmd#q- z)}uB$VPZJ|Y~2}K$yDP~RgTjql}8bDtilr~mIHv|dHY$kvK0Vk9#b~7k6mIgyl-^D zv@!r#@Lpb|gkrdKdc_yctUUdQ@*J;4=++5OJgf`=w(cwji#!ow$*Q7hZAhQYjy>_F z?Xlu?Z4TW(ZuHPH{V7QICH4ZT+?0YBNvo?Rv>aM%l-i7+&V&D)$iC^d4Y2J8idWa z{}CLNyO3VgQ32l3lYR?rxG#3d(AhykOcc$2{q03}-L!H0uIkE)E*(1nz>7=Xnf>ZQKoC~C@wX4Xbmz?%oHXU|QA6K& zcXiiJHOC%0`ezUR{pML0rS?@Q7K?G5i6Q`KE#y<{q=9ak3Ry6T2oS%1=U*odA2@z+ zzh!rRYscP(D2lq)Q~|(qOIF@D=S{?jAO^(0&0BKa%u~h=>a+N_H~n+razvawa?r?r zy{^CKk>7vg3IL^S2yXoS-(I@)`U{SmbolT=Z>(I~wWj*mal?N0$a6PedTttQ?X6}) z0Khw*dF9lJha5L%_=`XK+MfMQz)NJGTKLX=bKj7%pgP|NQwkU3l6z&pYYk zJ^QN4bKN`DAi&nTz5n~n%Ruh*ax-DNY~7}no3~FLHK?{j#a%DV*GshkKysh}uwwJ} zIm=g{JbuKFK6BPJ_dHqxTA6oh6D@=nmo$$ZQZ}N0_8S+~G`7S5P*olQz|s#|Ut8WP z`gh67mXjxy_vsdW`?8vMKg=V-pkCRYUGVR(w0!o|O7Qe=&_hYWHa5qz=QUq&LdEGv zm7P2}SHGXivRGY(2(WiQz4Uf#Qai;&F=2!R=B)Fy_Fq}rI%Z&YSij6y&#yG+$W)ah z04)Eo@cO%sQ5#$0*{`)+Fs=N|qspdF&eiXyTo!Ap5CQh=r@3$0$puae0|0E=QT(`$ zhV;o+mE)_+TvMeTDqTgwm#}t^PBk~4Hw^&p`qu(=TY64;#5Rgr+YrB@H>9>*ZNn`Y z1#Zs2VZ&#p%$?&ch91nju=T1fuA|fPq5cl+Q_?diK`wNC+V)GCf%NYDeXObF-wjvV zZoI?-hPF%UBN-Sl-U&eHN@xcsEZ^xf8% z35Q2896Hx(7*e*9m&7&zUjJ1cX%77E#ivDx=YRjsx_u23hW77X+i~0OJ@-B}_ba#l zA)hZOM~k-Y+Vk9kr2~6+A2qP=h=F}~?%8|QPw(E})O^87Qr~Udwz{=YShjAyGP8#;R6Zawf8^NUa#0gg!UN;0b+thD_WacsbhzzV^t;-;pQF1f4tH3#4F82B7aB( zi&wRlmto)T*^vXXT{~trd|bHyxh4WQYE0Rt?ZxFE=9zdnq)&GA!0h^M#T6grIo!24 zpzlp@*j8M%zF1WmRhD6GO$L#6?1hEz=O28&si8@+G=GXkXf4pdp4nad=Y);N^Dqr^uup%!T7fQoY%sXS*huN&@=^Q$FiGfuigZcdOnJ1F%(f z?wWl$=3$bj+(%Fpf@tpdTMQrfGbKzDuLVIroDNHjh!7*RSuSOR+>3740T8KwO-;MR z2moQ~XVQ%#=L4}B3VB)PBO)WY{2GGWc5kT{kw*f%sbFOV_ZpK0$;vxYc*<;~Jx@G`4 zghM}F8-j#708tU3_r_24v|X`njG}O~Ad3i@EJhJT8H%zHA!4N73t`+@^^!k|L0({I z{*7bvdMpiW@Ym0BSq(rKee;4-Pny9VWV1qQ;Yl5-BTouXA~(da zqI;O@S}vE#M5!l=K=#$4M-|tWtg2vbp@f33HE~I2VHie@l$Y{E;5)3kto14tFob*% zWKg}Y>Id@BEtP;n%@jR4)_m@SN!Ol!Oy>?2%hzu`<0pT#FN;ovL*Y}3Rb^iUI3??z zuqqxgLdYOQQItW*M0^1N01*-bAMvU+;R$H67miS6`%~N>$J_2+ThXU1H1hiZx2`|b)yQy~ zlLvt9BAEAbL>9yn$Go)}=$0e?qF*QRM}GP7zKyLV5~p~u%a{<{``wsS2uUSp!4$jV z(H{ZZ5Ix5pVNo^)!a-C3rj?R;7TXuOi=b=tPP|X7YVtWnbgc%C6pgG~tvL=*>lYD; zbfsq%q(t!~^e`1;@X{*nj4gS*Z_>4Dll~zC`kXLfWE;=dcBpc_ph}T=hhv43n*buc zxCEI5BOqEFlg|lPJiBz|iQl{PPuKp}Q6mN&HDZu8ih4Bs3x2#UAboJjc{Vn;CVIvj zJez*g_&^FhBw?%_{P5^p#yz+eXG_`T)Y%E61ykhCP!yFaprr9ES@f`^|DLiCFrhF| zsY(Died4J9`P9h-@aK7Nef|EY_O}!i6s+}qP~{@TT`BK_(sT}5R!D{m_4)-Oh@vQt zA&SV1V&sI>84=S=#CKz$h}(9G)H4tyBIWFd1pooHLJhNpk_!dIYOvZK6_&vC-xOeb$%I1 z3FuVlpt+eK^yAnpx_rwzbslW&kFv2LpC?fM74@ANYAVL&DltB|IMj5TD zJf%}CP+X+gEC7fBfL~JP5i7|=l2~LokuW3aB^T5fdRP^%fe#Z}{7X2*ij@Ll2#HMM z#^sX}Xrk*k(AjF~N-h&!H1)909C!F>KlmMlMd+`zKX@G>>oOjF^d4u94kVnz4}SYH zC6tyt!kmOo*E$CG(s3Sifjx08I;H1n3!gmF3I8K2CoR-A-qx#7QYAVGicbgEAaAfM z@vznh(%gBI$DBNV_`P%9SoYD@K;#7;)N!pGKkPfdm^w%*YYiZ22SkJjAcGi1m_c+Q zBMW}S7wEviFjBQ!J0cHB+)${4?5_d% zdV)2MvRnEGI~b*{R~z;*WI3HzPHzDO5aj#jq&id|Esls&KNF@619Q`M!P1pnHm2mm zY!m|zQ>%OOZ>EWmtY;L@yr!wSIf@G=eQMK> zX)Px_KOcKGiYVwfg-TA>dBhg}aVj3n{*Wj`W~;tA+6EC2jZp-QFv^Jb1?8au5flp) z#}vmvMVC-zFpv#?0D)7^jz$qdq(nrCkepY9=y+KRb)c#J!O|%}Nd92+SZJ*yV}~A- zC?3he@F)V-Uedg60ipbi);;u?}|+$F<`B}UpktE8TSUv1WxS;C8B10~=Z(dJ$CqA(!< ze=?<1N%3&F4RoywENmA-Rc3k3Hwc1ZBFyuP*K{~T;o4zPlp%DJd(NQ(XU5!u%D^Hf z$ly5KcUTnb@Z4M5m#U!9b$qWh zIYg<~?0<;k9r5U8y_$-#gEpKl`?pItBq>lUQgWm)RH$;KAn}Qo#8jBr*6J1h9kL$+-k$KsD zY@#%ko>R8ag;|l`qkH2|5;u31lvhBD8OqOgd7TEpX&tb(laq|4{1optcg8*12~PJE zDk5`T0m?MA{%FCVjM38Xc$!WGiaesREP ztS$H=gc^3|eyO`|(U43&*wzwT*8;Y{bk&MM(kNZyIA_JA7fp|{yRj{&R&}1f?m)DT z51&6h!@{a8qIV&Wa<TLdWYi$)w2A%469>@j0CP#wYu#2SlJ)Sq_(b)G)D_`sWF!bZR;zXF{wuVYLCf7b-~{TJN?> z09k1`N{$1{A&T5skbBdep?@Rk= zlNK@U+3Eu|!&9O&G{q)eAmSAfBHgJ6h2tM2IOi6OL$CGl4l)U(^jzsB{9oQqnvn;<*DN zVyWhm50|!!2UL`@<=7ua^Ts%#Wl{j`g;MgvRSD(yIwxZY%02YlT7!J}B8VYql!8wls^`5WpLHXT<~PeH1m$u4_Qx&`_EuNrR^_ zw5J@?1e3G6A=8OrlZ=|jP`Z7Ug$HE=!XQp1%^X8%w1=aH$3_P%fuB^u((5(D9W7NR8;DJ8Fy z=0yp%OuZq4D47}`0A^v1Q_Xi0CBR(Pt&2B2KRe5Y3`+E(U zI%0K#9~?jF;V(&L%P;8JD)Xuc0&#Q6%1q1?|00zFkIeE52Qqv_vVIK&E6-X1s{{er z?H86hW`-yf2IdL#TvFKBc@VdQA5JJY&bczhwaE(_4rGf0SImuy>&_X6l%a5wK5ptr z0TG8 z<}EY;1Y{S-K)8yS0dNe)qKHH&(nW$MT8sq*0-zWmvPLzw4l9D^Wg#NOGQDqQLkWV< zY-uEb)Ea4~*RMhDK85$(bvQw!X3?4D$`CUFT&3BD%!*9M0qi3;GFf>4u&#b`x7D+$?(7~jwNVd;+^JnqaO zZSPxl9hisMc7%RBiT+7-;JocirlL&kTchj5J}^b$&6Ebo4vyO}EKicR@LKp&-0 z5_l&mgL=3n?$GdA4WbMfKZhvwcWY>Bru+q3U%!RfIc=BuLLA8lfIGxGuuq#s{ zeJYMnn`$8eE&-%$jt5pSiIk@i4Yf!{6o4N05mlaX*d5* zN-_befAlWVztBad2c4x1YaAR{*)%ipA16g%wbi#YrY-S!dX+Tb&B=WMC0JWWPW@5R zDJJg^#4-A20PKPWwPiX1E_Y3Y5nv1$S<`6!Fn@dzctMBaY0p}u=>_9K>-1Y&W)T6* z*-$Eqa*vaf13R;b*17c}esaKQkus}cW$lS#Tes#mfJI0da6Yl>7vI?Z==>62So~_L z6W;^%JR_dDLJviBb)-vWp&^ZjhWFS9jNpc9L4z8nw8%oazs`)`V2}(UBuv=Ha9-Su- zIfleMn(duIq*%(6@;tvbaZP^=)xXIW)jcfzwT;5+l1WX9&OQj@LfR2f3KJ9FfsPw^ z3R?~dEbSc1;F&CA#MurZ0;vlWwVTpTD%*+b5i2Vgr%dAb_@|jyo5<2Yg*5`G#8ha9 zQkxzvN_?R-zWReN|l)I5EMF@Iqg^oUPGo{1vO0)AVe zw0af%k#knr%bGf)70lrz0t;&q?Fl7qPN6y53Rc4sckXse*<`y*etK<*mSmIXe)BSk z1R_lGdjN!V4T+L)lECS=1Ty}23T~jAL&KDZ+AEUbbOEG?vSNJSUix5QP=RZq{+rr6 zuwnMH`X~})^+!zRM1OZ6s>44C7CYyTvve9aC~fDZ0z?m{BsfAQMiN7-HBE_$^HAq0 zL!nRCitU8%kbJPS|J{6A+Lc?*1MkT2ALnjG%|RdncvlFKB<_>#gd+*ge7Pj zKz3tn`jp+66uMD5F)3-r#3$tJE@+ocD@ycOi%I0VBU0Q%05Qc8FT_Uwd{y82ljQX! z%t~PZl*2zmk1|E?`!1KvGy(7yv_O@h!pS}E4+{lff zFEmXlumv!B49BRe;7u7)oep&vc?K_BwP>3vDWrbRP%minOeQg=YRN}ik%Etso^EuH zs_pjt2YoYhFh$#mSobrl>K+^?j_ncs`pgQg@@{&u<@F841NR_4Q4y7_Zde;Bc2VS3>Uk>0 zCw+=v0%&(D6ENjsQY=GB7f(B)&S}qNYzvgJwXAj_U+vIWkL`5M=nnF|u|Q}2@#7FM z{f$9zJ@Yh@rjmX}F@q1Z6&K0GlHvz#$PtAghLc!XI4W8YWJrio_{xP8zE*NlEw~Bv zGJXJR(n}})EWD+7PewZ7NA8qs_!Jk=-R=Q7maUDDfp2&O`-6 z?x+-k0^Pq+w0Z>vleYWe;s^hC*(l&~rDF>gC}x`y0N8U`6J}QtT|6DnC-5U^X*9(m z>fcrJGSs|@RWsW7Ig6+>tJbYcY}0V-)6D7+A~}skW_!}$cj0x?ph}N+ks<<;O#&OV z&8GhtumFGr82~hgz=^_OPIp7>(@WciHryZ&Q`J;zAx+@4$J0zB*S2zIGD@;R)>YTj zTS&=vbU5XfqZa|>%=Ij%s(ju*fKr)*A)U3?0UgQ`>Mtw@NL5I(vTD_u_0-?|XrGe{ zx+PEdk^7Y#L-GwJE}nivUVo#G!SeVDjHn?ZU_=oiMPMgU#2k8Am+l=hL%O2ecZqRcl}Da%G3 zHRTI|ZNX-Gl37ExshZba9qHB|XmA6O21Ec%n1hvvNMC9{Lo~5Slm$d~kQrWb4igb3 zLy@4TWH7+oZU5MWrDYh>HbG=xm_8A_Ic!r96!#^$z$6?%+o9MW&#ADkih8p25^Z4^ z9bqe8b4F7GtEq$j1(DCF0sIOOvD7-k$~)WQv;W-Ws`-}*wsYyJ}Um^&DIa=>_NW0s`0fetBNrkeeeF=&CDz8>wIxi*$q>3FML>> z^-POtXznGILprCk&(21ebZ>)2l;GCWD$gIC``$~<_b<=0Dq|{fYN=NTeC^7bVhl&$ zyKi@sXgUKLesNOnhN)#Qd{~_IRI_>f{V!E&j2iRsK^@IrO%J^1R)+Vig4Zs|6^n4p zgZW*Jgb*P`1ORai5P$K=nj4O%*RuLI zysJ=AcZn#Q$>g8;69816_xa}5R?lSzFLj0`l{0Fx8DzW(<gQ<4MA8Fu)zo~<#do`CQgY^M05@sT z65o&YPFffeRO3256M3L*~*E%%`xThaRWWM zvQVCdOApNjEoCCOWI`4I?p~6&lwsm**=O6-pN;kY8?1!VL=fAv)=0o30-%rg$4{))e>gqL*u6gR zaU(prhRU<>*>M?&B8Vc0vJhn;lg(tZmrSezfVdG4dV>pgpa^14Op>kWvAknt``7bT9rFf`1+YG~a$k69b zLyuKfgN`Rx!;d1I9L zgs6g_OG;02lE|ACGh4Tm)fee2#U75&BngG?Ie^#*B2j@LPmqtHK=xC#ABqWz-Z7K_ zsx2XF5;i0CsK`>nQnXdfld-0(O5sUCEnUvdb7^#Bf(j@GvLaxNSd ztu4x~ojx?vry7@REiT>~2W?(DyJhWeeV99x)+~O4D^c!V+&pu1`K5=I-?gx%rC?Kt zgmn6_T%Q_TvZc6qOVR3d?&5?8n(JE;0CO3<;E?Et)3V18z!@X)@s$>wyO$Pcj>ugy zHoE(5Y$-%`%L2t`3@z_dlUcI4b@7(`!4a`kG4m8wDH{|$T5aFG=a37(WNJ#hW!);W zu@cEKK!!>QElupq%i=>Qbqt>7=p?Info~h@DU8d9)&Wo3&Se!KNjs%mLr`i8gYeO5 zYD{dz1c#}~UPV3}$}x2bsFJD?QELrtR;4jN1*PD&J(+wnrUw}QV0epJD7>Fq^s2Iy zYQfY5(z-|?Yo>vn@QA*4z2oYg^zuiAE|oZQ zG#hCGAh`U{901(C#Kt#TP}%J()t&mmh8l_%#?K`?-@STg{PMciE|oZQbk0;TuE*tv z#9;;dFZvOof1r7(PYfW@Gsmu>SdoH<$3h^F zl#8D}mYxRo<4ypO?E>~+1W`Gn*2!xIt=eKW683fu2Y+ z>IQY2D!Q_DT`(e1fv%fiCWa>!RTcaBFrz-Mgw*HL5)a$Qh`*5=O6Mp^@2tkmn1d2U zt>%H)9U{>K_7#c9AE*E9HQF~?nE*?rnz*Vc6aYz7Dcl4Es|s|Ct3ydgPV$}!$d>wX za;PQ@5FjF@>G)&S7^n|I3{XV$Zkm^-bMKMCj`Z25#_K3;`O{}gQtP=fQar%l8(L}k z$MNxlG9$Z13pU!Y=68!)PZ(Tz<)pH|zE?0{j_;K@yiaCbUHrn@ymE)6Q71+cc_`JJ zWKs*Ry1i*&kv7*5HK=q`2Nlq zAgV6&I{Mw)@d*PmS4_w}yrO6hXByX&+x(!VJsN6)wc!nk4${>SfKEI5@MmxTo~}A~ z(Xx}j^j(i6h`;;R)mP0pb;^}D{_&=3`}gej_)80}{PAyZ``Q(kopHkYk9S=D|`i5@j%(`~Qsb88geQ@s{+xOHzJa_&N?th}WHE;5}c0QY^b4`aEFFtq1 zv6Bb(?ADSmEd5~p@1CCXm$~zqr)|Xc-xr+ui&+kp4U@!F!FeE!1Y#*M13tXQ#O z^R18lur1Ldw=FyE1Bae~D+Hk86L;_0x4-A-zWJ^5Py5_SQ~GtS-LiY{124}1@!y^;#9_i?{Gfh6{_J_j zj2>2ui*K&}=*9=0DB9y-h}_x+1c2eadt7(U$tR2(*}q%o)_n1u^_%}Rcm4w}El|8p z1b~R+2KK%F{8JAfHn3l}&aH*w+O0btoww+B&%M&n)DlF~>9M{l^6RkPJ-&9%$l44-wQqm#%dWrXjN`99 z{rEvWyYATA@bJ9Fw>iFKj<>iBXRfqm$FlYB|+XN6Nj1XtlNWwwWRODKwtcy!a z7`@c2(kCg3HcUL%=$o60%RVkn=#@EPQ1-=j1pv7G&@2Glvn0>wzm-~#>@mH8n9l)8 zRu*sDd;HB!`DI%R6MAP)7@T`)T>$_-cUTz!+_Si~bhe3GK^)Qv0pP>Bm@|_AL~m|| zW!q^&51iINdikRQ0DW#k4gl_5)bvUBhU${^PQB97(z`S|FdOR-JG}H9W|iOVZ#PJ^sQ^UcB=XH6VDrA+tbjvt!}TW+_Q5h0NA#tULN1B zu9-Y3#IXaP7|?H=cgim>zhM22-3?7G{kwI(VaBP44(@;YEq4&NgNVnB9`?^~f2q2n zyuPXVgRMJy)^6hHdRITs!?dG7L+)#YVpA2H#37o9z3 zK;KXQ@*WM&xPkrV{rJDDE6QV{^*eSSJ#xrPKm7Wwv*$1ZPGF{v8urY0uc@vmuWxK# zyLCs8+Ky9451l%C=t&bsU3S}j8kdtMjGq0SFJ&`PzF6G4dv7k288@i!_(6ToK4QY@ z-~V4@>Dd~&;4CDR&-7Cd8TMqU-fzDTSPcQd$rBEFvPAEve*f1^Ev==x2*7Z XdB z_oSa)Hgm&{-3?7G{kqnE^SqNM4C;5*kM1<=e0QZ{Lbl6U0qe*>gw)uj@*9m={0cv-8M}OUM1;I=UF+&CT!D` zt$`@jh(}?b%YWar_FG5K`0KrgueyJ9{&YNYhoPs}(D}a`VYj0q`CR(&ZSaI$2G)$y zcWxV(m?R74e=iyT)+>5{y?b-j1GHdj>Jgp)yLDok%dzvEIRgO`(5~@Pvmtue*XCC>n^`x$(6UZ-0F2N+i$b^ zb02-`8Gt6`ojzsw_?N$A@!LLf$Ni50!m$VK^Mg2mjv>zw>>^9DdPtxBlYhJJr)n>HS9^_NlWj{PKC1 zB(gqs{E`3qjuSrj_P;v)=f8UHg>?wZ9N0D8TF(M!(+fET^>gX=~{c~DcR z&`teq=yT3``9%PjK0I{%L3=O$yHDTw@G<~AcHiB<|B-hdvHMQP?YqYXH{7Phzw_QV z&zLg&sUKea#S4EvGB!p;uiJO`b3XjeHyymsnO9%`izRmnI|%@0Pn){e!mW1u;AhsX z8zF*4n{9N{zyIUwU$W;xJ8t`%yZ^{Wi{MKqy>7;o;hXMz=nY@|_QOveWQ?S9rNC!cW8-e+BP{S~*T))4?cdHid7 z1I_oZx#{n|{ex%MyZ`{(ZnEJ8pLp-SJ8b>-!w&e?C0AF(z@$sQKCQby39!Nce*ar$ zOd0;{4=(=F1(&ZI9R+~n_TS^I51)L(L3^KdXIr=0YP z-4`9Z?`}W7{&tyAz!%?k?2IYHH{bX0@n8DRBTp{}z>mK6@OK|^pp3u4VvdMz#w^nx zS!;4uv1TKaM4<=Eie*HP-GI?NNtRALc8eWq%lZaAmvy76UuZZ%*88aBu)lUotW> zUa#k@oEEoe^M zeQ0n1PQP{C$e23+VTN(;@zXAS^R!FfJoVOhP5s&tgO~h%?3f>}dwA7&wrTUSKhlG% zX#dTcMf31YyY>bfIQ_P@BV%p0Hdaf~H%hJ%#<3^|LD#TQ_u|EDp#me|v8R>;z~j%X z(0>8wPs>*Vz=m^Y`<06+LxW#D`^R_O|4?GckAHpRspnq`0LLEqVxX3Yh}tPbz1JSJ z4*qf^CGtR&6wll804gd~Yydy;ddIQZD&cAH++L5HR_dNE**}u900FKym z7m#Jm8B?bmy6X-AaPrsBc;xBjiJE^s|K|@r`AkOh@L=yF-#hO$pFQ<+KfE|0A|PCN z!)<3?bv*#Qe78lKm4LS1cs>Ap`NGQ+A_BmDk3V_D|M}VhAN}Gbx7-o-e}+ZJR9>y9 z-JCMm`}^;nchqOT@wp#foDdNJF1+rxGp|go@8E0LW~0>lFQj$)!?Gt2|EK@h|L?ze z@hx{i2Vit3rfDE|n%{H4im!4{=Mxby~RbpFVMg{tEL9^t8+AV`6H%8e^T4P?oSW*dr zq`T!aRX>tl`E3g=QTboKk!}UO#xo-V(R&ZIgqD+iVmHT7 zfk2XPmlQ^urhSR*%33FI_t>fRrq3OK{pP zqX6)RoqNYF>a8B7vu_^_t?JeifK6xORwOQRlh&5t&Ica_fQ>eo zGqD3EL*rqoUPyflV-5hoZ|=I!n~7`h`6DFzE@QNIWaQ$T@4S4;-D-o<#XXNb0RVGn zOjSBG-TCk`cEJb`;GW0+1OOY)nWafM4HrpX(X{z}k_K zi*H(b`E7TFE)(4Q*q;Dk&h%-nfB5i|&j7&wix&D0KE8bAE%!b2z@MJ3u*5Bzcq^|K z=7n{mm)v~E<+t5s7BRK{D7Ws7=0i_C0|5Ii+6KhB0noDLD{t1;-O&;!mg1(#Dr0Hj zuf6*|GG~f@d(Zs~Ab2 zbow6p(vclGYnUBu>70DIJoy~K?jWR1iY!|I1keK@_u5w-8-h4t{qx{3r7dQ2CF$_~ zH4luRdc(R0S5>M!?{{OTykzM0I}gqp#_!%bx@xUzPHx#>{rz=!Jv9yhHaF(Ik9^jc ze36XV;+AF8i}UVScglfNU%%_ntl{RnH?Li_mf!!7$s_^t!K9ecBe@w>N5aU*=L}=2vn^lj~BxFCOJ- z$Al7!*4Zm-`A6Gwq#QsF5m_zIKEFnu5df@wel-A085(3p5ltN)KE3U(+5BV|8&NA|Mjygm;CX;348{Ae}`Z9Ce{>vRF;WMShac$v^HuhpI-w2 zQwHrF4N1#3nLGQ$gZJKc;{`*5y##eTZLtXeAU24Qy`Ja!7uI^4wRU6-00tV}pA5r; zJpfq#+?s44o_TIHWVZ-`VB@*7PJHRU+itSq@L+li7468a2QvTrvTOFfk#bdhGYho?QCCBUjyV@AEILBYXP}_=1_wSQVI!=gvOyrTZ-0WWmtjU@~AkZmF&7 zmIVCo%YME0b}#zIyH9xUs}8>7!N=}h_T=pkJaX02d!Jvst|oE$9RNt%i}DcyShadB z3SJ`O%GECbz?4BdQ8qN#1ArCJXWUZ`BLFl_;~_jt>kExpLW~qUoQy+cY)98_U&obw zJ}mY@l6YO#Ah1?&T#?UVkmq}$9Bh`7bZ08A>QP!{8LO5+k_>XUR)y`XPy7QKsrW|Y5jeOzUOTT#jWoAZd%TSd{ z2>{{UM;!dcw|BIjIwG~5eN}4xm09bbKljovUT`^Rja{uuoz@{!aT{-PQ(6<;x?oo; z&aYh)`Ss+F?ioczEt$OYavpVT23+qHW!oqg1nzDm=`zY&7u`ogcv{QFD?nIq&rxGi zrp*-Cn*AX0lSr7A0N6SFox|#h@E<9l;DqFKmSvTcp2$B!@O0}PSU*HuuMrow>Y9hz z54{BLUqO#Q=kE5YOZ-%sAZT@D8SIx1L7|yQKzPlAV;?#Y?qA+6Th+RUj4tv0Gxoxx zD;^mC$N{kJ1_KR$$=cP7bj`!R#T;rfNdx zH#M1DwDO5k=oK#`Y;yiJ#Ui9sdh6CVWg#zs4nywo#M7L64gN&MqGS-E;m;@00C_42Qr{Ce)iuzw^|yF1l{Xsx>d9vHIJi5B>Ldyg@Uf z{O_zQuRHU~>$ciZTVHhOt~-40&BxsJ=%0Re(;cp(mCb8?M8L;9ClZzF(@73bQB2y( zTNlvG>L+49l&4!LGrV%Qs~(!*uCWyc-QiQSc@?)gB4VPj@a@PlE({a_s38fX6g zw24xM@T$ijh|_$)K6kvEGp}-`a}2)MbYQx7r(M5+_=5*%=gqC=vhy6$_)Gm7x6Cp5 zGN9ug7Xx%L8~OES0CJ8qg#enoVHAM0io@Dl-76FfK!7+?w1`C8wg50R0KG<^rqiM! zY5{sQwsSU9-XYgkDyZjSwIhb6vQpLrO}eV;R9n)-DJG-t*%09ZRR zipaFRux=dy%$`2Y5l=ugXU22@cwt@Ie4E}FN4#l_(#l3_D|@cPbsGCP!Mj_5k%ha`M{U-Pi~+#3;UV#o zxU%UoAxqI;1UP1&-4NiMU)^}-mDfGHW~~iul_!!OeDdj^-gx_$FTDI!|NOO6FTM%@ zj@xe!p$7e#YH7|(iG?PP-gkEdIOpmc&-~?eE7z>i5*7v|*Qx|3AA0hcpWV3h%Rm0b zt3Gw=sTW@j0LSgOJBy4^pA^!GxOI#`$B*;Ro;JnzclPwDAVKMrXWi%+08AYk$`CUJ z^C3d%Ul=I`@Tz0=k;4vI0oA7}*wRY~22mGrbwdEE{dOypT#|)Gck}RnB-Nf)GNZY-EBHW39$beRZAl&+N4VuAriFao}IGTip@TK&`%OiyD9dpdP>g zK@VUc{?`CB2o1l8fDnlgT4-8m#sM61lmiaRlfPJo{jFUcS>ogWjk;~MI zJ!{ahw+)+qRh=g}eLG;sZN+L45FNDRLI8O1iKn&r%qhbF@c8m{P?FTM+HvzuQm+x+ z3rZ)K9(`s-OSH+{SsTrn-~g!hZAK{9Uyapu%10Pv?3tFoetw%FLJAt0i;)2AKxl0A;zXScR(y-mL3 z!AAjL!`U-AFIVnNY>tYRwEv=o{wI&olTYi$nMa>lDf|rG+-O){Hxdh&gD_^6cEvY<2b z4!Zq+Hp{YVQeT^Nsjr7do!n%zkv^|`&EByS{tJ{QCEs@vdC zUJwot4y2bWdzXdXB}2z5MA>Y_{3uzt9&F&K?FT=+|1bbtbkC@{(dol11gKy`gl$Wd zj%~D3qvS_N75AO=<=+sQqE^N7rdb7%zKW?sjxp4q&l=4@7VM|AFh4Rn_V;f(X6J3T zOu1kCvi;uw+E)Rm|-F+-Uv>kA67--1W%ggM+=H zp`pRSUeh$}4?3^V6VgO$H8M8-;bRZmDJ@bGy>`Fd-}~x=0pOw=?*MrP-RiZK`KcEG z03ZNKL_t*RuDY|OchAp^QfaTW~AS_nYSQp@-v=H}L0@~)IUonWnt!k_MDcuhHnPB76!1b~koF!+Ie z^6zf|z|sG+`tj#lt%0EPB{(AR=FMGo^6b>?+^IN#004JAIezN(Bfeb^Sxg#{$e4%! zIydC*#7>k94cRAf2!8!vU)XL7o=GJ8c+l=U|LL-`(w)zJ=ZD|;(N8n-92S;q%Y4Fh zV4ykw>g$)D@s)?4cxvXf09rt$zo{F{ngIY;+`ROHYp!=YF7QL&_};!dZo9{JTipFh4U`^?1@JM0LaS94}X2rDaRhZ>sFgB`P%=v z_@<@UG<$FNqD7l;{P(Ay_ni;C%{50WSFirq_s;wJyWaTECmi{)*B$Yv70*r^9$GMa zCIURZeAU-3x+13vvukwB=ixc`H@BQ}%wfB1wdrkN|K!Ctao-nhvC&6PJMX(6d>gpo zTDj(hkDq@2*WP`?KfjS%pE^9W;hdQWux$CNuU~xi(BM!r(6lX$jg5|twQ0ArHfgge zaTitN2Abx=>zCa8m4A5TsTDJ(4sS4H8UXzA_Iob8ehC0a-~r)d-@EWvpa0Ms4%li$eE^+!1du@9ss^BYx{1LUbzCC&Mq+aX zMo`4}{#EWY3ccd_#R(^t@?YXx$jxw{raA z-;e#@n@3(4EjLxxD#Xq=`u|1ADGw1x`H=q9Axvk8G6O25uV%3Y^_3@9NcBe(rJ^IXwbFR7Z(?9%K+v=MxU}S9UkWYU3GjBTj zn0&zb^gNk_R6B@Ue&Qxy_ba%-`UJk&(L}dHmv=mwxppzj*rD=W~NW?t2SDwgYzp zz;&aehkoKKpMKL(NAI`W`;UCtQ>&i4^7eb*@pbMyFHFez{MV(|EP3FuQ;t1s&xKoT zv0#H2Mn>*_`0=0JwDc<%{qnhWqr=0)y@4JL5F(6^kJtpGk9i>;qf>u&_2}66yN)<; zqq#F5eP-nkuDR(mKf1JSTa#77B@aAu@IQX#U*3H50Xr@{dY{F&{_)`>Kl`l>x?XVT z#$xh8@AXSjkKAOG-DT(0lP^=Tx0AM-ML~)%Om2`_6(}?>zP#UH-t9I}$MqzWcYF0G zIoa$Rt4r3qglCoqTbbRSyJYycIET*?e%+vWS^f zaldR&762gqUBd|oiKJ$TX4}{Jz5gTkI zW~eo)e{El|wP6$k8pqt&YT+(zyOe9phtLQsZmBtN8SD$hrMVPG37UasU|?WyaIhH| z0HAif9UU7VA0Ou$oWgruNQAAs;8XyZeZnbgM@9pylgT1rbjeMB>>mUJT<3uaX+OJ* z?qrrNC_2qEqZ!o~5gTjlTzuaKqbPoE>%4+MWrB!VLae2aEuywFoT-5CDNU z!eE0i2rz(v4S&c&xJ4G(pMPV(?C<9oKJb3oeJ57VMe`GzASrPX9eW1|EfCwpBIZwUUW!9u{N+Uu{ z`q%p*ll2pwE-y^}eC!tg~ znW?hY3g;uQC=7%%V)3L+he`0LU#&YQsP9vjD)9)Cf6}(?=;$bpjipxHw?Klqmyo7n zrMV8(b#j(c=ecBE;E7=7lGO(4&z&x+7+X!!L|rF{D7`}ku_EH2KWaN1O2zgMvx-Pw z5^icw9HvB|Rdkw?8`x}^>mMb?pKo;pX~rQsfIGnY$GA8O(kZq;1>S>l#4 zoMgqUCO@H^hSW1`OLkrdP1MqAVuR#4&}|1?O;TQlmtxLzLH+h|Eto#A&AeKWw@*^3 z&~8fjUvUvZK7D3BZ4v{ooo=7*l7wvjvkX*@jg zF1CZ1O}|Pyyu*fZb{Ne|J$b;+Zw2RphXB()Aaeq+0Rb=xy0g!ijAs^n7J&738bIV= zz2cufj7dQnCtVOc^I{%={`8Rc4H+HXqta5MSy3ah3W(u>DTBIzx%K8Bq;I^*@X7=y z(hzcm)|{+5e_1V}m+7=}8R09TQiISE7v@DoW;t5`~#c)}usU9Gcu56nw~CB~yOYMOHy? zV$oH_*Yf(K{yiZFbT`&a}x>`_W$pCM`^ zKh3RC(fxvQ0MLj4HHc}8s)j^Uu(Sc}0So{l!T>PE$<6{mi(s3+{m45tR^g1hfNR7s zuU~vzni!@lkuZ$Tm2~;%q3>6E)xZ zkRU~FNYCI@IAh;GZ5@S?^iaeaPl%HECM!g|7dag^80R%h{$@ScI=6Z2KIGM*SiZ}V z2DyVqkbg`hj0uf$jj2vK(#?>2nu=6!K{4VZr#A~nz5@cd#LnkT?N_S*P3+#GD+R zllk5orS;S)dp6;-W@7j<%*cV4uz0!1+%lOdx%DT36GY5bWVLfvCm8Qb+BlOJe4*L% zr(?2MqCnsIC^{~XA2rgpFdb%vw6aYDKuy!gnj$s`NNI5q8}XCekS1G!n1A-FN>c`r z>1?_XnVM*rq=5z+#HML_4eR}Y14We1q*fY?Yl=SN<{1`+w%`?8p)#(-%S+->G<+r) z2N4Dkng$2d=<_BGY8$^|SWim78G^zG8AlkGFQ@fP)lf`J^0PJ8&+9!h4R&60L=*H?B=PCmq#+itE>$B@4xicWa|)Yqn_|Ortb8BauB3dfiw*W|e3*GAlGZQe~0 zIWaK7rx6(}1iL1cVXu?Q74s<##$>~?MjgMj(eEsssO)6gkTT5;m()Pgsg?iks3-xex;8j-nXYg9`8x(3;TW>EeJ{@xTzN-<-H? ze@Upwh7-UALO~oY%=1##RHn6ca-Eap&11ktFsCHjZejTiy@H68nn7qEtaU0#@>7?Y zgSwSMo*U`>r?}I$nxd~zz#zfAZm5wn3ZvrccZeu73y*AML~>5tdIjI zaQsKC6tYRN(IEL%86?1)0aEACg-|^>dq5;SK?j^@(nin%G(c@SM-Pqc_eM+~%_v+W z+Xu}p783b(s~BL#AeXD8Fa`T6tbhzZ?vA*?MQ{`mXX^2ykO4VqNh=#0LAaqqann<1Ylh|6mM1#g! z_e#<_*=l)0CW6Z7xQCimn(sG*FH9%;;st3or7jHmdZZ5W(;gfsxXlZI0S@xuB|ts_ zW$4OGjd%ckNLEDbFvl_*(jZ#dKa@V$9w_T$U>+)^euT31WHJa0uO(h2Hwq3+>D$Feaw1k+VDnJdTIB(PH+jC43 z3F@vxMqkpY366ha|7t=u~50xvA(F2F(&Oe==lQ*{4a{%#JhGW9ibrw1GG$4 z7Og)bRxrj9ny5u|z}&xqegv3x0^q<-bkfDsbB0W%P2tW-Uv7`M42rBvM&cE$iKs_V z%$-1}Lc3OPmsgZgN%*^I z@T^0}6|30%Sf!j)9aG-uL13dSVo$9(vcxX_!rYvnmoySbf>RLu}fLqB>@7 znkd)YQV58zhjp?(cqRn9+&>cLVF`fT?qc;-$@mJz7-p>~A2D7?@yd1`SFZStI!6U+ zMPphBfgU6XL~A2gEeD6bN1TU2O#9zH;_P6qA1*LyrMigkBQRyo*cWGr-OUU?GuqrJS5C(w~2KC@Y#M zezdM|Iy>U&$fOL5TSccOOx;JVs;OXXSNu1t&V?M^>H#=eQ5of+uk=CWBQ6hw?n(5) zwgL;9cvg@TBkUQH(Iq4}&Ml?I(qb(g>b8#1x&$7xa-;0~KS zh@N&ScM#!BO>5NV`!=~b+41g4jhkWfct!>i1=HNNw+>Q5A4uy!kRu1tt8jyZZtYRk zT&*K#bR?Of>asxH(&`QaoXUk5GpT&~0$KJt@H-2cXArl_70;}s z+eHxzrV-S5FN3spOcy~tPNclic)Cz(Hq{sU2vW$k(WBNyPuxZvqcuYWRCg1yvQo4* z#Buv@Fv`)m_eX>x<{1t(MB|VV7a|(25qb9ox?MhrUu-tIW<)AXvf;s*M(27JvO=*L z$zq#sx(!w6d%%fW=JFPwKCt6w+OjSz%L;ZZUF_#aXD8iiXwiD1mzm(WpU&-yp;2FT zpg@X=kW(vUqKPp1b;>?daW^WZ!7cqId!}k44rAQ}Ruej+yb&+0UZ0A3u1Qg9?Tu<) zh-$OI##O1Du1TcQs^?<;7bnG@{)6I_55r)lD>A(buXFtUM?u=eo_EMeOjY6 zrd*OI;XF*nQE`IdZ8nr^6Dn8k8-)`$P-bvroyTdZz(rAJs#G9Z#2DCSA8(ce;)MEZ z2XJIplsn;p@)iPgl>l%4WF{asO*7Ez4GatrP}@?=FKi*%L8J2>QcHq`uA)jqL~0;_ z2Kx;s#(z9_WHl<|Umxjln|?}sc6E?e(@B^eoA478!9^PY^CQiy$P<#0LPa;Kf}0U- zP)j*mB4%}`3At2FW(Uc+OzDojwgddWnMxA^H~mLkJf+-zkvxq0*)Jel7?%W|DCDIn zqWNat!9zpw3Cw{;K0{kN^6})Y|CgTvqfmB?x!Q}2lG14Qg+?=e?wlft&6-poUU%7* z&P>QrFWsegwR(#BCeX<~Nw*Z%ONSXoSPo2sh^Vs1I!FNS9XjGFn056t3pWs5eV@qf z0)>FG6vgsp&5PDB&NBRit}We@POS5_CKzbS!@eL?R=Uq@t#lzSc@>^#kUTeh;8ZUZ zA}{%JAkIT0uvO)P*ffKKgG0l^LqkJEG&VjqGCJC}ZGuPAZ7b5WX+vaA8aH&Wt934v zn@{BZsW_G0sh_?np_3VUJ)GlgcUI2(m6a@Hlcx$9F*6o}6e?C!Wk4bFVqYgdLZi1) zwNfOepf8hkj?S$kiziBR<@Qp9yiVepYE9)3=-SOOv}2_G1{ouz3WIcM?=dI_KoakzCy5Hq=t9Z^4K6b;nN}s!H!wa22?z*!Syl z*A_73=0v>B+f|=Ym#!5d%f=@GoaRp|H`7ipkg3_Z``B zcH?OSZcT!qY6E%_9n3A1zfqWY$s)2GwyI1Rqd+ZK_QHCj&ugaJ)#h5vqZi>QMNDqA zZMBx2&D6EH@h{UF|Hue2fx#pYDSS#i;UK@th_UE;B#&SHMAN#NuF$z)C>v;{p4#iw zI;bnh!HuR!f)sa%Xq9)pvqu7gZ!opHAK3FM+#PCSZrh} zL8xM ztwRW7g$Uq|h}6qC4XcZpj%IxvJQodSN;4;&2z?Qvk>jGGjX9LCRI2^g_&`|7r@UgR z9&*7T^;3i*d4~?5T6h%CGm8(nq0yd758W#)g{a&HWaC!`C>-USGrZ;vyzxTll7vXD zBY6Fcd!GvXWSC4F5k~8XsClADh%)J-56r67*M~`ROjK_N;I(A2bq5qKp@-*rQERgkwYwOaaT4_(a#SaN-)GT#l8=v-o*M@ z0BMBK#~3Q4POM*;M3IpY4S}pJ{wEs)k`n~PuYSXp%mD~^?aTvl00KaEx?|ajzNM_+ z$+-XDsh2(rC7ubgbRY_H%lF7xg=1+{fN}0{r8nY{h_qlPx)}aQrRp3+e%ng|GOF0u zbuEgoWYQdtZD+2csE>0zY^B9&vCygrm>mCCKQ&d>xVd916Pm)kLObkhWLhSSx%*m; zs=bn)xC|D=jJb7<#(;!jE;~Px%@LS!E$~}9uozHKdneIlzdwc`H|XN^K^U%BXC^;c z=YxTDWx8z#$%v;QZ}tUR!%LI%cDyATZO2*y(!=P<3*tDR9aD4jSwaG8L~==mjG+l6 zKudDVZ*fp|IQIm__=-pxJG&jbQccl1h5hpRzy&Ap{CR#v^m%qet69mH*LB;001BWNkl~=gWa*D8w+AeHEg3UJI)|p6uEso&&IQtOb>3b`*hof~k1ThB z6y08>&x%xV}STP-K`XC)IVwlO#KB zQUfhljad+fq|Qja@+M4;DCF^F@~MyHjG8n-!muIJRiuW`?Kw&%NGvvlQsDGSJkriQ+3=#1G(=f!~p0|bJE^me>$Tj#Q*Y;D>_ z;Eg^vrpB-ZOlnK9*_2I1)cF^+9!h^?*5r)N1n+>rFxEypsb>@oF<07uJC1U!%aH*+ zG85q;z+t*wSas#QWfKa^zJV@~+Iq0^R0AG8K@+s?H+@spHi#gi{vjEhL|IZqisd`11+FaJ?tzLIB47gug#1XumIb^b~@en^E|zWu~1>4%^|8gy`V$F z-J6WF)V*${4^%iaRI11jg3yd9Z$RQPAHH*Pv z%3hc`dCh-i;av`*U|$U;CIh*58eNea03AZ$0nIy=nfN=bgL2^>b0J7Z8^Z^iT5^O` zpf?hg`CbSBM9_fE6er{BX0Yh{gq1DRz6jQ2tu9x3vj>f^0>gr02lr8T>ecF;gvLl= zhY7sM-%*C#g<`0#NLhTsg(^$$FI`Lc3pI!n1UvI*xwp|Bto6rN_OVy=O(=&`tGB_VO0J2xQvjQ52mGmW@cVs9HC#8sg@kefHGIVq4vEnw=+S zYDIiP$f2mYJ30BvbhAX+dhu{r0~EH!X>v4C;4qNx!s$m{5?9M+O4cb|LBDjxHz13O zOGQwb(PY!JqM=wQG0#N+RC3&!W?m+8D;LP1P*G5Ms7M-+xpyJavc0ZCdEXRVnIeCQ z%_cTjtzY^gc$nsK+A%SEqEis4CRY^9#|Uh(yy`KPR5CXrNm(xl2#Lbb7rn@fu|wco zF)_*20uZv*l8BB%7?cKY(yA>5dx(vj!tz+@#$vZsMTsnz*<>snfBg$4@~qiy?oR4Y zba6esYT(RbsBp^*q`;ux{ciiN*zcB5F zn_Uk)m5`HNPZ80xN0<|3xs{`)Pvoi+fklUlN^UUxS(|=MD2lLKXQ<$3rGMQhZuJY@ z-ZXcV3)Wk22ERcwlIe&8sjywa+++J$C7hWT6rv(}WnuKSR^6v`kGDCyf^q36Poeex zE7s+$Oe&R21X(pXR;w% zRzk&YAOIl{>g(M!7x`_d{BH~a2=3TQh#Ooq@Fqu6ys+GcNLZI2DP~6reg8AIqzJ3K zTU97Q%@8+p>?Y<>Ox;>*mFs3ODj(G-DN`>A3h>54=g7Fm&DnLfFETceXK#Ru8Xi>~ zAilmKwHmhLMWd=714EmGgd`)*+=w$v6+Xlv<9%vj?Hk-R+B%>E4b1X|D$}f&nJMC_ zb0+7=)d=dF%GLs&)vYF#xmA_i1`OL-J^>AC?gNrVRn%%@l~hPYX3d#Bxw_vPeF&@4;)qV&yn(FLLbt{0sX+*iS$A7qO=#mPjMv-p)z{?FR3ZjN->k+4Zmb4 zZAx%aHkDFY<_cCqtE;__L4&0U3;DuF@Sa-xezTB89-kH-*z&t?Qe;R=-2ymlOo2{5O_ zOmIL%XLPbxn#QKPZ3%E$0CW)9l`=RM5kl1=AFDx^H~4}MG;BKT3^aENTQPUo$dtI@ zWq8H&dLN}+z4K7t?$y!noFmo23ez>@22k$=BSx9@LM|uFq3A;trvp?zq(EsTLkKJH zfTPzNQi}PFf}Gi&4;_0dNH)mHrV6lGu)IUY=+kMBscI%naVR{ryT52)nc-kR)mR)dl7()wqWWGE7ntH@gtSHPLo8f}g%IireBWr1Rsoreo8qV0!6ygChU zyBg3ofw7xxMj;2>qQ-PHaI&yhXz-E10xghTt%b?b=BWsFftlLuCLm-nOO{g=cw}P$ zx`|Lsdh}NTfS@&k<9fZeq5KY`(rvl=3Z}Q_#z(3YDqI_X(OG{_-nWAQZf1i4C8PsM zy<(5*#P`9cN{XItR1A?7Hz%gpA>z@(CJ)kt28ufvV9lv2>F_IE`L+-jGZVQ%7A2{Z zVTeou4#%(B(D6X?1VC_6%vSOytgp#12TppOLvAb`XD@=XahxGeM5C_(c~X`2 zqKgDj1P!Q;g?Vid8;1NfZ&oK3x8hEdPLy4rRGs%szHIGQ&5+gX5r(HVyQC%jko8S2 zsKEgZRGJVp)L|I?zrw^x&^3vcqMVh0?NbCI^#7maX!ac=e{VANQ5;S5%GTYc59Ffg zaAAkt=|<&^z^QIyW+y1%lLWL1&Sxw#8xY^!K&Gwr&U$M5jINqFluoZ#N_{meli_)G zvrp~rD*#m`b)_lyK#LaT%^`goUB7n=Mz_T%tZcv$O0qC$z`>$j(+-Uqx|(H85imfh zX0L%F=MbtLY^$qA9P5>uCYSoF9eSQn;SYrVc2(?AD5(Q2z)M}O*`$+z zB6@4$XYCP2$c8qq8v#_h7Ti(Wmzcl0rEauM<5gfOKFqhOk_wOR!xG_&^?Plyhs5WM zbj}y3ad#Y_q!KYXyzPnX6~|l(37TlKO?1Vuur=+lg<0DjSrQ+De%DKt-d4wxj>b@h zp^qCm#{axqPr*;7(%@F!M7HU6a!2+p-9B|}9l ziWy~HMb`CTMy?+4tb&xIQO&of)W`R{@zinHUSJa^IF8(;72{P$L zerb;1Qd3b+T}pPc=(aMj&r#N&TYsI+f%ZL&qLLMhfr^!dP#keuk2aDrnJ_rl#qaAe z2$8OYx)lx)u|aGA8;6AGNVRvV@=zf#BN31qCnhpiLsxxh&+$df4?&8>@=~U~?5Ha5yT7=utRQWG1F!Ey5oF=$S1Jslzg6 zVT4e%!;DVTEh7neKWfNImPwYkqlqBL9Ijd7AYfzUdDh91aHT`Zu2!|6Yc?xQf{Unz zrESE6Q8-tPSIeRo3L2gGR3N7q=opa^ca|c=7{$z+5J&A!*_EFgoZVi8US8Q&3NH@Z01%px^ZNrXA~$PG><~Ihm^LhlDt}U z#0*_d?|=)H4y}svy)?7oBB-bvGh*kFrT9yA*?S(4-Hc^(qoDdrl;!D21hUVDxYJdk z?}Lk=o`)T=AutOOw7ma-u_qjm1H%jM-C*d|1h#v^CI99rc-zd21D(+L&h#v67|M-Rg2#nJW_k@2&Tc zIA}$^DUJpa(z<8B`=$n0aanKQ4XC+E>L*;XhD+4B+&|~F%YAn zz#4@_o*2p>na)RwGZG5(rv+q*GY|Jw^w9%RP~0>2&DXOX4fcQS2~cT3j6}-?6pX}BzXuRy#=PWzo2JLLgaz9tCl`FTVd2f zoK1%{lf?`{!ALc_%>-nVo!?eKjW0yBN;7qG(9Qtr=ej# z?q~9srTiv2CRbDcsHtdgJ}5i_-t0O|0^U);ixhIR#EL#0sga_kGPnchshevb>W&s8 z$^d~x%JT-zUpMpa)Yc~YW@IzMLMxR;G?lby*o{cr+~XWIA*=s}8_%f8Ck29Vp1u+T z;{(Z=XOvmB^fRBK%U^Vo8OPLuSTT83^l>n#N-0|FKlh){Tdq;nGIB4iBAh_k{a5;|2X1*NiDjcVE5P!x&7r%Z{yfdvu|vvsctlVn5p zlkDGYwystt(W?m5U4LN*0mSP9AdO)l6s}*^1v3@sMMNWw@qH1zZ=)KHvTmDru!MVD zWc@>I0Em#>d=V;j`OelIFv-pvtNq?dH*R@{J9z7Zhh}oMOdWZJfwkSaf+VG5m9IFi zPpSxG7slrIx;tK}rypVYGj?O*k{CFIR`afp%lCA6-`FWRf`rl}NR{f+jTQZ=7GJ1_ z^v)HmSr}KN9aPdS8=xULk`6{xR6)|+x$Yt58FR{#_H`m+Or1nv3)b{a6Rc2`71iZCBMIG;O1vc?cMoWsxzITC4ah6B zPQ!B&DsDkWPx_y3t&||DRG4p{_msM5l2b};fwU!#(JCgeXXJ4aec_y15?NufqDZ}DPB$0$7Mg0*^?h; zf#v6VY1u?Ac84h3*9gH`m=5&{et@nc#?v^yt%-Wjb>J>P%UD{6*gc;`#Y%LQSt{U$ z(7_M)%6`(WNEj$pootAes1f67Mj;5Q-Rwx+IV-%?KLWL8Bv?ab1|YkaWZ$-RHWlFm zJnRHwR5V)~<;*6!?igK#c8;Yo_{k~@LYkVG^$}XER~dL)^4_9(tnv*6$zfP4j~#G3 zZN{d-romnhdX0PU@4Zq)@+;iq5fG@_u~5}0)y%T^{KHDw+hT%ELO7PtFU z4oam?1AuPl&djceO{&_7zu)>#86v6*Mvt54rY^8bVL>}b1#x0@(8J49LiJe;y-fPz zk@zML*|ESwkaH82Gqnf2wFJ{1RAH&;igJ|@8aYDL0)=n4Yu`~`e6)mo55kPbMo zs1VrsC~sO}LxNGpzsxdvl+Bn-;uw&MBAfAybZ;Ih+D)Yd%r?jklFC6Z`gYIky^>u_ z)yiJPsmx_@z_%?FBEf5n7qZycqXQs+;hri0NyjOmW?B12Rt-q*1nk~bBXnL zYBk1|!d3>%EUFDoXaax$8#&H|LZ-1Vn@Sdmfm8o-A=x)$u&82>HZKHd01=_F5`kry zH6(Y%RONhA!%AvA1!aToO63SVUZ~?o1cXS`5FkO@(f|<` zW0#pBGCk>VV#Fb^JR&Rl@jC$L$WCU)PPKW8o?G&v6;(=+ezuiJkoMz!juD&VJDlasqj^^EH^-$X4(e?iI~ zu@u;3FJi%;nG}v4U{U{mquNZ>Tj5wH$hHat;LZrDjgRiFWbH;oVS;=@fJkp9#4+_z z8yWhFT4-S$V5|iq8V6{J+W0YI?pWRTG?LUXVwtUvmyuOv-br!Vr!>3> z6PpPc4+7``wEzu5`U)0_5R7e#f*e&m~*l^j{?N)`cY79jpJ6 zD-V8(rs``1$QR)~+2JIFm1IhkOwVcZS=EMyS~}*6Zhj(Ly2u6B0%zQoBlGnNTTi|S zfH|tMKNM&KR1c92R%9!9u~S}v-;cmeqM8pewtDR<)QN?sA?lyWSz1n1#EadN#Tbdd zG@zzB)Ss8iSt7V-Tbs=aw!||l8?pr&YYq5SPXxggJyMZ`O{1Iq zIXX=5fw4{6i3ymt(+~n+BN{|0=Gp)uLc=;_3ri}eI_%s9I|XFPv(IB8gT3`x!9~nI zFDycB|P#j03eor3L|gtjlxOo2_W3EexF_WwZ+R%c_!aK{SHS zb_kj|wm92e8o=z0Hf<}emTrCuZiufnwnEj1j!pnI`8+%&&*X=m3zZXYzPfBTAA#=J z8h3VzS*}I5DGTz2pDA$KxIsvYt$h(vg?fjtq%7CitJqJ^3UGeEAYY0e z5&|^<>=4hb15w@U5POJj(Uy3 zJe#xiQBK7~noz2ABk2pd%+Gl65H*|KBzsm>&*c1X>R27Dq+#huR2U3eu zQOJTAyC>mOZifvtv@JU_O_J?oPQ zz@nS2o(i*Ri4u_6b^V+4N@fyaE#KQeXh2ucJC>j}nc5u*)Vj$|F{|A9aT;-sMrYRgPFkZtl_OCqXHaTMiv7?MnB3XY@KdTm=v{ z16&cP3S-fE5V0043`_ZaX$0Em)( zcTnL$E*!84$!I6_hwSu*MR>T!q(5!5aVpqgA_K)K3xH?Mu{7oe%tGscfb5Z`jQ|`2 z$^4T*I${Ibya6Idkx*jqg1815Ex!s50TY+7A)tX4!-{6+FHm;HBu!v#>XHTh?gg|_ zek1t(!`w3xjp}H$PMo+9QiX5E(?ogyonje{eVfw!@*}q$l0|B-sV2#b5>fY+c(xRj z7LA5GwK40|XxYt!9nUqy3t9YB?S<=GPEUC=dr)X*001BWNklTJfy%@l_zgpaZv(!i5&ue6F1r9RH4N0Nrn#5siWBrBJ!AGe^895UmMb!8FhI#xq!3A zSs#6mWbBA3;zdzvnQR44HC^kLrn?yeSmB^-E?v;$or%tqSx^ zB+7e<>7C%ZR*-gWaBs)fhrn@tUL0od*h!p7pA9>0h!kdX27{@YIwB;W)UPw5AF(d~BS61V>@H+mE>!uV#SL#e z4zyVXVE2B7h)b z7u~x>e(&_LU|h_{~M zt+cPABKx|1WSdPXn!%kv?yy9eCq>8mLVe}bI3&5tNf{0LvOFj?p4yEJ1l(5 zKD!MK^v=8O&I^{_Ri)5Q@u=9LGs*>=p)2k;MMYO6W_KdkWp-kKu9CXul3H(n|3Vcd zW}7TPmPWgjYqpLq(wgC7SxZG1N&XmwtE=tGp)9Ddt@7-1dmb4R5sWZsL&MI8%Qj}X zB^?okj9!b&V(d(MsazSC_J>E~&uT(ZGt?_eU#AkYk&lAe+`biSL5if;oYX>(t;;4K~Y5kSNIfhO&C#Ksw7O0_hqHDSzbYi-t$yf?xPnz4dE z?Mcuej5ldF5Wj9Ib+7?y+sbOT-|;T(dQ=Zj$|Q))Ca+w9s~7Qhlk$;NjgAQAdkz5S zyk+y3Zacl&!t?8BhtK~(a5Pea?*G9C@V_&Mo0DEValAdTKCQ0 zuKNAcqZ)_@Cw~g2Fap3y`|UBM*8_mvHs6Fnk?ovT!=@%(%Q7Uos&jeZQv5&f za+w5dI%n2b-|$KRxc-4hzWmGU0_Ch}@ZGn(cINQVGppCU=ld7+>ul(pl7yApfgQOo zh$XA)O(>zR`rwX$lVkp4Cd_LAul`DAKM4yF)Ic}aNb=4gJ+gx-z-E3_5=sO!u_$AU z*`}gs(RIJC%mr=2g3Ku4v*LUb64b#DJaWKjsg*nOw(uA|EvV{BBvRLSg>zQlqj;sC zu`U2T83B1WCSk)M_Oi#IfnmlejjNirR+dOU(I<*(!2=SYr?eI(wS_rSimZ8><&PL< z>zu>gdTfxwTvLcaH^3NbQl#?HF20{fg#>sAfcNFf$EblI?NZjvJl|BjgtC9N-wNc8 zHUy-Ez1SjR+qSYLLI0f~O%%Kfj#D9F@t~0pYL(_xqR6f?8*&L5)Pnj>PPd&u+(qag zo?7P{bMgS%OY=S4vt2hCI`jAqH=Hq`g*Tbmd;KoGBNt77-Pw;XSvI0s<4iI4EV6aW z1Gk#;rB`pT zIYm6x-o3*aF%5qUadOhlS|=oawpY!c`Cwg^l|ari`Y#w~@l=`i89uoVg#JZctJ)5= z8F4rZIq+cROh0cG!q5Z-M0XZBhxicY1Mvcte%a63L5O*s0{0fx;mtq5+%pp_;owTb z2{gqDc8Pv1@tPu0Y{4cX2^|Ad#U$~BiyR1Ly)Q^(lP}eyV~{kQq+AfjoEo##sp=-S zp(<*}h7yF3A8VC5F&WNusI#nQmi!Er2;@s=ss2Xdv4Gf!mSKNum%~SfCr*(F0b1nP zb?YfKLl-LUD~l5)_0Ysdc-gnz8f8CXm^V5gz&6VXv>!w%ciIgrnkd|dZa4jaZKeUh zT~Dl&`USJV*Wi0-!I+uDO+v(Rg41t$_Luj)&};DIy=NY>aO#vEeEel|PB`aD0FV$u zFujO1?g9b8zrAvU6L*^d0Bgr!^+-E!S_1(0FCSBXODXubSIjSUjra$74!dSut3 z>PhA>8dLm|0s*0%T_ZQ;3T5&-T%gd_a{MGZ>S~_Krzk^DX(PATauDU{XU`_EbrejR z%g&<`bIY2dwC$E~L{WkZK>!0OE4oqUE@j>gah#B&fj-Jc9(ToXA{o!>(hakaH2*)agccSRx=o<3711tt#6ma%J+IhKvo# zIYok2QBheYOFTsJ83Mq<8JnHF^%2WQpa1ebKUxoTEP;*hyCaqLV)_?BR$GM@Z|0?k z+5*wHf4hR40O&RFg`+l3hop5QRCyutgxzMOIpP zc+;}ckNkY)dB@KKfG3_$IXgzeBKiG7#-!l`{|#U%=9PBtB4W|l$AOs%UN=J zTZPrDp!oQz=iFq}Ud*=HYzK-R5qKis)Be^nNqw6wT zW!`6~#w9ol9%N+}$Tv|Vp+2L&utqE)kq?=<)kVb?9+pHChVd|>(n#ouY&}PBN|rG| z8{-*nikr!hq<0HwkJU_i0Exa;@-DRdwUZ*w|M$oI0~1-Zb1%sIc=x_sG__ua7Mv3noVJkw^+dd&ylMs0h= zX+L`LQHRc&Klkz9KXCoI7w>x5LEF4|@wzo@u0QvZ<&XWzdW>;Y$njopBkpqO0Xx2Q ze*n1le=b~h&wc6stPSTM@&2~~z(cp+b;E_1YO&t%@WQK4rcT}Y;Qcn=Vd2oUDbGE#;?^s!n=yCRKCgZ$0Q~l%s~-Eq z!)jy)hlY0Ack$-iZ#8xL)YZ>Ef6q;KK6LK`um8Y_0PxuTk6!!JtNdVWxcNp47w<5C z(*?s*r;Lw|Er0TvKi+!R#y(m{^4fu*H7OG&Tp7p z@{UvgV&zi=fWsHf_}*K#0Dv!C{`5C~vs}G2MELBh=D&UK*#Phl7e968O)I1nlRal@ zbJ_`;?Z5T3(J}heWlx@Q!^$iQ&KEX)2Qz$5llItbC|!L2w$*xb-58CHw*UiAK0gkS zJ1%U2%F{YxiWhFsTeX({kN9Rc8j7hJk%!}+h= zal1`s&saA$e#3*0o_*tzH4LQyL?`XH*Q@yYH#xm;CPDTOV1*IS>KpJqPZ4==R$H zz`M@*@kh{KNe}y7i8*Nbc`on1XzzSUH?b4s!;u;b6JnFE8d+(;jn}Oktw%KB% zZMIl?`L*|4dvoH&ta-BmVD-vp_d4=rGw0127#!Su=k50yAKz#jt@FUEPyb)H+bfWn{P9J=<#Pq-}U`vw?6uU zk|Uz6)m9ym;U=?Ye)`fYHS;EOxWZ*CR;kMCs^PMg&nJpD zos+klldSF^i!dpYS&I^`^(EJTt7 zLVz*BV1Y5g28_WtV4G*0^TRv``0Qunj13rUgP#EhvN2hJK?qPpNJv6icPCxG-AjAB zJN^C9sd{Gi?(loxKVP$)c4vC3tE;Okb#+f^$wf=%Cp_<-*EY+hNx+NIbtj*A>a3{- zPFYdW;tAsxPZ;-y*ET)&=G!J}+E`fupl@jC{6%xmUoclzt|^UOw0K^^^X_?lGxtVp z7||5XHZt-hY3oi3(|aFEr7`(OFnq!}h6_dF)tG7##)wn7bMQz2@P)?JI_M+>e7&rs z_5!LW39uO&7CD_$YQ00iAWrPNU|s_lg4z%?>=yJVg$gY=Y9%Z(Ob{=0-9E#8H8=}e z7Odw6XTbpXn0t6%uxpJIu` z*Cq=^Gd`sd3t}g+#RAjOF__ zZyV|xfIvlEHGs03suym3AQq3G{U6sTn791mq>ImIFparG%0A?bAW6+er=q?Vfbjjk zj&9TYiZMzlrdvAg(4VECoRbUxqh)D?;sv zqq?YUR>edB|M}MMn+7|~@XK=Pq}A8YTr<0T;`es^DS~Az9LWFyi9eztC;&9~WV;6P zH6^jx^+ilmE9%dRU%uG6zcU+z>SWHDrkF-y z=smQp_o9Vm0B$+A?i>H?>>BV-o1Xl^IduRwHD`XiK4n87#vG3Bn%`@T1}X7lQ}!VfK5EH&a#KL5snrqp0&e&g6lHI)FaIDYYqyZ5Ct8A%}- zvn}#sE2d5U!}?7fef=lTm~z6Di2%+zX4ZWhw&wK9O7$p22s%BG%#;kOHDi21k(5~{ zn%4?sDlsof%Y6n$FVK>9^R(vEc9Bj%6>4=+>tLbtOt=!z_!5{42W2hW-mt0!Xe-gO zm9?Y{Jpv6_!tmgJkZD~rz$x5gi$E-@niU5@4JyF3RwT9&>bk%_=`ap%UP0V~;|kO? zZhNDKxuT&CK_dmvCgrUpRg;g-J6o@7~xg1PN&2$9QXIZWlo*od5wYhYXV zRJu}mZ8d=2u5O=Ao60f9Q|ypW#S=y2W=#Xoy6@1Ye>`VqL8`5zc6=iU>CR3`ijvB* z@w2A`7)bR#b;o^~z5x(*9Bw`Cyww2ud(wU`FJqZymF44SOad^_+yCsJ|Iy#u4`BQH zl5;4C(j)s zK)_cg1^T{|f*_4bQhrR%&%4740Do_KY1Nno=ZrhPKR@{6U4O;9E1V&039^e2+nWbh z&M2GJQ0&Qr%za80$7JBNvp;|D>)nBnZb`zMT3ZC5G(q1#Z|sfdjQz=TZNGT2gSVpW zMq=|d0zCro+@68YKidA;l~t$BC|UQJ3G!Y`I`^w}y+3)WE1TDPnoQ!=u#-pde+a;g z+JwBcrz7juvy_lt$&A{#tvR~+sr>-bhA0UjoA-aU_7!=1#q=psDK@3jr0ql1CShEK znv%CX`_kU_P6+Yp{zDbX;#D)I0+?7`DV1U(<~3B7L9Pz64o)!cV|Pjl>NgHFy>Xxk zz`Vu=sT4OIYWeNI-r#Mi)s~eU zP4xk&Dk*;7g4qC4gPCtW`t*@h8bHjW@1A$&tophbd9xeFY&g^epsXlSl~l>e-~H#> zrk)gl*A6!Q_R=*~CB?<@SZ!HpYq~d@kUA4kTV}#Bp|JV57htHJ`lkhy3p!}7G{ z1R)U6q}+c3q|_4bB{`=_u*2X&W>Q2X*XVJk%>k{DiB;oYc#fqBTv;1Ix1+hA=`~FN zvzi)slMnGZ6Q#3c^O5tJ4^BY2It0{xh=dJ8CAWfw!-8TwP8`Q*iUA{(ri1 z!F0a_km(ypclXpZ)B#9!rX|qvQzpdXF#zvuemkGb8#&mgliKq_2#+8<5=7)7Pvi;Y zWyfV=s?VkaI)~Ex`i@L18~2_0ANl?Mr+f3-p3vp)15e#pcI8DAPU+8QZrk&yz8s-s zf+bofh6>@WBZDhvlqC~1sV07)D+|yiORDP1VgT+~*VR81Wa6oHiL4J2A`vG5MKOHs z%=)&z{Cyj`Bif2EN_F^=1O&xns7iYM8K;#a>HN;t%wU#ZbdA&z2w-nd*Qze)De~DX z020%6_;hbqUbz5{7-iGd2<|{@6x=2-FUEB zcCc?~=xDlkYHc-u!E9DOwRF;ixEBNP__m!#deTyE=Y6rQ<;bl1Isl$WGBIepUeVan ze6+bIEroL4_qzrLs!ECh4CZoNT`{q&4S8+N>ycrynuQK65!E5v1QJjOHEN$uhIF0e zBd$&KbrR;Hy-hkNQ7`>~bV>`shkVsIkurFRAP=LpsW^fgAYpIG;$&+OIV_GS$Bqy@ zR@}4_XwLZ}90(j63O!;Qib6H;#Xio)jpw?!L&!`>24@tq%mwF`xC7fty(q8(AR)u2 z>DEpNR5XkMkk4lOyHg;NYk29lPFcNX;yC$b>A9ybIp;J3CYI3aYVDmeWFX_5>9$S? z1wWt7_IIZt)Vg50y;Es&Ato(6rg6^n$POOedr+32b#|rNI*;zz-}26WZe`R>8ZW=Jn_K`OS*~2$bh~zdgs7X) zATPEZKB`Fv0L3Lq0NG47(?2L_Tr*BBd@eop_$8~3vs8*}Dw(AtBJzET#e^>)d?9p( ziEk#qYUU@q{(9?@PcN>XaqE&9k%W@v%E|9}t#jwbuHA|>FpTMn3FvuauPNKvc@+RYzP#rC z4X$YB=>Y{8zpTi+?}~B9PAE=g#7)n1{cGP~c@cefMb#OzN|vsvuPKe)`C3Zn9vX$i zdKc^y!jne&e_0=gdh!J(pkxEgs4+EjP}0?OK(=h`VYi#CN?_vJ6wvOJJZae8((8`9 z+S)n5+ET@$t*JhF-DJcxr&0zZ(kqCaef^nijxhwlmmB$h42zwLodVd_a+LR|GO4sz z&tOKvn^CXk=8hw+TIT?SiX!C{wx#7hNYSV*fOpzh*g&Wr4d!yG!Hh94+>s1yv5T;z zp(@T+Np`ovx`X0p(;Pl=9;dO|3})IM|cR`3eVS|66b# zVQNj>)YO;Fjw5%PQy7fgxg_9@kM!8mnW1zhW9tY3A(-Au^PWwp*3M;5kAM)uH%pJr zdP5-r@mOq3c`59M3g!W4iI6E!}EySh33Cs=)- zmX+_CtsN@zdMKOrBWXSYK9MSy5LvcIFf>7OS5!Va|%< zwy#|$>q&eDd;7DQj2t%sVH!$xbjeq5LU^T>6#(+Ne10eknW8O3{e-b{sM1|ltVs3Q z*OPwy?uVf5!N7n3${g}_a-8ft{FtB|a`M0($J2i+b@2L4zX|}6Wq#GvTNi&SPTp6x z-MOc)MbT9RYUv?*mqwOEc6aMwHYXBsn%$5DaNQ|&0Q$4yj+b?Eld+%OmI>(1`2CrD zQE6--t9QHed7x@Xn}!uh?*j`f0BmW=tlMwn#)DaLG@Y+4jn$NR$pi*-3@EeIoldyj zH;JN?s$)el0NB%>g%yPnWm1){*{Le5&j0`*07*naRFQKi$^8Mjsn!v%!mYtkA_Amx zYH_yDtH+t%O0(4(OjQ2gKqjk>@)=vHmLB^u8PnA{4P$IfHDt_7{gn5`(Nu4gO<`49 zQ&-AhZ<1H_c79=M_6%mynIR5AD$CCPfkC<2LNuYuCjJ1>F;$ig6i|njR_cmgu`>e@ z^joa{b3$~mQq|Rhfl!{Y$fP`y&Za$t4s;e#rP(8L@R!EeTB#Mgx47dyXRk}i2AqfE?{k&K_Rz0?^`)CJ% zSUf&|#S&FhD@F3Cq`VZs&`@x7s!-8^83K{#c|v&bJOK#xmaY-X{K_dxBffd(#_rvS zGJW1{393$kTpqjHGV>dgGsYAhKe=S-#1a7atncdTw_DvOR>rS6sT#mrM>2ognl?bD zk147yjRAPGIRivkhD74rV=Cs3O|IKNu0Yr6+A@Vl-v5hUpP%N=pEw2c45(CsbEfBqg4mdaX`r zVgYf)YGRD9(Xn5>?mkR$&K)yyR$4P*8SH#__a>Pl0{Ngpb5fmpLgq9~WAO;3tAyDT zGV=(#k}NNI{k+T}=cn5Ow$8EDR^- z+rKN?;=|$-geo;(Uq_dp&r{4RtE~l)Zf%3!6xiF@<>zt|AxW2tF*S+eqU@j)G@^0N zj4@Lt0NB6r&2)PQU>!<7?-O}twJNj5-0JP@_Va!un(l71zQQklNtf! zvbn+jej>$_J?&j}jr9OlUvl=r9eaHtCd`;*(Bqz>;Rk?!>3rnAR>?4)Yh-l@Mlu!rs6$m{*#%O(^j09w<1*{nHZ)=4#r6n#N8h0t#q<#9cVpc^7sAElq76LWMoafG532*37$Oy5Be&bABVJ6b@lUR3NtPQT2K3IXF>8u{fssJmcJmS^u8 z8?Nv1a0!~}Il-t73cN{!CX3C^^QPJvaKfL$#&G~G$e(L0@ z%NCO7bu}H?_Vikr=3rq8l-E@om_mT9Sw?i-L63rVU-yyL##z$XS`Q;(TW9(A>LY+JWQ zjfQ11sYX3zb9yoLVl2p=i}K(bhg4u(zoBdQ2iDy*m>;qR-iU=;Uk=kcbBR?X5Vp4r z0w^t_RWr)~+_#~-HJ!Ej-GtpoGe^?7aTW3LRq>}jJ>~Ij>39rhA5$^8CIMjM;laOc zNd-q4R8j1GGhE?%pi}BGM$AQOpr*7$y0F~K6fFCu zxu-|lU}8s0+rkOs;$G~Q3(k7uKvQ1$i^exf5BK6{} z^{awPRns zG1_AEvZnWl#n_u_3?(5+fQW4P)Cma`C>0I$P+2xAwh5qDI(#ZC)he*fk3GHm+AHG4 zMKu$~Et_z*x!%72(98G!&1{%f54Lvz!eqzv%J8Y1&iXD2Vb}W2)0QqwmY2qhil!Yq z-`qL+&b~LFdCC0j>*_hUb^GK+^Ww#crSCf<0OrkSUg~T*q9+6Ger?PA)h7XHoHey^ z)>HtmJ^b|Sla^MG9RpzLdr#?mAl28?OTeKWdt>p$+!Gg-*H&cuGEI9AZhK|($rmX2 zz1?zwL=e%I7vDJb182sI;x!Gm%T7PhQmMK18#;O&MXmdLp6`P^53!iY=goO< zg~oC)KLkWsKL4j>TT2E&WinQojAirq)r%d_U6vK{0$+RN=$#)LANOcVP2$t1)S72E z9v-~vPfhuVzKil=PbV)UJ?L*~(y!4F0z~~;@t^E*d$`Hv**tVNAc#29W!U_7y!Fk+vSyURh6>ZtNRb0JY(w0=~GPQ zzRb{1pL;2r&l@?^(v$kZlh0p%!qO?VH3Qk~)~1$wU)%hZGfxGO$>lry1~iEzE@B{? zdwt*G6Q)f9uvll6_Y7pRdIzw{syZe?W*Xr=BT_Saqv|gta5KV#bX<%Cmr>D73Rt=Cn_dGyea-K2qKAW^0Xu;8^ zWN)!;7~pZtf)h`;I*%*V(FX&KmntD}JyF1>)!3S_2=9-oT+sctsIn^|6NNW4+KvoU zcqU1Nm-N3Yaqi1ApEkNf#;YT(6bIA2*}*}8*@ZIpiYcV7f1x$$*rnm}+a+K9aL}6w=funUqUV?=_SJ z^Rj)JXYag!-s%&_&6u1lE6ojMyN|T(+w|6fE!!XfkIV})*8lDCqx%j_U$&&8wz{aa zBsY}n?@4twHSb=xv8(y09%K-({e@RSn6`95vaB@S*|l@s#{FA&^rh0roqJkEZ4C&i z&Tf!eFxbC+*Z%Fh&8(n!tXc+&d(yd_dbNUp=s42$^q(J_cfz8EN#lx3lbQa(o{pY< zZ|y$(&Ozaahrn36#`Gjm44#e#c?9HvJoLF%PK1QGLFvR|3_+a|WHg=~!k;q}M(C&L zts^$iiBAMQF4 zfFr5gUF*9qU0T_a%6;qcw*DcXneqa_UpA-qbq;-UdChT?ifc-|{w#L44L$yL@4Xw+ z!6UiVchQp0-StN5(naMh>HN2z?CcwI5`1RWB|@k;<(&?xL}^yd2rKmObPNf>4<2#; zHH75HuozWWs5Ez{B+Lmqcc#6!|CXm-xaOo~)5g?fa`{b%n(p7QwJqIiM7Nxt+nSDi z{lO=ocep1!Z(>a)fWuw($XO#3gb=@c{*|jT%TAa&sY36jZ|d$bYgR0wrpFwvLZo&# zw)ggBb9P~MUq|QH9(>}Wr3)8~A6uDBW^%cMUES;U9(a2DuB>mz$c9OK(wth26%uB@ zhN+ML)hGuIK7xBoNr@nf1-t_5uo)lGZsE`|I{SeR%tEAdSFu-cAOB@ATPSinhYc=rKW$+kJfIQrgvuQvA z;BS94myA;ew$Nkssxv0S^p#`Iw!6Shw<~bqP=uVb1EuAnHXWq>GVe6jOGhh4+9oE! z$G#K8zGJ|^F})>Ig*BlEC45j}s4Zaw29_S?yHbjz;}qm6xa7&Oxlp3g*WD5NP=9rk zx8~aE!CTJ8TivduCJtFGv-#~!YhU9uvaJ*%1##N4A_NJa zgfE1EpQn6I_<51f!_TSy+SI$yoaX=oO0iILW+0gzXiuadqjX{HMRh~)uE~o6VfM1x zK=m%5!y>2?vFOMWlEb}VqKgkU96JM+({%P*aJwWd1uR&%6*hIlQ6@XPg=r^HM@d41 zPoVd~obwA8&;Ri8ivisH)Y^@QnvKYHnm3C?!3;q@wR(6X-Sn<-EWmf<6wrDuPDE4xool51+Bntd}N2vdodC zmQk5(aga9ejFa_jQ|=;$R8JRLzLCPgSFUw2OA5#k`vqXZ#Iek|rCJ(K{R zCwE#2DcV$Gq+mNDz_4(*$7WHQmRYx*x1VUsSrO7IAN|*7&*~d$D1abK8d1Q64!bMV zU#mC)VP>7Nzu3R_L?5P8?7ReEJt5Xdy=%r<-qB!;E+oC?Ca-ve7$mi67~7U2#1`wL zrh)7mIVZ01YJj^WTu=o@-XXm?6MAN_S#B*TIYbmp)zVjm5yYWpl(EUQ(J{(OcQciOMhHcXVDDydQ zkz3%lsbeoHLKqTfQ$r{DSTk7!kC|3)N2vi_*K> zk^#fa!_9CdDjB9xtQIuAVS8kF*dQDEloFx#wov@&2{R6?4Oi@F!^qmT0>V96*a2bC z&?oj<$I)<_HsgqjN|MK&b#ee!HZ%0{BhUAz`$MgSiwOP-O?3!6mWsZvJ2Q+z4fRff z8vNXF;+6J``e?h}yiJ=!%hv__}@=1@7RQ z*}>lDSpbh{WjlgZW95f1VHjEDAvJklwDtCe7A=E#RF{@qrr%;=N?!QCUi)fmdboWK zLij@X!n~?QFK=TwqU&daTuo{`M#Fb(yj+29L>reOOu+~?PdGFR8Ba#d=-6gZBIz%} z{O`(gaxin$8qR8I4AgB2%57zNuMC=fo{H5@`Wv&X|vU$g-bJcnTRfc56&v5?Jh` zLAy_=nV=rgEJ(8t^W$mjBXsos{ohj(t=KG-)fDiNSb6zqumL&YzJfI3}2 z1ckj68%+E}^|p|H7##})3>RySS%SHg57>7UBs28Lj$j@X!Y5M43$3TESYr*k2^4&; zMUcQ4nNjF)PtneJqc0i9M)$@LFpB&(<$(v6lu~T%?N!I$8+9eL{AP$uthT8`0wOh# z+17mIq0QU(cN9!&Q!>r>{ajAIme$WRH<4B2CMnA*(lza`kvJ<5uF&0Pq>#19sU>H* zHou~`6%d0z8XTgE2&z7glo1k2J?M0Zh)G%qIE*edNvzf^j80*8F}MF}IEaBf>#PYO z$PbXtSQvbIL?F$id7)8qgV5ZWGW-#cM`SB=|Ii6Sy28W(8X*9~h`S{qw;;!e=ADKB zR}BZ0OA(5yD?)YUfOr68Al;Fa&`L#rv3{`}Ha4+cr$7>rSh}%{`^yEz7!iA2C&S53 z5wkKchhGTx_7#qQz>@V;cRWwF1&_B&AQGO9cH zJ^Fd_bHW$!<(eWOUunvfq9$&^3B~V6xI}Q|KyXDi@C9aA?Ip_+!iY{X>J!0Q!RGa( z;WN@s6c~FlN?lRJH#m$>Yy`qHg3%->XSu$KqzT7LBVcq!p^2+mryw<;W>#>Zgw})B zjU(r&;j|HlWxQ@4x>C~JP8|IlS#wxK0CNEwa0N-k$Jt7q@Y<^p6!yY!eX{U5O#(w> zZh3lz%AO;|k>#vSYRQloJR+fvEP^M6n*hNh@-*leC`KU9DS~B5D-H6KC-0T{ydSdRiQdgl&xVH zPtoY4Aeqf2cO^g-0XQC=vFrj2N%kJ=p-^JbxX`vltto0a4rCV<#$lGWLJeYE7%W_A z!+$V`!-$^<3%1}~NArM&3dS#_U_=Y1u0cKEY|g~@-UQ|`bLEW zrgT882)FlIRt7$SUInP(22w(h%~G-A&&VQCW$)e=fG}BU!q%~!j|LP*VT8NG7~bYK zS3%Jb8A0WYp}>t0jhIHY6&&7*V8G!!9WWH_8PEk-Sq)LhIumXkji#eqLmnP6iy)Aj z7txvEbpu2M+y-^1po7w|ZUrAJGxb~s*ZBiF1ZILwdLoa4x5)V_EZ5kv3y4Z*9EAHX zuVI9PURjI|5-^?WbQw+-CfQIOn2)6PyE`I?xKdQL?ZTP@!l)zpTnMshX6B0znDgEQ z;1gm{IjA06nDK%nh#pzetgP0PAUwb$5eLOdby2qH8?*=}lUqilP3*~;gTXQ4bOi5u z6jr8AAZq7WnNBoSH)XcZaM_9|32U<(LNNj|&?B^$5}+j99I*ed$}nLH6MKxHq*e_D z9@lh@oCC59D+?GT(>z&yG)!FyTZ|xUMqB<3AR~#O(Zq%Ry&^(if=xTqWdve^1^EKH zV|2Lu-;97NA+vQ*kix+@3hW3Fg2CNDWl`W!CX0=ja&8l-kU2O^F-kGoF0)N4`-R?R zBShv|!=3*oR}`9h1(}}ghbUAbstt~(wjzf^DTHFdI|UyX0?wME0CRAexij)nKZT52 zb~A$Xy0cvKX&ot-KumU!!Oxm|x+d8GnnP)|4bioswMEIVk#rFRfz-jd%#3sW;|OA! zv`@eZeMhVL(HDlOV2~LOWUOB$MV~^SEWG{t-Bh0Q-7M*qUb+UXQ zB7&es6LQckMogPBo)iJZT%jy@{eZO@tZOfE(wgsqVJ}oni;@M&I#e9p=qGiC#qhJo z-f;H51VD*!^>Y@3+@hH*BDjUd0aRF-89b~Drw31Pcf&PS zMl43}>u8;JMnkLAO5O;a)Txa-7ODxYC2+(P1kQ9aH-NA4*k^Sh79h5`7?g3E5N4+w z10&!Ad4P0Yi4XV?BAi351+BR;Jn_gSoqJjEP6Jvr4?8{VJQtRT;Uj;b&N>f^bPgiA z0|DBo0Vfh89ta)|`&&Q}?YY8sL@sn3!Ju|zst$kv8FQS>f2Ia|8wtnKC3~T@X)-K8 zdKE>$`J(WPG9by#Xb=iuWTIqb_rrSH(H0P9o|&6Yd|^0!sFtM)7P>@8NwEZG>{Pb^ta+m(7Fot9PFx@L)1!s@a@SZH?U{g^dqz?XpqcEA7(?=Ti82YOJs+sQ=E7xxzeOfTGy zgqjac;*eGe5X4qw6k#A;Va2DYMN~N-?|Mtd|8X%)280bpXGfH6Oc~AdI!r2r2x>>t({Y%gAfu0ja;W;bVjk-RPs zrXqbblkbs7a2IQ>mr17MT=^870X8xeu&lU$$V0fA&xy?yCJiIgb{rwdu4xSUMAT~6 z4R@LfsyQ-iPMnDhdk7uia;J;V;s^p|GFz|3=5!Pxzq&@7@<|rS7CBN*?u8L)Ok}1LrpBA5JWpQd`(WDh=_cB#RqYv zB_KS;zFt6-hLxK>vV;J+I}rkTLLLOb*N0=;Eg9@ca)TS&$QPtzu$aD@_Cu^-Qo@+o ztO@2S8WHY~CM>zvD1?z|MX;y%EYUAj(`Yy{mcY+G9i{|jS5TcZ*l_4F9M4CvT!D~| z7RqE*fx#bkGJ`v|wtisAP)i`i7sL6Et}!%HF(T0Xq%izZ2s=kq>W89`)FOx-rNe|!K=~1%VYYmqQ2qLrRjGudHdK=Mk`L77wiX^3NzrcVA zhGhT*sfLt{;Q+JkB~wSxmHXPH3#FzW%~9Y>#w2wLoF<)^KlayqXGdh3>E1LdvF11~S%4tU<>>k9 zj1a1$t0mO*{&EFzZ!MkztENTJ`<7>66b}HZKv2%)Jle zF^pxS{|`_>Fa7c1CpPbN zkWzqkNYYMLD;+q0N}EPTg6twABJ!t=6w+pZ%yoxJMw81hK0ohGU60r~rxYVw@(Fg@ zu@eadL28FS0lwaL>4^X+K&W%Th3&K132UJSdKW?U@Fj94nVJ6-ti`sCx@}476N6wr zlA#1k>fpl2+6}_GXEy5ZmKYkQ6=tq*#|Z*O#jy)6n7D9Z_5Ar&^XFH!w`cnLa^c5_ zVXx&Eu`d!w&njv1$n%Iukf%LD3y6gw7*b@Z#4HvjUIT&DutDPtHYMV*pMUD|I-(&Sk&Fu|Lcd> zKDTLyKD*W0bOFqm8gdsGN0vD(6O9~-0GL2$zq;^ARbcE!PGf?7cq4Y4q=u2-qE9X` z13`RpxnBab4TA|2KQw60cXI1F`Ok$%lk-eia0MC)M5c!;1>|i=V1?>4)GaeO_spzN zD$$F1o=0Z3xOyQfHYv>TxdRb31`+HZ=!qqtB<+G<= zx^gKIUfi+Q#fPl4AqKq zkpPk0zb|3MbXVAW@}fTlCp`M!2FtriE#kM0liAsakxad}|DhM($Yygo@NR4u zPo6}`%taFoHA{8A{43vd2;txSu{B@+(Am=)>w5YITD#Nolg|rAS`A-Yea1Uw$U5cg zm%L}`jES%8*!SUE?n?Cyx&p;vc8apDb+0}5mirL|VUE`)2XdhB@lmAkA$<4(zJTwO z?@KYDkGE2ofg}!|VFbks+QegzxEvJtDG&?>Tk*m#4!71CU50r?Ku2N}V{-eH5jjjW zDsY{zt$@+f^hiHW!@!6rOp@8b;t^Um%SLrUfP@gf@B8_D-uL1A%v^|=Tq2;>Bum)Q z5%#*}L^aZ8z#aBudPjuehw%t!XD|ZTkBV1{S9a}N^TXd|a=Gt+=$sj2$GE_B+NV%F z7=o;1vJ(|?6r%=IP!jThB?REh*r|XoOyaw)Dabl^<|>=00Zt&-n2}F&JA(jEz~g;0 z=+S@&%=p6+L8S1RqLBwAf&fGe6Wp)Zvd8`j}gV zwqyh%8^rfB5FwWn_uRYhi(fcK(*A-ACT-c$)zvi=4NOE+(JnfZIVaMvexd2EO%1{& z?>Py;S^sg%3!Anpv_>f;f*rG^tvj{k%C9>nhqUNM2U%xO8zVLBcq`qjdt|@%_ag=A|_tm4Jg+=wM(gnLyg>Uo1&3VoEla8VJPyv`8)yY zTwsk-p~snkC|tOU^{((6hMdEL(#j;_`HlOUZhLCo4d`_hi!h@a0p(*jh>FPAF?%Ls=0fCCa=Q!)ctf0i(Vn=6Q8h6#&+6 z=kG*iR)>oTYs~l++6J_KiE;0Y#qM|;!o3l)W=u=I`NTZbRh9!-zkM$QXmZUsm8_p! zaG?MIaKZA0rNu?hZ`rlu;E{;iHkx29ykRUb7X@d~c)v&;O{}lz3Jy5a0YfB1OkW6J zkS`5yyOd%Ul>=a0!UsEOaTr;$4qGFl%eGUj8Uqp{o&}>#*mC+ zcT)u%ARo0bj6}Mc|ZU9j{V=h%OMjpLpeg z7dOH}v}NV|X#k$yxKnn{W8ISF7hm}3wdbF<>eDyf@wJanY#8&<3$K0Zhj;$y`pd64 zYt_M{Z6Ck+_6}_cqtE~Gi5GYT{uf`o=Gyn4 zzUsQ~-0}5KXqb2W=(AT`arUZ%N83Je^KUoo+^1!$08m|C_T|gpzh>2OlN;(X+1%DW z2XBA)xd)zq4SGAG%sKk}#b@4p?Zw}|>u(Re^u~9ux#*O|bIOv*w+}Y|^noYtdu|<( z%I3ZI+n>JZ)D!M_^ttPQ_D3@u1dvC2|NN72wN-1rdFzv}ZwvWb0gEMAI{yBPvSiVO z%f8T&vTv*Z`iI_k;}!4!Gt~>D6weTq%U7`_HnbOPOPsP%I5d9v_A0S8^8I- z3%!FG)smi;GaKt~_`rKsFPb~Cu6ih!-*%ws_fN08=ebwIy6%+uv;OnL?^`x=^1x8` z#cjL4b%b5deM8&Ic~wkx~fbzzx`0lUC*rhN9M8x-XwBrgVZ)WnAP1*ewHoS5*1*x#Ic@P)pJ7jgptD$BgH zmzOV`QCw5uL1(5a%-J9~NQ!kI;?W?TMWTl?2-9ps6d0{G3B z>-z@87k}Ay+OeglE-4vP9ZUE7uk9Fo?3KQ(PVXb#>Hdr`e*x$o+1wv?h@BF=2iiJ! zx3tY}tY192al^hQr!!(W=CN(VLX$gl*gX>!wgN~o3+#b#O8x1#WPqE=0Sqh+O(U++ z!E8GgeKS)=kh&0D>NInm8-RuMq6kz(_^!d<#m=q|@vb>GU!ahSKqz*lnlKw;NgG7^ zP`&^xJzx>Gj=B{8-$Y+Bnf$%??*H89=E$FyTsmd@_MSi{s)K#-3{Tssg|j9<_v`;G zFD>?caqwuziSwra^Cw^Y*6sbIwRZK$??v%Mbwz0qbATg%)3p~}eELbxZFsA!BzfM-rQg2#!uiuCe)v1TG}V84 z!xbMm^>{uWyYBrShq&T~A0O`Mkrf)MDqi^E=cbLT1JIu8D^C`!oHu>tyy+{BnRdf( z-H;9dU`j&`fSre1Wm}p-gByK5a?Ywd9)9kFr=NKFStolj??^}YPw#*Ht5>YK>zkii za@AM$V`55U{n}sM*jQHspshPqmMlJT-mDYn&02lzf~&vxt3cBqIcL@F4?lD9>B}!a z>txTPBOTqh-uKwouDsxP-@I<=RbMevprNMfg$Ua@f2 z4L|>r2ByqD099qB&;Rrr&Fx*!Zg^|Xq{byPr~LjKpQ@`W|Mf%9NSX1w$JbtT>Is*e zzWmF#{dsUGYw%gMXzsY$s`j4rvm3X&<26d-cC_U^$Ig4`#?QuMv1~ry(%F-Uc?+ja zTr_Rs`6n$t=i5K)&)9{7701kY}B)+`i)P-W3jyNAL&Y+x#XA?$4tNR-p8DViHI<{zIN@+pKq+G0?^izE=v}lID6`e zv!||JF#GDC{lRqhn2C*#-grZF2L#^SfB3@h{gPkn?e_un4JiGV?)S?}Vts?mTO|T$ z!q~)@uc#_ckPzrd`P0Y8KmVbsr`Hb{6piy&R~7s66}8pno`hDMpy}fi)5j;~PA@yE@{Mn(lZg}2Tt~l@7HLLZ5G9gG*m6tcvRC0(7HC6m) z%!6H`c65ZnpLAcX|N7#l?NioVFCRI7)v^b^|2ZIFoCu?Ts>(~2&7HdJqhIeI90D+V z%J_A+f9C_Mk6*cH&dXbO$%d=SN`rV-S47|`0HPmVd*QTkb({AdzUs&K?mT?dBk%Il zj=Sx%mwxixm5;yn*3+AIy1fvUr6mB;eFJLwT!s#ODa-7ZqKE&r;psQFt=+owjXSB z6%W0z{^6J2P&6X|c=)B)pMLGl7dGyA`Z2{;R%s+s=c{9(k9)_vG8Ye9b45UC*PCoYj=hvHYz3hyW0Q_a` z`dmJ*hDsXODlSgOCJz*f{1qX9lvw)q<>$v^u|KbU{f6J%m+Bu7z|8RtfB*J%C(fC6 z^_eSw_1Ib+fS}tycV&4=@pu2{@&EqYQ<+>2z=bQ8{_#s!Uv}zo_dfsXGn?O*?B@~P z`iV>8vDiO1ymig3f9&k-_dNRig=hT7n$t8!1U)xzz4qe9nyQy~?78OW_Z(>LB+vyX zExzk>SAJ;KvWH&X{P6m%68YjpV#c`oU{`hN?&~L)6sf*^CW};mUdpDfRKB|08_X~t zPyi4gTwPk6p#3em+aK)dO65V~tdq)CEiIK5$cK`#gv-vXtS|NaD-NMF}jMll<=8 zolWg|5SGj=zV`gec~gs)%ua6Fm9fqaQL5k1U=N$* zGXMf!FjK=q+qk@U}zy;=eM<$;6q z=2cf$CjgvyV%_@n?c3k#4n3wv$4m>hKviB+y!yBW06zZRUmrTs3NH>{{P3Pf&pdJA zq=q`!v7xJP{@v9-xKjubC(--dodBv&|LCB!(*ucM>YJ8T&IPjUY6W57*}xA=^LQ-w z|NQaM{(+2yyz^l5|2+N5wdbGq-V+wS{H9cjxcUdTUHyaK0A4&6?|tSD0M+MwHj~W? z&jWcxBw_@Q2$U>JT(Ep0fNO63)6T<30r*1P^X%(OrceCL`KMfR>akC6+7+O@$K%gn zcD*}4nmc+xUQ1^Rz>&@#Pz(@9yHfxfYAc)CI{~UFEjsJO#Q;9?-CsAiw#yDbwDz_6 z(JNNi^+^xE^g1V8b9*;{mX2-!M>@JCg^qT018As`Fi}!mbiu0Q09^Bf-|RZr zOn~qE_x$t4C9|e{=A!pra>hwdzy79D-J16MkGB8p@6W=E$sqGj9(eK-=bt`#Y~2aR z%y@R=Thf5J`yXq+`>{(ta`q`wDFP^p$JeY}2H?-nzUorQbssooC>SK*H=-`8zthIn z1Nh0`pHB4;O5pD_x1IIPpN+4p>SX(2l8MAue)qR*F8B1t9cF3r!B;ll^X#kFym#g4 zi|0PG>1_#h!IbgS#@6*`hOW8wkDa}J0Qo}v`0vlWXUW`olNt@u0;otP&pP%P09W1m z$EJ=hIrI;{x@EzX@!!1U><=tos+1yV%icrYc^`w_oUCOM->}Eb+t;^eUf+IHFK6Hv z_x0GggPsn>37Rvt7!ZGWG}YOYm(jr|U+J4ay|}j0vmzBJE~5Fh<3DEiYd-C%JjopoE<)qWRO4fcV`bU0rEkYKl#}GEcqM`@R+B%jPCG@6G^r z3x6U`Pp7?NKOcXV#HGJi7QRq>Vmr}93clqq2K7_%cO^ZZ=z`;wW_dySVo;A+H??+ z>nHY2>J%rjCp0Pw(hOb_PmL(ERHCeY$1nD-zQ_Z zs8za%#c!B8ws@g#kA#ZS_x3X|nE#(Y?=!bAzkF(OQDOE9(4GKb;@B}U&+AI{y}kF4 zT{ac|OPhB>yLAkNaEFPppV1AXaF-az2>#pThDR}l8<@nly@xmkI}f%17*|&%fO{%XcPQ*LX{o8HUi~#WBws!!`XdI)Bzd|BgTLW?_*&};G9(ihOtE#0=3j*MI zF?oGr!pF5R-{FnJz%9y|}8CxEy1H^GJh2*4ly`C>MgKW)kUiS@Oz#j{RWSW{8D zuchs^9eblG6uzRaM`d-8wK~JM4zzXvIBD*53z*Q-)wAK9gZqzmn5^%Cp`m}gzU}Ev zZwK_QGkwP%i=BY+OGWorjD&; zz2f->Tmq;Bp3vMey^#ZAR`>-JTTxA==aJ|i6fNyJ+Xlq$0~ynZlzlaoF^@!duixDV zip3}vBhLeQdz-QV>MA`m$7(9$vSwGWuiO;^fW6H*RZ}M4F%>Nu%|f(U`!QD zjbVa?OyY~q^ESSbnxX%GiDoICAQ+h?$j3p|*1v?l$}{gmg&e8n4x-S58~vPAi>^%& z!VfzAMCG8U9r=*FWO+ zL>(P3Ej%&>%R9T%gM)rD=>e#%Ep8lNdSHKF*Z_c?aNq-#EJ^_AO81%sIN6iVo-}|! zE>+0l(M8*T1(0QiB8wuqdDS|}DdJhXRTV(rKn84M+F&LJAQm&{wVH^%%g*7IbV5mS z5rCe)0p1u0-Ms?@I2|36%`c$ zs4g#i;wN9@u&c|<03_n!JgkugN=dR9Ku;e(Pk=z^O7{aOE=nj$3auG|-oZho)P<1Y zjhp`P;2n=Wzh(D+W6`#DrypCl>B3WvyYj4)Z@%|Y0lN6K6A^F|4Npb8gPfM(ciRpl zEa|t8zi|BQslWL2WuJQAsyFvF?QU+}y8rOnt-E?vVw& zW|Nyn-;jt1M2Un4pl{IE_Oq-(eI~%^DSYB_0#KIpZn(5sc2y<@mKN)~9!amn*1W8i zVS>^m88`t%2Qp44`ZGR&1b;=kwXp)`Fb$J7q5C{~HOZ4qM|i5RD2nDxB_RX}vKw@n z4$@vv5NyGA!a{>kxGsW>;-(m?8lHP0g7pGl$hj>KnG>XPp2_UMFW|cTpO@fi6#A!) zVCsE}N{|HIID~#uXe=NATzctLsSyGE>tAgL5A>5h=2Hl#wp)ZV+7>$-=GN8Rx1$+C zI+*HSgt%O=d#Yxbry^FK0{p=55EoB@{4b?JWd*hhZ{)SIxZLGv`-Ot+VY@3V09(N( z;yS}5eJ^=e9VBIVz#JPy1fZn2=(JMRrb?Jb|xF*d!JiRMBljV z-1$?+&z~}0UhK~d-SWUcfArUNYeB)QnFwrTd?ivq@iw@GCqaP*81EYiU`)iYu4L^EQ_Lel2WptK9+KS@5D=Vw z!w-aXA=w_7Az!ed`ot6K)F&|gPhB#14CH=rO6^TE*?Dn zh#`&_gBR1sB?6wutTN>(N}qCXbKATtzpRc<)w57ff>F#sW4er7RZ_weoRJ(z`cN3z z6TNaGVL!X!t^G&Zr#IFwpFew2Lv3lYc;l`EGIm`EDRYWeu(hxz3U8RUbqK&c&%S!k zv#(BRs9iX1;+%=&-gE3Rr!AWEUst|=`@xpSUVBs4TReT@&#t>Pm(PFvXZJqx>ShxF zxPHy)Kl<239QNQ)4nS3DX#kI^(vlEa1c1Fq+UH$&Q;5}7s7qFxJE`%}|GXjapphI!9gp?K(Jou z8opx^Q@EAk3K#hz`tpd6a#SPg5C96lB}4wpNoU^S#kg0W!H`VGE@#{J@4x@hKt=$b zB8|ntKsHF3Zz3}^1S#dYd?jdeTL|G3L9T%6Q=u$=fi4rEkLlIFfJ8i&&F3R1FSJgJ z;5d&}3J}th@*=d4NK13JG-L7PsA_&0$P59fDot`g0#sF&1TdJDIYffdUmWdD1DIG} zE%l!eBs`&CA7(KZo+rGx@Ztajk?>*=5Gu0j3D1KNLwO%SO+^_z4?dKYCVVXo^hQd- z_$0SHhO2#f!59gt(}jp-}>Xf zKmFeyzxcD~ufAaUlE+l43(h}b5dnW*`}#f4y~;h&u<+V{v;)B0Nn>j($~x11T76^X zG1D0`0>Dr%2cV|B41k46X1HzFiW7+$jfJyMd;9shR4nP-G)L0<n6fzml^jE* z#W4W#ilMAgR(yY60aMLbv;<&MT{VDKxmaT{AUDKrY&BtD(Zaq4VHYY!CvXYKQgkFi z)d`7a7cw*(D?>44Banp_Zr>GA5duqhTiT#Oig7;UqfV~cGcw_95ZDCzrJemTmXBTS~B}o7+ojn2Gn9BxNmTd=`_Z?|3EiSt2^B<|LC zjLJ(EI`kA3$>JH~>Km#mO@7Vhy$9&LtLc5A&v{qV`PUrx`I|;2RftO6X(0qEOR1{N zBQ|6c8-g*?u2kL^RGOp-wVuf3{Cv*O=Y?&NTvb1>d)J6ep+}9jkBa-I}#1c)rK>&6ET^kAd z5HIFB*klx|Y{UqYZg>^^t_qiS!?!hJqv1uNz+ER_e%KCmZOMVc`frb z$UQ5SwMgEaIh89{s079S{`~!aISkJOc|zuK#601}L@X}jc*2Vb(g8h+S-lAA?a#ch zVH<$|{^He%L_#w2smtb{dE#Q$UzHvwBw}VEjbcHxnb84IO=ZP5K6+6+7Hh1l`RbJy zhGlVK9&oxFHmX!pW;iSgq%v7Nj;G8E^>mJ?syQ%}eQ4dA0Pg`9FPJkPuGtW!R@ z<_rM$Ket{Ffk$2dRSy&s7Eg03G?5^goPM;k`|)*~7tfe9>;Gl$z2mGXmj2;y&DqQX zyX2f)Kr%=c1PLn0ML>*z0kdKRxu&aP4j_t(0hJ^MR6qp;l%Qk*B`84&l4QwgVdI&p z-ya>OC!Dj3_df6EZC7@7rbAVAbyanBb$9hDKW^B1@c2pB8gk7dK`3p9%J-hb1;GHm z`*{<9=Wf2TR>e#K{B;+%yS#mKhk5?m-`z@>KYHk<>5t#>_;r^jCnX9Qn^mpSg9Ca3 z*u2LTrknoS51>!GW=Td6$bbu5U96S^r4VE|j`PrjFQT^Ht96sTQ(oNi-qVLZ8U0}Y z9+Q4p>7!>(UcvXjZUyks12;6RURe}xRj=lf7a!U@{>cFynyc7ShAB!ze-Jj5MKSVz zl0}??0{hQ>Q2_lqM!+^4Cgz5Jxt(oD= znc1h$GAy}*#nP7{fDal3BL2utkG}cwk`JD{`jSqq8)vQl?a%UMOJCHg(JNEFdFIY* z{P-CWA^@b~5gcSRqwW+%)OKvgiC7kdCrT{kdZ<8)#y_5=Yq2)1}i=B}TKCEc|5) zDUIj`eFKmRQu(}vtHo!C0APGH_s4#n_4dSYGu}PK$~=V}#)1h5z-wR5@89`?=Jjf9 zoBY!LBPYtFrDUY10T}(|f*l7AYr%N(Z0=(dXTEXQwNDP}GxDlS51u%kmXcJlY-s|r zkDna(^RY*ouFcf8~tQPh8mp!1x6#6npq{GehmP zBllGxn_jGeOKTwzyjR~EqF$dvruHmI`Ru6d;=o{O?WoHjg7!HO6GxMaLO*$HVDpnY zoE%;f>XBvq9SAo9TxJ(z++DKw=veZ<@nhnZxvT{e8yUipX9IngOATV^Zt?*U8Yf19 z2e_0|@A~(vR-u9n9^3lInN@2~x{Rp3rn0C~Q%YlN^`TnfjeqX$cKegh-81OI7U%cv z(suo}oqZpCseFd#P#7wRDC0YT zCMhvNze!I^i3NsBm>`7GVQlF?l@?U`TG8k5sho}vjTw2>CF1PU{6c%}_MIQhTlK}V zU;Tb`m4<&XbM@=PZ@sj`f#auN_-sKu@M0xZ?O%tEwY%@-N3OlBciSe_D`e#4=C9hk zed@erAJ1DFjmA2$ub6cB#Ho&VJUMdk75y%1Q>$|M{KDwkZM#00z2u7}Yd{vHr`K}F zx9gmMG!|s^va$$?#lcMsh-3Wn3yZ#4zAiQhY9NHkFP-P)nY=C!zWmsrK7Bj3tWhzu zpfI{>>(2LP|2X|8zgPDCxj${#weO(;mt2rlvu4H2yn>>wd$Ye=`}^xN7aq%T&rK~T ziuQbT?5H7qujts~p1v0!IhC_y;~%%ZF|~SyOam~@GrWBB_Di1_=Qcw$uv066oitMc zX8!BYv33u>{K(ap^={Lodiji;y!=($c1>OM^T$h8N9`Dgkou^hs+riLe)8UfMQ?p^GCf6}!$R`n0Vd$sDd+i#$9s25YgR8gqqLP@h@F2I zt@_YzkWPsGARonGEnk3WNK|_X66+9D zW@ZtPO6uIw5H<0Ck))KQkU5=J@k)ype^@9PLRYH?iUs`t9agG-_Wb3WVK?ca<`S+e zHDo5>df^DbdG*pCe(*d|qOj0;ZuIV>CyLmUht;VDN(zuPgv5a~r)nw2~ zujyG1DQIB{8KBqewer@JA~ls^FR6uw&=Y%amobCTyLIE~kKL4%kg$5&?zd(yo3Ub} z2OiU24o}Kq<2cGzQFrFqQ8q!;ZsFlUh7NpWaNij}tsU~*J20*~6_t#u~MU=RkvN^I#`z=9HSNwOccz+Zf|*wUUwc9xC7JDq+{ig6y5F7!^Wb92A1gE zkre>kH}+^z)D%nPaR{5m*_%y5;K89%+0wW4=A$H|{xb*$Wd+>W#vl-cg)D z#)HYO>W!T7sh6@BNZkab_}&+sp;q>pKo%haSVR$v5&N-&0P}v?+WoP2 zCJ!If;ru!s&adNFiXMsOvy&BWq)**rh<(GB1&5`}*CAMvP^3x}XAXLeE+4H-&0-=M z%6!tEA-x!*nd`cq9RYm4XcZ8`yN&Bq@7Ahu8~`)YO9gw8nLSPv(!d#5$+n6$Vnug~ zlN3Wfv+o#W)z4|kN%vjRy;tidw&Q&J^G0{r8eD6NJr9sR0U)j@4R)7Xm2!>gxj59H z?CRoxYsxd0V}_b&Z=sQqq>)E%EqzDz-j(-5D&r3xD@)ijy^}ODMXba+ z6CB5|cOv9%l&C(2k3vBd;fOwy(?&N2)Wgj|wYspqpH8FigX zm3T}*!`>BL(V7B*-T7cU~=WS14OrlpOWRoL$*RP;4?3oE&9vH5_}4Vb@ILFtj|p z;d6y~d)#N1o8Q!=2wE-6EN+CQben~!YdO+E2)&UqP9iODyjs``t{2dgXLBbm{&~W} zl^b?v2TaCuNMx*7yLPwfUUHRzM;Q5p04Y&G#$bTad$MBhzOAo7zELPyYJaNI@@#>b*^(#UiZ+DHG{j~IFt@&%kt~J2l;9vS zUxXIoq%U)02ILf$MSi*hX3 zWJ{qax<*u`x?2XCGDL&&-cv(C5g53>$Ati9E?rX;jhaZtrIzk`NCQP;8nbW=^AZLz z6;|f8bP~Oi^&J2pB`L8|S-GR*)Y<&?JNLZx?UK1d-v@!vwm~RRZ0uS0sR@?b;MhHV zS=mV;^|AY}DQ4JZ;~2#PwmLywNuf@FmqIawKBm5w9#+qo3j>m1tit%fjhANqylK{& z-;A*msu$x7Pvfg$VCh)}Q=mq5afZ9OR6(sTgNF=^B?kn+0XZOt$x+J}76}WTJX$COix5#VSCiK`G8K z@)+Q_g!RZW{X`^Iok?Rt-jd!y;p$gK0aGWM_JB`0#ZSe`=0 z?~^~X{86J`V?%J)OXPp7vx)!3ek_Tm8WSK#tgb~sL=+)PfMr=oCZx$VMU=ASnqsnC zilYSCCP$1uF}h#Q#|=S3A%u)8RD8L~Ye=&0C`x4$>3>S_b<;u#WNie^=sGCyUcc8=r+1{|rb$ek>z5hxyo@4>?r!ip)GvIzmn?K>@cO_>p>Ipk>M zIOuvA)$==EB|&ULm^r?Njcq=AG?5pKI28tkll~Q}LN`NDqX&_XO;!T5o7yh`^e8jl z$ER?x9S#tIOlCHvA;Re8aR~Ta&QM&S*j?cRz`y)xaEM809qr%_1b;5_)u6<#c+?BK zF*z>yfqaCGnGr^xh*m7wJUOZY_5^82K*UL47Q|L>BK2Bg)yScJV{_TL35_1^hWIGFL!c0&uI;~n*

1br|rupo#*OZaSMRemw`B zYxqe__}J-***~)pt_i(0;HWt;FilcsX`s7VQy2S6Y8l1cvYcdKTYUV$l)bavGV_u! zh{SGq=~oaa47>zS&4|DjjL%9;qq(D%(D4s_z#qNy4f@)F%?E4&fU7RO;&UIp2r!^pH|Db+xbQi@_xzXs z=_}5A&5LEL0N`t1xbhvZf4l4T_x$-g?|s63?sdOo|KeZXw(E|ao3?D$cPw1=p-+G7 zGXL^|E_QWgg^im2^^uCaVCfH7NBm+fw#WQ z^|Aoxqxty2er^crFn6ZM7j@B!YV&HM%UVI*SC;AGuw1MW|LiRoN{30(Ngz5@HT;vPqNV&gu;Tw)GU&~{n>_>AH< z>7pJDs`?5~%frD$qQz#uNIi$bLbIi%wU;U#LW~}^^4qULG@H=Ln5Nv<5K2ZG`2Xy>(5oYtcWKX+rhn)|YMGDRvCn9u#76@Wkf3&+hQ==z?Ej-J&b&TKnjZA0$i458 z!^)19((;JnckS5qN6&rbQ_lO9lTSN!+tG(NtFvpqdG)8?_sOq*{z{8>Ob*#JfBIXm zf8w*B{KzLiM&DU`{r9f>+($0D`vxYLOOT?k09dtSLRr~)XD{;R{0 z2!i==3xo>H$`KyyQiZCvrAPoJqyQmichc_JY;jR++9W0mm6!?*YUNDIS=&mGl3;>3 z!D{og+Pqo8l0q{mgyw!+yGko7mkG%kQpj9FtFN9Gm2-5keZrJo^OBj}0|FH6bu?t` zMWAatArVu@QFBrB<+7V{A-~MlK`NjVV?Ci~Q@%8b3&~5O!7S(wax#*Git0pP-rk1$ zW^v9Qg;2=k3!*pyn&*A`>PZy}ZcXGUh<_SQRzV*;KRKr6MT+&*yI-Ud3rc&MCPVx48IApz$ z5m6%VPBTb0M*?Z{^Ccx1(dr|4GRt75G$*^l+zhN+*7@atF*?l7B8*cO5oLGCY7Axa zfu-KziBQHD5manm34g$^^hJ{fr z=}@(cC(L`9-DD^<3nq`oYHR7I+$EnBv1-m+!7l_pya zNlITt21Eo%0!bLDOXTLZHmPZ$jaVTHa;VoY9CY$Rzkg)N6U|#&HO@br_)C z9EVJ6?HaF)Ihr}C<%-6rYL**$tNr#LcyD?8DGO?2(g1^0bNKrP0+k0&blhGnxZ$Ex zM7t|3(>aR%P^m#5#pRbGl1jU8AQ&$R=Qdzn8vIyEG*%Y0g<7=2_bv#WQo%_HRdY|B zKD(~RdGJ$wb9mEkV2DWIDqIJ7-SDnop&FKET>2Py_arG4-w{S%LN%t1_NhfP09krM zrr=^@x#lk`0y~=#1YvF59<6zRZ`PQcX+8$HLA=AaISM zrIczKCGDjdC`l;CiGhTkp)E>@vY9n)+a55PP7j!xrT~Dwa9ZD%V1);{8o9#9zy}i? z?lag+OhR%k0`RzjZ7G^v6JsAHV|pZ9owqA*`vSIVE6Fn{Yh*8wj-aFeoX zTwv_WsLn)GHwuJ6QB{KUi_>~VfiOBdx{FA4*=*YLW`(!r3~JgMmc}|6X2Nk9Q)Uce z_rWqRh>3t*n*ToFKLr5hW{@h#lqLtJBXD(rZM;Lcxu?R+ zq)|445HK~e7HX8_^ICu03MHUYtJNx~h0Us6RYC}X6(Q;CNf5wTg^dMP*cF5d$=$|> zRDlxK{}qJtmjoH>wLYnB&Ds_kA=sh;0K7}PPNf1%Edl{3A|xQb&x)PStcm;_WhvUw?6w@86p}Bza4)vuM+0dG6{+fGrL)W0H6r;CEr9K71%Q|wIoth zDMebdMTvq0Dg~qf6e0+TlL{s^3IReOk`T5p(J3XAx-DTu8SjT|OR^ljFYFg)TIe3m z-mJMYfh2#?@wl~WCB+n5sEX;dMDX1I5 zTHhF|Gg&?*v9KH?XSI_&7fum0+HZ~DOv3D?S#SWZ9?*f0PzUu6@Sp*8PXK%j9gSYPhk zh;cR>Tn!o6!pQsD@+1l%JkFtO0s$n9)FsE!wbOusCIS_rQmeQ+qvil5R~6O*Yk^9T zkap%GLInoEl0y;X{M-?N1X6|Cn5u+OhE64v0^_HPnohQYz;>w6G@7Y|E`dU2kKF36 z1JdBypx^NRl5B9DI_EkYo2!sM<+t6_xr0B)DLVmu9Kq*ae+BvV9?r-ZA7`AM2)x{k!tMKv6H`5ek#TZz64I_U0$-JtWx96PsNkaMfRrM-C9ueucRFff0*(eKsPa2D z3Qc#n04;$eP!bvmtvU4V*S=;Y`nP>akq{K1Se(LQ1vTQN7D56jdlfiXlfE`r2UF3l zhs+8|^p2vKD9>tkey5lwA4YMYH2}wqzi$dM#uqyD(;SqW#qQ;70aTPt6EP=TDkNv7*RNnhe3Lp#|?9{=TgyWL@dZlDaV#PPl(}`0dbI8o^p9J zjq}4#0H6p&R&1Mx*jR-YqyS{w&~o<~abY0TA!|Fh^I%40b)5>-sGauo}STb!5w+0Dwr@!>L55u$D?y zsb`gWA&l){_=?aeZrm*?_*>UFgjgt}od*w>2R;BTOogmauX=k^IsA?1%u?j)@!d@XjNl>b7+qP}BU&M4e6+!@l zK%q#*!X8m*)Az8+6F~FyRqk~S>*9brr2OHA=ai(mt{!vqC~$ig#P$gCh?eCC52oW2 zHU(xuImF7LZRvUh%Oo^h@stf8eTHcL=`T(#g^lR)f$I!eU*tg<=MbRmKuB7jwb2B< z! zDw0!xS_lxjHHLoUsh{*4*@?n;`4G6v3MW2pWG3tnvS{vr$sa!t`(N;TnjTmXnG0}9 zuZxPXZU8_LNmV0Ez?zf@l{Fbeo5xn~vp#|Pf1J)|nM3LPP{PSK%$yt48gSx`3#GCn zFa405Ob6@}O_f)Y2Xw`(n558y&hF0ezNF-DTaB*#VCVF`>VyzjR1h(1B=B>R;R+=h4tW**~*}-&EDXU{c0(bkl`= z7PqId)UhVkGI0% z)vz0*k+B_D=<7_IdS-EcMr6>L{gB0=L=I3=AQq#k%PX+X5>A5Je(*EJkEzS(-|r>= zNo&N+M;0ZZL?jYKq!cMat-}%u>(VcR>#NDKF@5h4Aecuo1=$#V58_NoIRhmKDilIg z0u4Jw1XPL9$+aMutAQ5dZ$9_%001BWNklUN_PrGQBgSr7E0;PxqXrU{F z08)aKJ_F8GQ44Z)jh2&{y$s7qxm!LX(F`cMf;t;mw&1QsZqBn9vnpz2igcs0aNB{s(_9z5X{(Uo&lC&4M2@>5S2qf61Z9r1ImuO8{ zNWvea0jqGi+m-Zl4y3Usz!J??i6*L@%oOS+00I#!5>;DORbAKBgm8*j*Y%_ZQDaqW zNIJV?b?5fwwryogC=uJr-BjRkyuBvO)@?lz^s?0M2Rco&xt3ex79}RrN?UdnGzuF< z1PV|n4f~Dz-yo*b3mJ-Edgo_R6CJjhJfuua;`ttTy5G%Dz4QyAcyG$$5c1eA?VWTY zCR`4K#62D$*;tJ3Nz725a0llp89Z#jDquVZ?W-P|NPm2oZ*zbHRp`1@7ZkzcfQ+=V zzL4^ge8xaeDI83R4cKf0$AJk1-!61syv{X3Cljm`+g?O-z{>&F;DwdIz2C|L1z;Qu z6txoc+i6On1R>G&dtl)3wQ+@?yyv~%J4LLlZliB01Oy-?DHTY-8Y;jVQ3wQOPRNFR z0_E!+vVp?6w5AY^@CM=I0nBe)QFl3x&n>*pWtMy#%$e5$u||a=iEJq&IE=1ks|lb0 zl-W^2GOI-INz|lBqJ$PI0jknj6loWAAq1j+oDBRXj$zmCwj+j5HNV*C4aqf!{hYl0 zJcQVyr!S3_p^qaL3L^JEzU~Y;Oo(O@a05lO-KL00%0?fo(4ba}7D0eyth1HGN?A*7 z1)|cXoaNoKwrQ181cZ@a0(fs6zm=&)Cuzmd+{K{%ZY4s~HcLxO)yl$TMw7`z2w^V( zwz=)LF!BMICk)9Ov}M#b@f>@~bA+^()c3TTB=48X4!e6$3jt$|%FD)Pj$WY~xjec} zHUD^{x9b$C`!D%FC>XlzP>|b2@d=3kO$O~{?>Vx{AxD8jWnh?hUj_8Uax1j`2!{Ef zyJnv}*mv?xyRh2#6A6?z-hG$* zas?8C6nS9EqI(Dq69e!mS(pMIQy_Ev1tk5(u2OB=I+p|lP@o8;0VUWFHdY`DL?MI_ zm7u1gR)FOK>|RfduE4ZJJ3|=xbOH$oQMFCmHtl4E7G@}fnE0s<_67;7p~46sS+o}l z4@|!wh7Iut_6ADur=r|ah#(&)CSx$c=r=%omo4|n?HD_UNPAn{F`T&tm?{9pQs-u( zqy4r^vvM76Y`Q!IKqN8;#k_*yt{&@BxvgD@01O`0RwD9;u%z}MAOb>tEtdwb$}3KR z3mB>(~mqKSYBVXHtYFekZDRQ5%&3ZU|xK>ChbAQwuDmY#UX0I8nj*t6V!0P-d1k~Fo7TxF}t!xyx~Jh>CESTbJ>n5N{pV` zH&TX&Wb}rF&1bcy9#yKpo)E>1v$ANe%!QQxFGG{$4`ev~$)!&&vj+kSz4csr3KIH# zG%vl4=Qj`l2)oyaVY}P{AtIs86k6XyM6B#m53bTQ0#9!HIL2Uy!;$b#%bMNIFA zxJ8o8{pc^5k~UjD>9HXBfs&VL7kHmhjzXP-lCwF5xOOkQl3V!3!~7jcMg#}Z%?QV8PkXm-6iMSMZQas&|X)d zPhFy64N`$rBqb?zwWkO=btZw5=BQscU;|c*;-4TnU5u$^0ANC4Ft( zLnncyi!XYp8sF#v9aTy&W;}*8A}wzS#z~Ts<9k+^dzT(_lF}|MvuMzvTCl>C^bs(G z+MOdNBBd0c=t`=#ZKae-*>fs{NT`&OQi=*yWtW#Dmk2u4ntd4(vkO2`9*!I8;eiQ{ zI5Hw^aF|=cn=|BWDa_VtMS0rUk(lHE84}X*>gXtp-!WpyMgI=$42l$|i2DS1oq;H+ zk$5z}DJaH2ZoQ$A9nR$A_DIZPCNF*wQ7So`(PT1FN&%8RG(=`uWqL6>@4;kn=M4$T zg%ayB{Y|&^73L!miEBNw< zEZUs5TIfuMVpAvGtkxTZf~P>)BE@>NC@k3?KE()sco^hhHc!cBjVnUq-Kt0uC?KVE zNJ2&W?@A()eMcb%wQ<$jMZd$Jo3#ckkO3vxrBsG}9lAm$ zQ{r_Wg{+B1XAX0^#lO!NU#D*_G89%Wp=)7fa`M|P1`z0QY_6Q(t)LO1gXY|ra!6*u zqy6GkG?u^#Bt&p#U4MSd>>aX7`EO%O;bs%<2oA}aE$d}qKpP@z{ZrWuZX2&t@p+C& zL{iFTCgp-uN|7*;21Xa~M%hf!J(&AoVs{`Ut2G3Xo`(d@WygE0GhwD!FRy)1^Uq~6 zk@aq|SN5^2ipD#)Y6mPZeuCbVsue2xkVggs!<;;jV<_DIWUy}k6sL82YBOGTj3mJoTfMBAcSBcR_@EjAFIb(T5u*=eE7Ma|JJRX6Y<(7{S!RbMj4rc6 zvmLZ&scr6DsurPIKv9WGRMiBksYb~{RSk*8&eRIsRcIuDoVe9%!2rks{E7gS*PYDO zP-gu)IByDbV%kg~G99Y?Xf=S z|7Pbc0SXQ9bc(>A$1ZUqP=NN9XZ>oI`P)3!MMy*nK?&`rhm2C;@2UhRfHGag`opRY zU7S4prj={pONo{4CL3pQSsjFe47N||)?CJd4N)VZs<5iu#be}Lz5KF5S6|=??v`)V z2X_(f$%i!(Q_h~pg6rD$WC8gqxaB3Tn%NKg`4JVCQIaenA(z4jzt#g%bvcm=#pWpj z3b(DQWt9F*q;J7P(0{nLN75MsTK%q{udTNA>9uT~eFD!of%?RyA}RC*Ca6GE`r#80 z#uZ)X6d-^ED9to~`JA(!`^pzx_nm9r@Vr-n6O5$q>l9lL-ul-Uy%PYw^`)=<)yvM; zGLryKeB^_E?`?m0<;9o3<$wG+=(FA-NGTk5k5=2L*@q14WZ_ar&Y+_AeEpvR-~|tR zcC$Lmrste|NXQ7aj(slE!Fa|wXFmUxFZ_@1T=U1j@#^qnP|zq!O2t?*LxC53@>%<2 zXIg%gK1Xv{gTsrVnZyIE=rT~QC54q_IR^r3r&A0Vgg_^=NH36(0oangL_wVgQ7w~P zp$6q%Twd5*O}A9j$#goca5L5k z1Y?UM>)mJmX0XotDB9_!EZ#*VG%ZJacocwL{)v3O5F?3sAELhG6D+gySx97HB?Z0D z0ihkPAUO4d>sELf;aRxKz1BP@^44YI|8bijA$KN*YxPMGJ?C437DzvN&`M~PjzlxE(IXGfiqxF6hsBQs~&{)UBN`k?AR!! zKmt^ilcT5~D+6uw4WOs4)QU-CCRDE22R`DYgSH*K^R^vD3M@w($>BFRjPpv`7h&JA zg)wcn+SEo7G?3>@LoooL9Znqn)&5ZC zf{0k%Gj+s%ios9cs?w(J{v5I@-5iDJm&4XL)e>}UU%{QJ_9FMdqO{MW6trSwkoRC6H1;go=c9d!1+NT+_ARaQacaR67vX zLR7+R;oAOWy24oK2_vS@kX`Q-tTK0WxqD}g zL`(Ths11h4T#9(UW)A+?J+RtSM_FeFMI@c+SVL6_N-5)RXg$_BeS~D(*o{*@0l=+4 zyyfs?j(FtRkNxDk{-s#86SEPC!Qv(eM4?SEoFUCEjUL7lnEe%8vW@$4}+cdLP+35IcfvP1! zfm=3j@$~W15t_DLUS3^USy@?G*|ce4^X7$3n>I}*6AwBq+=yre0Py|>uJ^b>&MGqA zGG`xe(KI+cnSd0bKp_OF;GLzws#gHAEUaPKqz;6A$p@y}r-Aw(XX`zmv`+%E|92C@ zuIlJOqE+CM*ud)~Uk&43h@izHDMeB#sicz761K+PA`}YyENl(Jdd~+6Tk4p<@nQX| z$q5#`gNScn0Jj8rHYhlI$` zFtq&MT0AABudOtisdL5~^w>>yo505ypV~YD&MD4Mc>6^oOe96rl4=PW?RSgVl58YR zDgmNG1WDK`1prDa>A8pz-e|WZSC?0Ay5@#QJ?*rAeb+}JxPXOi()dG&1d&hKhVY|a zqkdohbyn>u`)5Fp*RD`M0|x*~s$@>APsl7PkBjzc2rUl-Ltc^e#-|{Djv3~zw<{9h zcZEpkr%?og(oXSujgdfA8>3b$CCFxpR`#^jW>JYnQ;eKKJ6&B}ovo~_?3Jra)V3A0 z3(b;P+AYOam~5@E7Fb*5Qy>bV4^XRC$wtj)v)ODW00rP=I-O1@Fl}MlXf@TYRMQX9 z2A1YW2x#t7Beyk4p!EF`etXy5xf=r=-zE8;3K1$(l7l?N-YUgl0M~Is4lF9g1p_j2 z=~HNNT&7RfExK5wwZ8XHX)a`ty}#zJt_aQcZanl!vdlq$WJ4(+7&@mfC3oIg_{E;b zL`5i-u$C26fTV==qcz7aNFV${01yNskQ|id84mDn#BR*G2MWhD{_6gc1dSq)1TA2N zwe`Fp@7N3g){7Xmq1;(exR&7#(#^A=oDx1N{XP$=^cr}WEJ&HfUBjv$6i*D66%v-~ zk8OTq=wKiE92c!!#GJdZFW>rgYElWdPW_d#^$i#-yWb@pqL@rjx5Kx%}+&p7Bfn&wa1`)(-;Q zZAn5R1ln@omb1=##)D6L*tVk&Z=3eU?_Yn(hd*=KgcNja`F(%+u1~-B zU!#6{>!<(zpu-ON%a@=3%`bgT(*OVmZaerXFL=gDkACQ(M{aAI_J`Nr__>c>^o0v9 z=I&(Yz2?6@{#VcVljpzs#eecU+m1Z!%8M_1$Lrtz+}}U%QD;By_8)KmKY#q!*M0Xt z;;tt;<5^ES{h4PTaknFP-LdoEKJ~?q{@n*>E2|LBg9Eo6{L~jd<3VBVpa0k;(cC-h zc~5)xe}CQw-}c@sFTVVlFMZDa9&-Q1&6|F7-48$co(ul%lV5~*qzM3)cI^Rxy}R}d zx?ydsKIcyq#ThbyB{n%lDRMez7Dsjon{-FhSRM1JbCFc4H>hR^yXv4bqhJsyyMZAD z*oTS;kSd|8M3izSTh%Pl>VjMpVme(k&6q7hv$*%pcF)dcwpTSv08j(eEw-(YlNDHO zs%nwyO~!9YR03;(l@L`WR~ot0F7Ijg>{+T|GQr7~E%oBoEwptHOjl6bk9pe(&0eMF z6y|g)V&z(6Y+|IDf_d0NkXvjFxu zjfbSQpZvhLzxK`PIBY&(%OCy28+UBKP@|16C`yVv`(yzU%$1_p89Yws?GOX2EQHN0`UTW@aFw zfr@CA7CWqH)Dv&9uo4SHn+{sTtJbmH=A*T+QZQTGl?6K9W)X@i3Z|5{JSLY`QG{sw znrZOt+=jNhDnwqk?5AnDQmSnwN&!-6m%#j?d%e!rmz9=HZkF72t!}TfKZeqh`$1BaWnUhc>J(bgfP)o5vwr^thu{6k z8?V0pZ(s9QKf2*ZDDaVIKkmHOz2x*?KlAIKzv|nUeM2Yw`WLQRSz5XG1CKlOh;4V= zdb=(M03P!AQvu+rOD>nKw2j2yc;$-@KK#%heEoa>=XGz}{^RWc@X*sveaRbM_J}7v z=E{pN|LUb*;XQEGC0Bg=vTuC%%I}>2!M{BEp2z&%>)r|gzi^*>o_zYl4n1<)9k<-> z`%2NNzx>G8Jo6Ply!J){c*x^U`JF#~#RDIH(#fZtdgUcwaUJozSH9?w!w>!b*T467 zuY2qEA8ki~ho1hh|MrHLJ>slKUwQFmS6zBVgw>w#%rigow;%Y_doIvF&pz*0&Ux8$ zfBkpP{lW#8Ebm=$E!Fd7*N&a5%d0!K7tY>w>1d<8ko5$O^sQVP7UqPY!HViH0@)*d0BLnK9aUuhCx7yDvj}1)CQt?ECs!qsu{0KmmY4 z-{avN0RW7jCi*e*JBp4hv&Cmo7U?3v9?k%%P?0`;Owv4!K+Z<1i_neNKC*%SF!&<+!_S$Q&U1K`Ms7# z-MXj6TNTC^mHdq7cYN?PZ1oYj4`6qfhy=t$np7)jL{?aqSsGETszyS)TVB$#%(&*; zKX~TJ&v?&U-q)&1lVXs&C@H_<{L+tKykT*}sb@a~V7o754f=#2gSo*eKYKcWcfRs1 zH(!4vAi{jVRB_YQ;QhVn<>`N6L|>^cATw)b@=fO$Xm zQx2U%RvlWK=0V7|6WBz%EuI5(QSoilnM|u5LEe?ZTj4 z7_=J)qfLX+V!g6ZjW(!eu4?CNy`kbEp@LLkYIf7|oz(6aVtIpV7Aw86Y8O?rsM-zG z%qcxz>4l0nRC->ubE+BA$`DI)dS^Y_MtWC;r2(zXsnNV@hN`WVu9Y4rt`tZa=VcOi zhZ|WD2nWqv)X9aT^0sTO{k_@m1}gWtdnnqbsio;IioPq?VBh$@kgc4aH%Uk5f)vP%TKK8lhU^dP(ZtT3T)#5$X{J4F)Zl&#+Yktp=I~S`D;PY$P)Usz4P; zffS&GQnF%XLi>ryN0?*?dSE}(RzqIK1d$#j8W%>%CwcDvCNan77ClvEZU}ql=Q*iF` zTu!H&pK>upNY@eKY~0f@NraRj{*ZC-s97{it3|W19dgKz##1c-&fa#0E=cApq0UAx zdKJFfBO}h7+`JYcA!V%fHK6UGk$MHhnl+0SC=n$r0#(&uO=67)!J0T=XaZe!-e-UQ zrO$iBQ_lXvd7tq_*ez!qc*Mc=V6b!Bj+=h)qxjtYx3BuBM-GgQqXeX z`fqO(?#bG!|3y7!xaC zdc{oOarNuTbh3)1x6b9NMKZA0NO>on0ys}0Mqak7Y((6&wG65TyLZa&om!wEN~zk| z3OF~jBm!YE__orO;(@YrR3Ug;Fk7}JjkZQlK)a+??oeuBINY#->WT(c0Gh;(FbGJ% z3}$YKTg6S&G!4yF^;|`Yh?GNZnc7hL(nyiLP{S$RVZAT=vPY$9*ZB4(MDhd;^3TwsohW`hzG|omTS^M77ASi?5H=VG~dj-?y zMy~jn0!<{|{y?6Pa_e0hL9Gc&DPjeQ)LG&Ru^Tx60H$bOr9fm_=OUi@?Bfs-Kn!?_ z40DR~S?V!iPmro|RNiX*sLI^Vj9Ji9~B1&XS0sYYAi9w)M`hU-p&zpKq#7eD<4X7>GQTzD?- zxAFJ??p1N}h5Z%*)Pru%IH?|!XXVn)-SN*|J9YsW%!PWI{1^Az`1^nVXVaCA<)!89 z$%o(Zfr~!;$sb;O{e;@w9m3s#?(LBf9E-pmck$+e-bXqdVjvogMxxuMX-L^C#B6+j zLz%OxGmM*vNCj^`>ERmxFvu{Y(F*SvEiW(c91fv~l*@`FSmQwm7OZfqxK(ERSXENh zP?b`us)kSl42HwOU_eUJLS_p|qCWY;;pO!Ydr{eB_UB?Sih$C(u>ttI{HAETlN)C2 zBoSe60TF5>5bL&_rDf43np7>-t&<x8HNH8N&qjwxk=CU2@rO$c7D zvzor?^)i#+ufqthAI&NFXP8({vMMS3UyN-Rx3`bChDEXPoUOF-R<#aw|)VWTg(86NGYeSkp%G~xrocYSXmh@ zwIkzv}L>4K~z^i;GoN83*`LgD3QM zZ@Bv%SK0MRh{)9&+!IrpwR&+}Y23+-Z+KzDV|ehJph*U*(yvab@;} zezI9!Bu>SdKbp4q@i(GQ2oX1z(&MDg*1v1I3qXM1ob@h{02Ts7DIx2^%2@=O{DP$* z><#ZEVC}biotG|aD-<{1Q4uAz(gY&X!GRYM8GCpK7Ajvo#g%C1Du`-;iIudf)ubE9 zif(tWEbLDk_9u51oq9%Mj4HtE(p2h?)<^L!Hz6o^n%fJZtXM2R@4&Uvd&3GQk)GJG zDET;4Oc;*cM!JdUYnbsCr`XDoH~C_K%|%{f4CY94#auDKN`ypI#iTm>)0F+6{>U^X z9_Z%nb$f#-JO2$AhX0XUuqZZbtH(67c$`?|AO`rZ`NkBhvw!>sgU?1Y&uIgRZ%BVkTi zkM8R+cruo6!g38OEjCGlNK7jtM7$LuCA|o&r~t{UoP^FcH`xXxgwLTD zZ;NLMfl5D{o=r!nWJD`Iw8F76CM)k*5>3^!+w^^+5rIMa8j=aI$X7yup&i^l>IKq%m~}yYmy1r3#?9L#H4>6yY{U zbtqiCZm}Z(w%^Q-M_8eeak^WoV(;}MFO-5nLX6b=tf{Y`e*jfd6AxS!0{|7$g4WGd zcOs1lqDY)3*x2=I0#VawUgoyeD}zxrs24X^#v-ZroB&0YNJwlPoue_N^qi}|=pnty zY&^=CHS~*Cg_uBL3QjR6lcm?eZ-76qW5>;nXfg=};krwqbPjvRu<>9d7n%mBY%b;i z03xuU6>hXNjf^xJHg4n;NV)#!l2koL`I&+5;PIxoZAj!ntwcIx|Jr3p795OqQAO~m z*OzHaNvoLVk-p9AIG!j+%Ho1W(Aeiw2Xe5~;aLD6C4h!%1tX2ha9(sLv>&^8vLR&{ z)2;&F6Jy_&!@8{2Nnu*6gXvfOS^}kCr1N}Lb%^=(G@--%eLkezUOfqj-Be*XL>ntu z2yP}@hgSp$%zk61dj3Zdz?PdmrZaNy9-##>nD8cf?&ONExWL@xYxX`n6w2{gYiv)| z*_oTr8#aBHaQfyagXrCj`MM=cI^*|{!Emr~aih7dx084GW4l^pnm+FcV^O)YO{BfM zz*0vxQ}7${SR-9eoeqzZi0y_Mf_DRu^anF*t(&G&oh1R?ZOl>t{|;RJu?gY-I1UOku)HJ zxlxP8l{bchjcJpLBSjUmWv9VwPaPwq;D|e6X(=EUfJNH2wV<|X+P2lqzQzX8ipX_e zyY}YmZ~CeG9-q~6v@*K#qRRmM`s;q{@MDewNGWyZlg~c;S&s*B#rc<})hB>1KmT(8 z?sLlh?)|_MZ@J+oKfLDq89!d$z4Y}jd>O#6z2>Dy9D9^`clNM;KCAPzuecdEyJ6dXMAoX?~u1_UVuQg`Wd(^(9~OJ+r)P>FZzk3V;{C=4D6R zE0q4qe|p24KKAxg&py4|lVgH2bn^oKO&%*nN6n~+z(no1Fh)kscn#1Z%Gd^U!&Rwc2#+$=9Qqfx6hGm|GVK^lxivl5)` z3t3Dl<DCEds~>6zZ$Xsdg>&LP?~_WargW@#E|-O+IS*%W^w>KS!g z&^PTlJD#r!x}bFllIFRG>Yp+7@$)$_lya;otKbj)ql9b4D=j+pDafC*E{9@! z`p%F{TYqxv{KAIC{Wk*m<`rMN>Y~fzm~jx5cG@_0p?9bIzwreLr20w2?Vv$}_z0X(s`=<%XYp?ekww%o`|U4}Nxb=3;>X zmmdS(zsI=#ba4}=HCa&+2ESkS!??F0P{_>~=ta6z->d{=gclNC#dWcOGD{;sv|rv; zbh+(e5p&I~H5ZNYv3vdiyfG7*172Acl<8cfic)mu-dhQ+ZrEzs7~BV|F7_@>a;Nvm)L0 zGD9i5Y`OYt)5*h{ajmH`Pne$Baqtr?#6Q(RioCo1$kV!MxbvT8Q<#LLjnN{sItaLJOJ~0ARr` zEdzxCsA61j?#0jk&F7JE^$myW1-rIxf6a4$?+L&Bw38q8kb{mmq#2FA|Bdfl{NYbs z@ySbJAy?K3a@qNxd-_YB1K^9F3U@9 zIluGd7e3!_lu29vTxanN78=#qV+pUUr7Ym>I1Lw6 zEe6Zgd^22Ru0#haOaK{j=ylBquSA@qKm(TDi8#2{#2w*>Mx_&X#&ywwLK7mR1D#Sf zEUAHNneT_*E0+-E1}CnB*PgctqUn;38&>+XS! z-xY~B$GVY=mID&Hv`i&BEI)9@bkMS@luwvasjIRJH3Cj`>RmAo&_&_{Vdk&FvOS$b zl+Gyso%&!zDNH%A@iq>fdBRh>$@32BQ3b?LDSd90)nt2&2u7b|)~6yUdkei{ZdkXK z38HJ};cz${4r}IG*z!DKu+`fN#j7w|6mGl?k1Y_%bPvyUM?TCU_DpMKtzleYMJ?$> z70sm5&UoTkFMjRIM$0QNf82|9?bwwMs<{T!9?T%)nGJw+Ktq9H^n%)P&!rF4x+jxC zEp>oG&g^F%(?0T11}o`{s6$ig5j5YiXVNrEnC9UrlUJ6R8(cCLW^xHoN1!FVuBi59&dySXV)~_0xuOx|(9qS=UR_ zq(Vjs1e~}?x~1$@Mm;VR5iNpz8ikB&Mm;=h2V|jl?T-nm*2I1D7SzV=iTz1Yd@6%l zO4eZhZiZ&90@NmcYJ=)IiQSh?;Px3RjK(!sS6EzYP4OVYnur}+V|(QclQ1)T*lLtG zVy~-l`mLCMNj4dJLHNEO`qm~T;?ShF6`*`4xLNfx4?YRN7yk3JyLap==0&8c%KG2e z8fL`$kZP86!jo=a;;HomwC`8O>lDO zHC5wlzV5*r_0AOkZWq>8?S%F)vu<^zDmYQn8s8^y)ADP$Io7XLn7uA8rwNPYZa7dB z5#IE9t}#NsK)Z=jU0o+mqQeWXDT|bBu$BbiSaLEX+?&oq9EoPJ9uLgGC7PZY$7!a$ z(?GVSWd4-9^pegOD!&h3yY2)9M9#5h)bl<8#Q4L584m(g-Ux#M2#JOk3`JB`DN>|h zToh&!KmfP}JXo9$SzAhRW}wQ+z|Im1=py-VwzTD}rb+iR556CO3;zB5ZVVz2QB_xU zRhg{_Qd(=U7Use}cBkxUxGnvfRP#dO@Mdh{XwhN{>)SmWB>f&nR$wiQI@i6Hb18z+ zOy3)?J`VFabXY7&7qkT-*YG{6gB0USqFwe1+SpbBRb9=`tGX6J1F+G(+U;%8@Hb5u z66eUR01)H1%K|B+wijgl)RMzk>oU~SXX00Ucl3&xBr;6teHOvCH9ReI$mDmRvlPiS z&ab2$LlUu4j~3FFT@f=_jDuNdCPpPBqKKV7U(h=@g6l0XrEf|-k#|R&Wkg3i=gsqi zBZK9F zGqW$N4HNl5&XC>n)n|G44n14R-c&8eXb#nSdLN;Scm^=tu^Dm*!n2v4vi4Uxn0%B1pjV|jQm}ZK zocY9%a#T0R`Y?5mVMAmF8d8c-q?U*i#vrmopqxMuGiSfL5+G?Ijkwrh%@&0Pm)3&p z#1U~Yk7s|`fz4F9`B>m9BoeqHssYVysH+NsmH>h>Mpz=PfL#%0UYXTu3NX7gRxk!- za_mB3sBYHWQ({6w>6eu=60 z9_W-(Te`x>H1vEeG=JU0%)3i|r)5kOpSdr9@|(Rfrs9V$WiaV?H&eoV5kbe}8^Mwo z3biFy^IlvNai-+Cq;JhoXP}YuY?(EGL76{D&@bW zHei)aDxfs4IyDiTs}-{36&whq<)Rjcd0;I9aH<*-tClT@ba&-o6o_)s!E3l%ap=ragCfq)u^J6epx9T9;RSotb5UbLEH{ZEQMJRY-31o2Vr8y4qcCx>U`T%87`wC=+Iz*~)PG+KKs(DHA0^9O)D?wi zDG_#$#GN2z5#@_8r*1|3-pt)QWd0D~+F0OoBoWe0wz;ytNYBd#DFWs`9M)*r+-n2P zFeV3(nyZ?X)6*omIY129`{*!R&znX?s@1VG+x?%cg;K=MavtmL#7)piqVCKxZC_Xg zO<3J@o;g)4mRNg&Fz3u^7B+h(6m@cph@-o^1*_qg{}ZMNS+{m&T8d(I1!12o{1=_? zO7e>lYz%6nw?1+VZ96rLzKmbJr7#m@iX%_C)ao=Q6~3jpQ9uX@jSlThkEeFrH&~~Z z9?ZIpG@AvxPSij{#3EWVo6R&477UypGHZ7bK@HD?9a#=0&w0E1yOk)5-pM_aJUxEs z7rW9dr9eNDjC%7)>N!Q^adW36XrvKDSVXf{Eio~X*36o{<;|4!TwTaPQ(q;=653eu zD9qZvm0Faj%gya+ulImtXS$E(wUvt8_iXujoRWrgttDytID444ooVL(D{``Q{zMmn zC%ga2EHC5RhPLJ8xw@H&@LK>w2E+dFL@(goGhVi3CerqY9#Q+lxA*DKI%Vdr!vs5BV0Hc!?2&fWL?7&Lm&B+V0p~{hwZegO?jv%7!j1hH+Xs3<7 z;Ed``IE-fEOyr4Sa%byF;=xFW%s!6Trmh{q?@q_*lKnUmszB5-NE0blRRGLE7(1=Z zbR(ag<=I}D+c!$l$VNRMlbpCc43#>DBu6F&?~9Xn3{GUPQ(BEkmdS?viSj}G&`$ER{~G^hJs%ZV`T@I8;S2y zzgsNXh8zBB8}EUgv$Dq08l%A&T2)n1WwyMRx6AJBdSQVU7wd)ncvvx%qDqNqh_>t!+FT-T zigN4Q)Ji-C?h(_xU`z=ClG#-Us|mSd26AgOR<N6#v-M|Ozfvj^eU4H7^J zDseca6>3FTi)J($Efcem7rgzD*b17hD|?1aQo3WUo6Q&TM;;Q?Cmli-H#TZm$`PXe z>7>fhZ)yH_5OSC6_j(A-c~g!oIuMOIHJ>f4``in{TFE(4Ic7)@&piu{1O!w#yaq7Cl9m%|&z1zbJ{*CV56-Rxw4hB;6dWRco>r z)>D~|mKW*z3e>n<&m_Gh`PfWYvuI(~%uKCND-aeD#iGIqexsFhx;H2BM<6wyvoZ26 zZ*Z-5DD|_cTQM?#GCNsMQZYfxY|2}|;`Tt0)I~%&5QzwD%`K!6RaI40rE0n$9TxQg zQ?9aNw6!piY$dLJu}=(rht7*Jiv^9>4R<77Q>1;F#S{U-*vES=?I}wU)MhHl9!%@S z(Rkq}BrH^L4{EyCV`UXIwUaSusZB*a5(VpmqIf+8Vh~|rt)U58Yt5Re1{B$Gj}b+o zKZqicbJ~z^G#2B`lHr8-u?oH-?(~oejf24Mrir*gA_)a*99Ha%{=7 zb(gOYvNhEwo{i&yoyZ6$nr0(zV=ab5oLMq;Rq@1Ps>G2^;bfntso^FiT^OkiS5Kxa z3L#QtP9_0f?F$yM`fvh36#P=}>-eD@ ziZ=Ju8L6V;!&xUoEVxg&xLcJPt!~@4ZMD);wRRHKOu?E9mVUWY>~`a-2x?P-*2p@O zXGAg11XJ2#K2w8+Su;kz@+gWDT@7lPRSHceHfS#?Pi6?24Y#;C;O3H%TSS<3E3CK% zDy1l_M}+@8eDq@2o*FM3_Sk&bS3>t>PW%pT;u5?(FCo4e%h>3kAR6{g$=<0NZ)tbL z??M)R+^}c873HEm6zX`zQv5|+w<4v*QLiL&Tl7^qupb-+8LM=Yo-ED`D@L3@DG9oA z0kq?CEr^6zNQ=?}W;U80VG-fzq_uMvJ#JVFp??NMJ3f7p);LO&U~`}S-|S^)k&Dxe zA|+fT3VWZ+V^vF27u~JHRI$;!WU?l#dPusnruTeU3J>ED-)_a}7HBs`>ORPs>+}>S z;cJwnuQ8zs<$ms|K7eGeICANg%o+Eb$jZhHfQi^4C>CP?OMncZH}O)v(yDevFYR8M zo12@PQ-e7g%-070G8&QAfFeT_+`OX51R|?{pcM(w-=jgs3_Z|gF~&%$L}ud(sTjnh*ba_z(_uT(MGU^>UG~zu$KWpRWYayku1((nnZA^iSdzkg*WOhFGbt!h8R*0hSj_7%g z+>2t9Wu%OCoE7(D4>iHFbJDr?fU}`i;;&ouch&=Fp&-PfSkMYMa_l86P}Tx1_5(^z z>dZ0VOjK(ME$>WD4fnvNdLg?pr{HXwggbR3MJud#{w5{m0C~OkC%X9*{8^Mi+cYvr zYQ#HrHLMyev#AVo52)e-U4Ke)hA07KaqY&8OP-=2f{ab+5~W4h(?FsAQKpeYVnK53 zmaO|NLQOPqHnl>eLt8|wz$pXhd2VHSNw{jbZWkBS;^J^&lNtifxggrZ!(+u&vq01dgG_ik7x@0*|OxdeIpvI*dQ=9UP z@&J0${8`)lnpqQ^ChYhr%57~k&s=0t6Pcm32+27GCe4c3fLbBNwK5KGoH%8HT4wr> zsrz7>XnPNz?v)TvuJO%}`!qFs@l@Aa&AK1%+Ugu2Bi%vm>(jooD&8&^DO>lNV+*w1 z@`!hkGJcYkPo1CBjQ1Lr*ld1k!OdLp7V z6M;x+)~vO%bXN=kc9q-PXB_VmE6{b^smZgV@XXOoW1-L^z`5`1QyX8Cy)}v@{On%s zS+W~Lk3C$}l$K#;$s(25{Ni_&BuBl>9(h*v#OTc^8-sUy8I48)5mif74~KKZxuLjo zD3OBD;Hdb@hdnYIX41q=6A4J>Q%OzZyux;O5j9A=o@C=6LPSKhLfZIX3O(7C+5pi& zF255>8-@VMICfk)6epcKFg7lfWd6Vb$EV$A!yZ-kcYAE|39!|b6aUD8huOon9`^)b zX0)wtRokk{ULhIH$sBP7fjld0nkU)w|CYh)Ta)H{LQu9dw$Y;F1RX?crO*r~TKF8C z1h1xZd(3!~8m6+-9%IdG%yRwhS@Z z?S?V41}jBM2{UW0L8R=_G5CWT#cleT32k5J=Gf1EjrWfG*q>ALOWNJefsbqKS2kb;|H|E-CfW!*RZ^rtSFwJ-Wp zL{l<0IvihgCa4xkSUhR+3Y8~mRQq@Z1tFuOU|IuV2&V9YrD#%&kFV zhYjz-z|Ei0Xf$d@P&KLnfWe?fp|H>(JrdeyLo@C-OT{{|z zm{94ai?Qj}C3Fb(n4C+V4GXY1jcLb@#JjR^%QL_vyNg0b@5HQ`+g7!$BBH92e5pB` z%m3bBbe)4FWUOzDBO(#(W;1yguJ6fe@H$ghRwwd%?1Bh*JAOYg@py1j5O}-$guPkY zFR3r>aYEEp^tt96~oUHC=6@}c><|7B`nSh#w z=us!1ZeA0pXz^`2dDC1|&e_jq1Ig%)#`p@E%^{OY{2~^D#BRJ|xrpKwV-$EW`wzjK zio6<5V)T$K*<@~8mrj{*4M#D3xz_2AFr3;ZoGeNebposMNhB8%K)YGTAY~;~A`*}& zhoWrPDN&>cret1{-O{MGt+lS^>w2zsoj@ScZL8b1S!tV<*0ilsRbAPDnyC_{6e$Iz zMQPu1*BPe1`L<8g)4olrbw zEX9`G7wD8&V7>IIox-~n>?wcT+bmB%>Ea8p#ZL&Upb#Nrx@~;8H6TdUXjKzxg<64> zkyJUJ=guwxa3rNuQ*p?;m!Eb;F8`*pkHy2O7&Yw zi%VgKC7#feDVLrRyX&%ym^OLhzIxyZk^sA>J@*N}^(Qa-*4MuCl3)1!B%1sC*>8W; zXTmJo?%4L#FMaF%@BZjD-?$F(I7Jws0kJ4XB{WzeS%D0w9?+l?sl_Nb1eMgVyj4NW zl@1gEPuDiRg8Z9@KZfnu=GB>Q|90nsm>E&g;va-Cr z-MynRTFl{aI5$*-ff^16G^f=ZqpquZ!1X9vkOnq-1AcO5x*XrS>+4K0oyoXv=r~3g zQ&n*WYT;-kS=ee0a~RCZ1WnceLyLv4MvAbARuG*-5TfW{oUd9&J0tAfoz3Z*D>!ra zweIlu0vUc7hv83kvtDiZ}ao_$BO)hw3C3bNHX36s!5m^Nt`}oU>0@ zeqN4)zQJ2lh-3zu&8BwMVf@1V@eQ{CQdQLGx7X;`5NJk*d9~wh8oR;qd7$vFT(J@7ux}lL9hbcqM6e#Vnu!S@g z1zfjXvi}LIFqAIKK$6ioXKS7qt~sJ_4_8GtH$fx|tb`ff>4#H|`m?h!J4t4Pc;e-L zGZ=s}N9{dAD@${R@;lO*w5SuoH`MKuMW#V+-BnOZHBGZ~$Ig{@Y4>t%{AIFc*3vXh zI~p}B+_u^zAB|RY+t&4HWu@k&M(TDr91e!V;Q|d7JzGip-c?Dw2q2LPRwQ2K5~)HB ze~FuDb*U^`>##Q{Y?Yq^I2E|Jg#}=a;FwAfTZONPI1{*pBNirGQiZ)60@NS31oo%} z>RlW%LR^m0Q6o)}YF`c_qFIagUyBM=IAJD+ZJMd>tc>g{yJ!Lcat4Nbs-CVK%3fd` zcnZTc(M8f~s@~5pJoOfVx8)$QNZeT-tflO!>zE0?uE0KHf{AN=baTDKys zS%jfQGczewsY+|z>b8aA$YLn1gySHl6O8`LIt7dLO|GaZPGYT>!F06g63b6k()-ttG7AKfk4>%_rmP+{0p+%$tlr>`?PU&^srj`?ma z%~QlF);p`6jT`|i*U3haVeK!;G8++dC6ID?z<7-{gepIuPNbp|!2p3&K(dBUTg5O@ zs3_S5L!A*X3}s|og7!5j>p0wZ%V7Fd4lE39`(K!aS&ZE< z2b~W2Yit2xMG`bL@rXxyG>@jKP{BPBrYofP4AUyu#;P+}W9TnsjPxI@RL3wm6H<%V zlHNLcKA}bvt33H_Hd-AKFR4;7g@}k2HvVe`6_N8#V*VKbo9gPkQw6~6(e!TY-Q{7g z)hIb)gP;)>CmHz1djZH6CQXSJ-kpQnO`OsD!Sul_YSs+*cbc%gwDOL>eD5*G9sSU= zPI=1DKlX3m^qy`UvpwgWwYlwBK`R2$8mxh35n(7IrD#aikSc+I&DM#l9(nBwU{Ir! zh*9kRIBH$Q2g{5yvbjMlf=Nf2yy~CC&y)zuIBQFTZ5>k-0LqxL1hFdsL1S1cAo7`8$OeEE zg;p6<>?kKJAWbDvfxX$5{38#!0q@#7U@e!%!QRAerFD%Fe1VZfdtc=C8N%8va``$|(ZP2oIu|Yn15AnuK^B_8)F2>q5K)3IRhJ7HL@ksgx7CB%*V<=;zCY zWl50{FMx5Tckzk|>!l+n`vkGNHFl!wL<*=R)5O9^I=zyMHzj}N*^AiKX{<7dONyU6 z+L-<|+gDwyUPLUtGrt^LNjyZRRgF7thDkP)f6}OceFb8enyd!YPF}xmzkJ8`od9-h z-!)S{pS$3Shn{uH@hARN7U6({HviI#pZU;7o^r_H2REbU2jBhCCqDG)^FMN-nWtKW zMHs>)^`L&jFFob#C!KZly^a!*o3H=zCFfjp;eUKeL|4WL%$l(Aeh2RVq+fpK1J6A5 zfWr=Mo93qP{pfS&T=4mGFS42)5fFaq4}blvr$6=$zx)Tk{Hm88blAaHUUb=eU-!4q z{_Pi@@x(`M{mHHW@6~^E{kOhnTjU3q`O&}dghxH=@rN9B*pAz`U4H&&KlYCwY*t1< zuyX>i-+`N-^vln9z?r8WaM(d@)86#GAARep&z3jg}>p_X1`UEWP*acws_MLw2Pc!ePJn%S0PH}ty z$kce#D3aGdcoI>fncZz``z7x<3R)Z+GnQX067*n^oVemZoUcOQ05R*axs#LGLiFH1 zmMm6;$&#EcY{WsxG79k~sv)%jh{D1wL}YwY`s=)uu(>=%1m=!$Ya46)|AUA~8&vA{ z%N({gYsvy#+ff2C3S<-0;9K(bRHDhsjT+Ekq7j6w_$d|OyVD1_A^#S;Z_e7J5YQ^kzwcJlAMrNZ0EsV0W;i#2rP42ya%aKu&HV@;FL_jVq6T+##? ztsxZ32={D;l~@SLc}SNN`BY+z!dV2&P=EqKDOAKT*Q?m*{*JLQ>BO!pOF|+78Qadr zE$4^=Dj{d%3yIR^P%UXpp;IW9ybMk0c+<0Ad&X z5kyW)%0n#wM49`8s+Q7wPl*m_yZ^*TDy^~tfOVw4OfgCo+!NmDCYRDj(@fYinp!tZ z+wR-}VEeWmGo`-umfHX#F%LWAiH}r@ zwr#!h{C_#;NiTfXue|!@uYA_a;+U-Uqo4DnXTALSTW`K~W%tqnhaL2DFL>HLPq^1# zzw9;f5FC8Op?~!5H>9QC`?!WzPLT>jyhyORLf05p)z5AYN2!7i#X(!KyDB6iT5E1W5LMR|8PpkUjjZ)v>dA4fO`WX4 z?u#H3mr*Y+j`hw-1teln{S}km@6IeEeC-QVz?th4R);><3$qsNbM|Cz>j!G%-ZA~M^Ae*r59eo%q*-FJ?r^TdEi4%y8YJMU;Eo{`udgM+%z|Q=$WUyKTu@ z_=Eq6%J$3iUh$&MhaC9buYCI-U-j18etZiNo${!MzUVbCf5^{0;;M@-|MDeQ#JzR( z#g~8c@~>QT<=0>RfwvrX&m-UUr*8#tkDosFl(SDi;LwBa*s|5fWR?d%=8RW8`~Ti_ z-H!k~=#i(r_|JdmzNbI%lt-R^)y0?l20r%{ziLbW)3@Dr^A-Y~{HW7^?X@pE{pTKj z>+dU(ej+eS+( zciwi#gx<6$CfEqF-TD|WY&Lj=Rn&r1?Gsp+@=h|1o>5Nm7;mvyUw%DwLJ{Z0x z@qqfHY~=I@&h9pHUKVN&*U>Rfc1Yc-6(B^+T3GL5US3|_G#FHy>Y8d*DPb1ROl%Hb z2bAh5MVQ%K)@6cfNok9+6)Ui^I^J9#*O>+>x)lVqSpV)`l#Rb3tUr_^B)Yef4$tEH zRj#HfwZ*gLPvIQln6irH?z5nIOh0FJPHp|yo66Cw7>VLP&KzA>1g!u(AXG{jYjJ;W z)yjB8?i@g-HC@FRNu)bok1*YFZ+FrtN9GaD@jnX%l(+vpnoYkuk~el0_dd>JP+&?u zNvV$}Oe$=O8&#)WhO^}9B8E2gZi94k6G-t=^;HFb8pAVY;Ct6x|G1N%{SSZj&ry+( z*;X0=Y*^fI`Xf#T@S5NG>zi-dVhm(401(Jk7hm>Y|9lRB2S56ZsH-eXyzR$Z zKKU=_S{0SxlmGm&tvBCl^t&L4`&kitjoMqH_s z-h8}8;<%jGHJEKF`^hU=YJhE+*a`zel6{Jmj2@doj8eEg^=NI{^<(ZZ6_5rsf)=Eq zT2!r64XYK65mZC<3RTNcD^M#?%R;-gtU$HZU_{k2)3VT#(2~e5ExTEEGj=oW7A)E4 zSYj**Een=FOQ0peZox8WMOCeHkZQbGG0bfMBt%fk{L})?=7_%%QVe1u23h77jx_?# za^3f(RiBE8@o8lOvw5WmmC+abL4q)}J$vOWhYh4vtcVr0P`avlpxT<6s@*Ni+jP5| zXf&j@R;(1Oij`tg48^Dzm8PnpY6WVU)ox8YTeVA9ySZB8YMJX59*m@FMQIz~*kjnX znJEPSD-5Ciu-Q)~dp;~Ciju4syJn)vK*?kXpQw=hRkGRaiW`$Qo2A`o>lJ*q<(gm}4_x=PYaa(3a@1kI zHx4}fU{m_-TW*V6`n_*_2f)Ec9^%Fzbj%O0`Cj54Q~0Lu-EhzmhwOjgW>*nkU^X?! zb}oe>iX*Oe)Mo|BSve&Q)8s72c_hdV=93p)yKOA`?{Z|pisPlC5(f#==|v-$i$ll( z;<*&?%Z!|}7lS6PNN-4GBf8OmC{nd%&1_wvYSGLxL^Z4jP1ClIi3H~CbUrn$ z23xGA!}%d`JkHd?s&181&Yy$na77Ge7A8fiGKLcxdbccBTx$h2R0>o@1fSfh(&i&z zmR3uvZKn&nvt>RJWqg4UoS%uG7xs6&2*dLC3fefQl=t|*-PJpDST)67rM7il!@i?` z9ivs<)5Wc0|3_kT5@LdA))!*`(*Ox6?>Iz6Sco;002NdXMXIu>DsF+B<{1Kwzs7PP zrT^O~jtqA?JfY&H{L|P;!OpaaKq_2`V`#FCPAC{TyVJCV>X*4yOar~Sbrju}NbzuI zUn7Qq^q@Jp^AF`f$(IQewrk*AkPjx$`e~O%|CF94hw=<5rKLUQ{a|x1t@Xsy3?<+p}t2f`vE5R>QP zej9)1?SB>%k%dhgeTl0MOFMVRKX>og1z<2Ygq!GfZA*W}J6;{fT-an7>2`T$3e%|_R&R*Ab^tLsNcf*%X_;S>)S;r@Z5J~) z%+6^S36$9uH%{wVvt|u}Kv=WZT31?Y)>^l1YpbFE3#AvTTo@ zd8=K&*GV8!jwy&W=Tk~~QGVdTclGAcK)S)i!-Hby$RCHsGGhxN64+Y@0QtP-NWa%z!@P$HF<_JL41%j--D zJa#a@S+myQR;sEFvY41w2@-{2$Ss}c9yKS_Hx?Sj8V7ZUyJrIQv5Cm$KKo+dN9tr# zpf~`z{$rDGlSe?ZRM@($!KA~pSGJ_$7ppJaA=0+M5 zn>Fi7JDUKrUbNO)k)nzOBJL2Cfz(x1c?(_FScmZ34x1f)$ECzzTF-3Q8U#B~3uX~v z0(D11M67PuRs&XhY&EzRST}9cE-ej*!_oYR6zYLZ%UZK;4e(c7DXvW)kce`6p;Qag zGkF}UbybcddnOv^6UA{VT^Ox&xqv*~#D`PH=|0Z^R;0O!X-JaL&DcK6(QYZ@>KxhB zP7m^ChJ&d_YPRIXxam?a(%Us!Fn6<>I`;T73#u)OHXFQDEdc`BxgjDftXtMf0Z@uO zJ+ZJpxZ(<~JfyD+$G(t>%VSdT!nVuRON|MV4kq1cr>zUniJOpc7l{Z#Z?ep#!t|>n zD)BA~GYy>=_tz`bNoJ`iv6}oGd+5t%`qp-}bU(h~C(nNDOAP0ClfqciT7Mj=OAhPq zjtv_k0*I6%sTz>dXcz!)z44YmeEM&iJAcGl?kEc|fLL7gc0)FIONdh~c#Qv}mU~Z> z*}3UkZ~Vz0Jnbc&rl-6$cK>9N3H;Ke&Nz`vH6~0swAoc0 z%tf)g+%2hA)huXR9h)LEh)IDVnp>9ET5vi0U;y6Dk3apDSj20;vK-~o z^K#uncl#%=grvVMa|-oy+$@S`35t-gaLWXSXw=HN#xt(^ybS9(9Z^C{<18gm#7r|v zT;gC7{Y805qI?o5O=99Mv00QKz^qRao29e{J;4dIB<7Ar3d3EB+ryd?@iEzBx8E7& zX2O^rB{HEC2fPgJ2vT}X)iWIr>eq4WV14KJ^tqXs;YP81P)i}UG3^h15vG+~4?X-K z0K0bXh7%#%rUkHR|4nAHWfPIyh?;^&E6s3ju(-I;tTX^IxCI7-`o0giH=5D4U;b7D z1;+A917LCgjY1U(2s$DLJ(Y}rb0S1J%HSW)Z(L|bBcG2kDri<3<*bEt(*juBe^YsB zX1$htH@x2iqs+5DP1nbmJdU0BG?t!B$SGx(y^ywO)jA<~px<8s({bWEED*cI4`Nc~ zE>SaXvBI>YC`t^J*{b(LQ;47tL*-BhcVZ17Vj+fNVP;wpEW3+F%oSct6<5@Xs8%Ct zvw(yY3v|m`z@)^s%lRX))fRw)eFJQtm|c7*us~^{iU`W!=tig!Vj+mq;xADl5n_Q7 zsz4)=#@#WdKtq$3jGI?u${QT8M#7mpFWup>O2KO~Vn{);?}IQ(4k|i(bCSB&l`K_F zt7|Qq+4PmU!a)fM>{*Q<7sd`PV?HY?Vhp~w#oPsv2Up#EAKwxz1LVh;H&F85xF|jJ zY2vCZq@wKq&ML?==&<81nLv)KCew|*1@65RH+3juT1!vH7L>oWi(ncax_WqF%Pk~N zCMAHBJUOQ7@DMp|kW1^2b1)0FLe~16pkOvkG}!XC3_B%3q(rF+G3c}xrgV)5VkLBX ztwdzc72-yMsM$%g*VJGbeyBXG`B~`Xx~$`Y&tVvbPq<{&QD{c=t0|-_+Y! zio#k7j?3CJK^*dON4KnCmTT=GBEqe1o3?41#@q&H9~)y(=|qpW{zbIb_9#_|<7i%I z_svxcaW`7?2Cc1au4V{WbJI3$8_XN5IWG%q)~#-urfplTwJ`fOiLW=aUtHbJ>AniI z-Z>bslhpo>0cJs)V&5>gZOhImIg}Qs>Z^~fR2ZLCuNATKh-WHOW#Fl0_eE#Yl-_2a z>2gVlO@H0WaYA{1XVuev7a?T^GHr?bLddF`wrhMF)=E}NeYVcM=IH?J$uLPMg9S#h zgbo(*CQlM+1AT7mR39G1MF7tG@TUP{=C*BiY~S(KORoa(tAF-?4nO87!&{HJ&vAe7?l->v zBY%7H*{An)B|={~ZtK>+`Pqz`$36e4M;&)hlj`KNANr`De*%E7eCCU;pRv4q`5RyO zGJs!w^=}<<>^)3w$K2<*KYI5Y-|&%loP72}d-|;l@+j)iO%-9p1p zr^pB$9D$ia6V_4*Kj{-lx5~EJc~DO3h-(39Muauk(TYKhP1CSuvr{4B&SypVHRBv) z+@!N+@n@bKk3kRl_N>bp$61`}kE6A%;aHk=+qC8|nSTzzVcOONtu>cmH#2*v?TL)H zOO7#ZP(8y9iJh))-g|_YY}1+7ZdMQoFkX1Q!7llojj^080}g@l#pU+Tz4C(cm5U+y zm^}7w7~7yE&P;1An+Vb0$)!xu)3byL+-NN!Zc#q2QT;s~1NK~9rlDSG99u&H+)j&o zlY-i8t&yWP4%4Q)-)VvCttybtT#|^q=94bd3a!_SniM=o3yiH83yv9QPowG5lQd~b zHb&&|Kpfps$uJ^b3~|+Tue-P}V%!P8?s?n&jPI+NQYCs0DkrajT;VaM61fnT^}FK$ znLa$1EIY*QpFi<8fK*j=$l(VoMa=wHuloBNum5oz=WVZh*9rGM?zj_<{pa)EcE{Fj zRi*aZya~V+pS}9L4_%;aokf5TzxU%0dBn*NJnepO|JT>-+_4M5#!ZU=K6l|4Kk=ap z$SJ2s!hiR=e|XdTkH5$9$GrAKZ{2bGHdU#`{Wk&l`sc6u+{Z4kkis=ljCUb~CDhkB zqow7mF1qYhA9(ZDTW+0S*s!?YMgZUb;#a?X@nvN9dI`V>{_5TLJn^`D9DnR{ z?%1YOTDs{!`!{g=q#p?mD*(}H@lx#y^@We^ZFk1-o!N3VUtN7Dei4(%=&=CK1ar+H z%fc^XTOKDS2a=@`5fw%5= z&53-XmLg*pAr%_oD_m}7_MEaY3A4&tRgpP3>FjK^$ci>mtqVH_X#uR^sxl7+V1{nF z5#p*caT-Bm%nt+&s1*a#MO9R*%3$2cHr4g1JA`112n>tJPxnBqoK81r%?N&b zmmp{xUS5{EuIsu6l%O_;-B>GOOc+VU+gg#bPL&+Zt<@g;k{rx|-hG-oMsdd1mH6v7yI#wokYX0;?|6-f*6 z%gcDogJLQ-8^+}(r5EHS*B$ERPDF)1ZWuRp{dli(5yiZw%oDotAvo@V1 zk)cscoztssL!}C;9h<@rbyz^zd?Z4AWHTU73B6)!Eh0%@0LDy$Z2d(!52^%)RUjbU zEHfD;o#Lx!X_{D@eKN;+C}7=~J6d9=gvjYP9QL(`E?lMIZjcnQ6bpa^b-HV;%Q{^Z zG;UV+vFBB@?Y@M4DAb)#7?(-n{h(+RZ#zypCLY~Fdq^3T49O^papcj50brJGcWnRa zm%jOdcYpMnZ(Ntf|M87K`IV>r_AkBonWvw1${~jzw0r07Z+!Wh^FMOYCqH_zZnXkA zmLg5l{LZiZ*)yL1pZ~-~pFj6PVJ6GRoC-MJkL+o&*HoSV{*Pp0!_=Ok!|)Lovi6y4OU6SgfBZ7HKpP}fy0bzQZjG@^ps{AI^d%)t46 zj5Q5mOp?(_C!QIE1PxCd&KT7eZCDGxOzld!PO<8|e!ag=hy;)DkXB!j`PLyE>Mqrk3-(NGF1cQ%_DtPQAD1gexW z#tTja^?AeA z^IXWFX1`Lz9Dxp&(s6a%087&Up|{ud#F!6(KTZvQ%PLXiBUecH$P=HI(~QnSOpufx zuyn4E3saM%i47*N$%vS}PwQM^X4dEw(?xPe9xG{U=)qtx7z`E^ZBRZ}jxhrfj9<@a zH;Eh<_WPaoO{?2R>$t6UTeae9n$7x(R7J`tTw6gaq?A%hEw{}|+ggRBs#H~(x{a7eY;P41 z0fW3Dm`AKk{(=usq_GeZfU{2WeL8*T^)WnCB{S0!Q0qXOxcO|dVPdg2$jZiQu(2Lk ztut{8>-u(aFkBc6jXCasc%a1ek3@&|2+CgN5ZB8rqSUPk#si&bbgMyI58L5jI2aCW z2eYuS)|J-E{DkGYp2(RcM8=5)5h!Jkf!cy_GffUQaZi7a@8`ZSWsAn-GbV@Cl}@q$ zj%*h8KxgT^^b)eC&lF{9Zm}}_fNSCkRb5wgEfq=ayuSE(?(7?Uovpr*5VWmCasH+V z|FaBgdqGmn+fq>Lk}6h3Et^YYxvsH{GNx0(?~4Z5xkuDQ=IU%V6x`S&BjR)kn2v)5 zwN@q%^`r` zgWSgCFl(L}s4Zz~rz2?&+*9(?za2w3#%CYJpH4(bY*i>47hl78$-wPm+9XlE#cq$X z2E-bsC`F3M+Av!ANsQHiU43@$Mm8H{7pk>1vL5Nvii)tCgOgMpA?v zg&et3glriKIr8P`|0?2hWz3J!%-rs-+DQU3zz3L*{ir(Ubl>@gGxzkaOeUWoumFM} zpsGcS>)~cl$5dw7tOR}ASk>Fega$YI$=nPJD7VH$&6g?AOCGRE{hkn;Y!lrw^cHCZ4O4g5C&N+Rg zdUphTgK#km(G07y$f_#V6#xnZpQ9b)GK7W3E_N9F9m7)(AuaBV?Xe$K@2;ynEPp?W*c9RMr#iVuA0|U z*6i2SSb^nwXqSajsxg8}+JPZy*2QB4v+5E<(C^-@k1S(eM?A`8<}PdiAGlq99Z zW$}QABq>s~s5ayhI^Sdo1DBjeXc#+Nh9}buvkrJ#0;HO0skded?dDU<>$#+zaFJ$c$qaWjv)N-@%C>i36J zE2yn~83KD~w4wXmFUqQFbAVFkf!mGL16UhIX38+JhoC=b&k(lSi?QE&=NFdy7TRj^ zu3VMA+|2AEB-0R)G(yGttqOIyyTQDZb@w+Nu6e<)r7Hx@S(t_efU3Z#hH;3_geFrF zy=&Hvq_KJ*fmTc{o4zl%f^Qf5c2yCPlwhh_+Sr(BIHkuUDn6yzKH8s=3O^J}ea?#c z*H8Z;`xU)(><+nM(qIopBJML*8S1$wrwbaSxb;O{4zinm$flpN@5i(dR8={xCIfci zFmKzpmh5{GER?%6ysF}E=hW+g=2T!bzfW;h%cy7H3a$7R+@=cC1%6b*JkWKEi|v-@ z%?^IpCf+vDj-C^JqYeftqzJN@pwI`;D3-;N*qTfdWf33eVyY-2k|fDhUWRX1nT6F(uaO{cy=l}eFw}PJPS}>X%sB))B=;?H>pdEnPnY1l9kXQ$l{;YvQ zAyXqDBhw>q1Ns=VFkjroN{h*jo#9b6r-B8fBx*8^%?e*T+hDx z^fvda>BL#$8Huq4Ctrh}2T*6c<1@9KgO(S^>P7d1nLnI-8x1&&L}t_XQy&5j#^(8s zm&Qwud>frY5y2w3h}(WF!54GQ)0Ud^hi-g{tGAvJ#pDD!e$B%XIp=)#-{NP!qBjUw zjN-07B#NMawI|S(aay%ik`hYO0phlKRKiuS}d6HMenmXP=KBmx3GO zIa)a43D4&r2gQyxw!dt8fx|gP3@C0*U8^>8GcA^3Dw;IG6;7d0Jh+mB9#Qp3Mk3;Y zjR25rXB`bdDaFjRlw7%E4Z0}eX3tRY)zT$quEW|UKC^SbGC1zUl3^1#>c2{&FdfU1wcxP^sp3FAKB}X z$2OAxpy`Yy-v!^#jL#>>@T5IYm3CLE{8@AQT+4rG`(n{UO)@QNG*Fq6RE4~oEztHR zce~)N%%M3~*%C&-BE2J&b5C7p3%^+}Hs&wi5-K;-4_nuDz1^^i-RS(BTKT{9BiHPu zbbdu^ET;nidr{S_P3($28mAfXl4zC%mq9t3wpx_ML~|AqSu7<@*X#9ixpcNu)#|h1 z>9tfAOW+5xtT_2U6hbsmJLc>({X}8<$*PV&t7^|inPUrMVlb#`F;!6&HNfCrEUAK8 z0D!1cRYaC$>2Q-Ryha12>i;6=exE0RMF>kS_)E!U&Fr463=!|OkW487W}pYSc2Elp zeNIGDs!v*h-*j6e+}hXzbg=ItbiN-}JMZ4O2?1FB$=t9 zo!)7!3)*yNWF6EN^dOL;S{>q;l&J{*`Jb34*Fyxn z$*_#6um7vmw>(KxCD| zWmtBNDA3hzCRrARWQ9UHsMQ+9kENa)R{&-ZCAE4JYJn&pivvSQ7Tx zwHUEE0~cf^5#KN-3q-XP)pxZItJ^vvCW;%FnG_<`f7BGdf9y2s3|as)QrV(S#j{Tl zc+KH>Ceudj;=x^$_n;oZ{iH>FI3EYL!?M`SuKU7k4}Iu1hGzrnx`5jPvQd$WrrXUH z+Cp>TaUm}3IJ9oyO%_?8p~kMZIkgaoc$(6qKmxx1=GODx-8uf16?fxdv+;UKY@LF6 z1Qcm6GSbHic`w&*d|Og21&ZJ|AI5GTkkj-@1Ieqv=;dlo*65v_M;PP_4T$B~v_>B1 zzfxMFurl*sMRSoUG=o{+p`pxB&ea%CuwhxXn8b6C(F@ zF*d9X&SAP{Nfg#C_yS~)T%`5N-?~Kvvucsm6=fBc>rxW6hU=x*Q>EJMywHUah|RP$1M)tGE7=!}S0FAOJ~3K~$p9THLAynp0l6 z@&dWKenDmFJI3A}*6ZFow%qE{=kA3E>C^56-+x`Tx|YpU;b?nvW6`?2);Q%Li3B(%B>iJ6&z7Yl=33RSZLQzo^gmaL*vNC3=tz0$!&gGEbB#*LClnFE6{;3 zt01nvOw*{52!ZSl(`@(MQ2HGK@!D)2>F67KEvMYQmg%#ZCSPa*fqocB8#VdBXhVAS z@DoX(PzofYWVH{~_jVY_BU#HXW1b`;9$f4@qVUfSUoU zUT7DZBuNHMtrKK25OpSEQ-`qzZq<|V0QLASPRNAIRLr@jza$4r~RYD8f{z5i^K91CG5UApf`JB7})>W1Cc=2 zZ0M5R3QDLMi$P)3$_o-@p&tZ6-4nHafxS?4#M&K$y0CZo!2NEc!KAhTq$ZYBa<*)C zGy6a(R!Ttuat&!z+%#H+B#1<$h4VxbmBpIb#xXhk98t@fI$Ot0j;Ab$s!4kq7C8S; zWd@CR&4VT;$xF0o1>i=+gDW6oU_$E0|Q`cB^MJlp*w5V z03ta99{Z_o(W)8MExu+&ecvQYPC~zC%3YEMD!M;cugZh3rO&YBAD`kjbe~@X%#>t9 zIE?wtuZ66J2sb7c%~@5OXEugn-TT}(;U}Uqad>1C9N+oNy30soM81D_j86X&$rXXd zZB5#?z9YW4{=(WZgOywg3kyh-l#-v63|Z%?a*qUGxv~0CK1Oi6esHV_;4M9N^~I;Y zZd_K!=vH2ZxeZMV)pX74x?){xOk%Xo4iAKFyM98tx7s>p_y+LE8V0lLD^?GkUhZCi4%U?e&ju#E-jG;tUf(17`7Rannj z!NyL-nIX-vvrIr|uhl$C&*#6N^JRY-u<9ceW*nZ+0?MBw%aq^Mu?*!cc+nK>D-R04Wq@EQ$^mLBj1(9 zhv09QXZlh7%d1ti^Zj7aVcSCp%gU+OPZ|5Iz?Wsg<&xY?>Ozr}E+~Sb+hP-He}aY( z5Un=_9a*<2N1%s_S!o1)83uB}WY{1nVrseMoS8E(mqjF1f#yOK!xQK`p`N>}?MJ6q zG~we_x>*4C!R0h-;m6ab0$xt7{1-C!w7-P)%dPor&VBnCETH#GILXsx+PxyGH7Dxr zTKvWW6N=Q+&l4m&DyS~c(WWW0O&uAY2ms*rp!GfHKgzn^Znss6NKW)C3rvzFt(aCI zeMwvOCIdj!o5tF32tW~-2Ba`-3XG%w1mQfgMl{oLuWFYXo4Qk-#jI!+G!B2OA-}A< zLo`@WaZ8=dzef5L^So=Reb}|nGuZ9s`25EVCpU>Bu7)4KIw&IAmaDeaj{R`Fwh-mA z`P0-;N_1UNeG_>*5biqJO;b7o9oy9KM#xpt6Rd$wJ$#Qz4TkCRTTE#5`%#Cytz%); zq$DDlG{d!DGHoC&NvBy}=X1QIlQDDU&Wcz<{ zO*aEY_2xg?Enhy(s?|x!|7~&OW~H}NYVEDofpCt~yb2K4uUi^{aj{%|&t}Zk{YV}y zgZ^qOy5{gc2U_L`Q8PW9z6j-8SLT9LXbiLtfmW}WE@#b*%%F+DY=tT8Lq%4*5En6_ zP~<{f#2Z7JNxO@hEeu5;qs}$h5bn57*eyLAyKjvbxR0n-vKg(o$ySPf&XZU!#( zH%c*G&9^$UVWpJiQhbq;AU)h`L#`f-YHq25giK&*L}G-YGt2^!UameF>Pia!X9 zm~DN#_t_~mfIk5wkWI_1PQjy-wJWV5+d;NF>d-?A$`fg*4ei0PA3Z`Np6Ba_HJ&uD z?IjUN-j`yw`n4LyY|Jo0bze?x1zNxegH)7~?MpqTBshI5zt?CpzIUD7Vb@F_{*SRZM*IP-+Z1EEu1J}aP5I*}DY^N%shG|mntgnrLe8H5_ z@x~LGz9!brcJTHYzFybo(tQs0lC|~e%unXq+A`0FXB*L{R}`ottiXw+$C-o^TzlXC z(0C~tsaLL1jfw55g0|i1A$y|3ebqU8U0#ft(a09(m0Cd?%&Y)~C1(_~)pSKET2#wg zG*_1}f`EuokgDO+YF~YAw^eVQ7xiS}c9sre{osmB5m_R^lAVY2@x&&6!Rd&Ok*Jtq z2!zdNhQU#QV6r1vuiQ1idfc+z@_M;k@y(9~2&|wx)QLiB411+&yt+#2w3;5Z{W%=? zOnSW9?evdF%0W$!eQGyc^O>#5pOBhH_zX{XLJ6QFys)6C!0D9(`>|ey5Y}+0f7I=7 z`^_Eu?agyIdJXI~isnc$ltY+mplTn9HfUACz+k3DS6ihRXpPQQ zXa}`;Rr4(sb-K0&X4)P$n1K)vDdtal+uJgZE$&IRtU2@jT~+-mUBBI@J0biQviCe8~~0H>UT}SK(gP%3=43qeN|L0 zy|I$`Kj!yJR~Ngi$g5R%yK0d&RVtz47a^e#g??Ra_k8!Fx&+-BWCjpy8EksnHtVMi z`0ArDKDF`TY&Hl}f2M2z_vkqYjr})XAIGC6Yg|hgh}JvFLE6X1yZ&3L`h}>m_`Okb z5xG!0s%iKKX4ZLfP=lUK&rsa+CEn2no+Rz%l$*2N*5!K)t_bI(uHpz{? zRe;V0#twDk8D_VfP0O+@m&+oA5bcID+YQEcT*L3j#I`N#zE{tAA&+Io+4~AKPCq|0 z&E89uRW?uyE4k#7D;`oLsb0>x=&C)g>a0Zt_SY@(wRix{u^}k#22cdmafF~up|%ID z_P@J#?d0OS+oWAihJcN6HhnUErd8F} zRaMuVzkL%C;XB&pg&HGFD1!N?t=egWd zIiFVm&OZFaw}<6D#q+saTH`lEh)7>`AsWl@4fVBO&~_RzYyr-4yT#GW;E~!((Hr!` zN@c#P*|DqjkXrymMSPFejF53fLfd?4^W2!?JZ@c_vhBdskHcq}7@38~2u{>ZtcBvw zXJ~_Y!q1&q=9EfZ{f7yJ;_ebPBqFuIt>yxf@ORI!VKHrOeEI^=O4UafYQ|3LL=k9X5*GtXtNh; z{eos2%1DEVLkwTZCD;!j90+Tp^W_`uiA-d0+3 z!w4$JZkrdJ!t8b%c7N8#uK|*d$&9eNP29DMx^z3+Eh1SiIhRuMhw~ zKw6C|Y*x%S!32Pg!}OyM{X}3TG&G0R8X(TvSX*-@XzY`l(eItB{cKFX_p?vYex=M{ zI~F>|`WRmY<~>P*2kD@oQOle$VqgQ{TU}%GE1*;_!Q5+@0GI(KvWY0N*-hPQ%L}-0 zamFpa^oDTK*{I6e%cvKrvQ9$9<87F`pas~2ob+Is!=r*Eu)wH=R`6~t1($`(MN%>m zA|){a)L6!pj&b3vr?HRV!RVf|>5==MZWo<=gKO4Cln$n676-32i{K1)2Gbg10^Cqy zXhr;X*T#-D&P3W?mwP=uPub7c6uQg#Z-3bTV=YghF>Ib8(BNF`{A*Kj$ZUPn{iq=a zG!n$s@WP9%Y0NtTKU)R#qnsGhVu-qyo8oa3EkT8nkOgWqE2>(dtD66I#+`uzGs1+* zq)93!<_OtoB!tygJmEuB*RFXIC($*nu(+LycBx?G%AL8hoyZ9cvfsF}t?mrbj3!Ja z?Rn-dP3wRig*F`li1(ivQCbX0QV13)tJ$rTcTFj!RJec(Wl1R|qZ%tW_O)N>ENH8f zXGDBHH+)=XX4BM6*&a)n6Efcu^Z`TQayaZ;=5x3j&N%2(%pmr5rUV8$Iw?$S@Lbz2 za~nU~e|IhA_Rlb3+K;Ol@&>1^HnKhveJj~wOWEI7s9O0j2%ybjwx(n{6JPe$2BU_ZY&=#P=1)&kFwO<}oW87`jDo z)Iq&ZtltAbf=!1*#&Ms4&zDVYAW${OHvc|@4LNET&x!>|#gZT;z6syN!@DOjP0bcW zWI+wu1Ebn3km@p41ow|A7B0KA2@g9cv_7I9&S8OFRLxX#v5ybCTzI|8_06ttAQwsk zRB?Iig`*lJc4F^9&`5b9w-~rrA-rLHfu3@4I^OM0r2UyZB2DYjfmWE3Ul&M zs*LYyY$itWdCWFDD>+NYg7!H}&zx!Q`<4stOP(j@5KJBx9=%^ra15t_8ZFh@-)ZX$&+bYqxVTk&BfARjg(!OE$k>ycBB{ zRc^ptQ}^9r>-)?J@2NiA{C9dWap=J?0BngW{$U1C;?0FmyJ&VjEdrtkU$n(G8Ip_* z^wa%fLrYoX=v$F&f|N>1N!}#A$@OiKw~I-ERKMhcY|Pdvvhh#ACXxsUVjNV0Md8v> z#(W-wIB{V;l19C{C&sf$%445eJ{;QbmztN`Q>+I8T|G@V_tmDS(|7cjdZnmH3)5%K z0mv|IU*w!WN?w+vx}>_PN_Tk>3Dk!cny};$imi82iJI@K`9J~5q#dyijD z!>}+^@)wZs%%<5sf3S8QQsnpRi z9rOT?UIMM=z@|>Nof4q2_Ua>BYIJpvMqO{Mt~Lkh?7uf;L!kF*X-I*CovYJt@A&EL zU+us8Y54WHozVh6zds%gYZ_z&lpcq>+}4tF&UsyzU(>JGUoJz#3~+|dFWE$8XI&i+ z%ws%$nVl)>&!kW5>}F@t4<`N_F!nR)l_t263}I-diVufk><>ODdGq6yR!yqMT^gR) zM-2b@!@2d=?*ag5Rwy^QWRs6<7sFL7EwV5r*wW(ZHRsTZ89CfO4=XVQf$z+(EfHYc zJTd$afvLEt*!7(ZYd*@Tfrp1TDy`J~&9T_O)n>Kwh*r+@6{3`)s#-Fb4QgW5223gi zlIT&-DCE0hEv2Z|`x2c9t#>uF)O&6xLo<&P#?rkv^Dpc$e2=u}zx(Qkk8gN#P}Fy8 z6Jl-g$Jot8+q)V5$91k7TX3s92ouv)af1mYnO$gC`bK90x|bR2RkxjgSho@4WUF)P zagPjK2^Z332WY6IC| zW;evcW*8;gd~;BkZT|?mTb%W_(!7f5^kkqZ&^;!NZfsRGEodawzb;ax?rQ;PjtYcO#WK{a+_ZcYijav= zTD_ut*b*GpTBm|h>D;t=|6(Ud*bGS1i-(i>aO~$2PD6UlK&?KB^8FKF@vs`U%vz%;l3$p(jtegWt;Og)G|4+k3pX`>7(DF`O}}7sd$XlVpp@A z>>|7*xnP2ktoPKrl&`qfX5Kq>(Mfzb(wpPh<_%C4lQ1EHQ#PH)tZ_X zGpDMgB^hZZs=rVmNkmdg2};xUu|W$(qy~6a&P`~ohybGh4k0!b&X|P)D4Xo=Z6^T} zE8-wmv))91`Q@5;Aqu3xRLznYQWY6)$09}Or^i~H&fd0TZ4;Zfn+b0&yBo+p4vi5O z{fPq=g--%w;&kBbj0$YCh+?Y`er`3Y{o1h^VV_icp0<+rQTC~6Q#0<@((u|Wv4i=n zscYe^-ko+e`kYjmV>M#>lN0xyWY$@Y)+e6~eqOCFu5QuaD%w_u>ts|drD$HQWWPeb zn9@vIX%0h20|H@nZApE*v2Cq%1?)JTLCpKm^V7g|^Whz9?k3OYY{QRQGx+2XS8<=G zLs@@Q1KsUbHpV1m~}%6acCUQUoF*DYXrI_edBUyN&c`T^>Mluj#ci)-zfYq7e@F0IQgE z-_+rXTPv^ak1(V82K3F0W;L$*)uL9~0Wxi~psEhxMM#P}9t1~`Kzd{2;O;`2 zd-0#?J0zd8hr`{qhH6QWJ_%~ZQjA=o31wLpxZjDmR3G8_YE_?3l}ZQi9{*{~zZtOr z$KP6Rw;N!Wt6j|~;vscrQ&4yR{r)=7)YSjD>AQ6AM~(i|=?TX3ToH5HsBXmY=$X{a zaAcxirpfS@q#xBbRX^aBb19{mQVVN*?@2IY0Q#+*B5Z1}}GLj(Y`^|t=~?|QjjmdiC=EnS9G_Q@PR2X%1l(^poz6=}nZ9=e8d*3)`P zhv_)_!CYVeRq@9Dyf!)>*!_M~xEpGZFye_#tE1|TzwBA7?l<7*s|mw$whC`7!CU;= zxWq}z4;S_m>A6+Wu4(1adeur%zZaWHQj%p^L7Z7- zH(0>W6^2)8+%33g4-gE}Ih(QjGxDFS#lU76dAJmSuq@`G;qL(}8p8&f+may%&Hdt;av z?OKhQ?i}#8XG`Ww1RCZE3?>jp+%uyHU97BYUROV%kYR~PHMhC7VHkiN14WQqvDV!5 zM|$mFH+6n8FXSKIn_1FsUIB1}cyNpLXEtG!+j`TiZ~1z?mNzcxdTG+%)KuC9lWbI? zF7dJTo_{iZ%Ek7DSOU*lYJqM^@qK7uw|e(1?!MIc+>E!G8cfF@oD}w8`1W7zM%;Ek z4!?Vx9?!~IV{QLy5`j^<-GXgTJEXuoKKoO5A^S zo;F!deQ=NHeYa38yyz{w6Q6;N$k;A)Y>1nf*(b{f!R0pMG}zw&i9(v#zxsm zA19n;;W?YRq2bbqAP1?}yo>o}pUQeGW~E#gEm$roEkxBHokCj$$1Sq>GeZ8cIA%0F z7sK`>Qpm>s(Tf{DX6S#+!=@;>aj8sAw}ZLolOpc3cA-)GowQS#p0MQK5eBxO3LscN zp5hL>x!Yyf56SRWv;&Q1ib~guwT@u>1d;pkrZr+O*|hj}S1ARW1qLwzSnro7=r`s9 z&~X&Ffo;dKl?S(Kr17K|uuJXC9c}8fMDsbU_7y$(^>heJ&QeoS#-)jbp&vX!0SLRH zl=7}+z1^-Fu*Bq{Yu%=%?Io%;>?L12ykmrW}>gdRB3Zclp=3+%NV^?iuAb5Prx z8t2I>@yBj#%MHKxCgUktTZe}vbdRofU)-VW2SpuxH6elHLU(K%7*^ZoSHuodJ?Qo} z^Yo|diRPln$F&A&H8cBA&1#F;0!=`Icqgt%5b;2P7o&$m0wK-?8zXLxC!IIPBb7lg z4PILbz$(3L+ioBrZpktVD8+Kl1u02d5O7zw!i91KOz`!nmWyRYQK~ga(ROk>AVvk( zV>e;o7TZ2K4COF>&HdTV#L?R`N_ql7K9y=Y@q|%tXs6`R2u>rhmyV}IICdwWY|_4j z&BuXf#TB>N5}8f4>qCg-JbqnmU9%QHDJE$Eizu4_03ZNKL_t(Zt>z4BFZgKKj!{qx^HGe0GjuS94sE53jVGDtWlTc41|Y zoAlX*+WB4R!r1uVX57^>n>Y_!Hd<&Tp#H^J^_3>Vrtd(v(Z8Vm?#m(0U_GmVyxRKS zE=@3)2_OqkFL7kN5umi$*6xSfFJ(;4*KpXMbqqoF6gbtBK{$3WbGsiq|t zgQ_WoBBBL_R!Yew6GEtnaPLSk`@FYsAziYw*W2-ake+TRRf@QH?fG5bXQCu=H;Ghl zld2Y<&V5w1Xb;8&(`o`JxvaU~c8lGH$nevR?0h#^wy_bMu}QR!b^G;SIDN^t`!Aff z_%e3V-3(CUXcm-J4Htk&(0Z3g@EYF&)#<=)U?me#4Q76*4meVrK)C^C9;<=EQp(5s zyMbz0mSwqILcu>TnQxT51|)t!`m^f?HY5LqKw}lnKPw~;gw>bj*S75)%En?j^!~ZJ zpw(1|E)T`!KD1_Ln#D9VnB&de1r?2}!#n_AdoX$F`cks6BJtNCh<}juz5&Qhs$&)tS(XR%nxoIno|ElaGy8Zj1L$h2m zwTNk25<#VEK`Eu=B2a+I9Ky8#apG~uiU2nq| z%8WjOUz%&~=lby3@wW(!_od!^uNA=KmQLuPDhbBBL>xceaG6Pd9n}^G;-qg!WWAA` zUFq`MrzXHrY1QFu4e4D5z7<@>TF8tlB2HB!mkZEl$cUcuepI8oHH5Z434JC~uej~b z5Ij@h)`I(tN5SK>3g0iWdwWN5bpI2#Zdi04u&u}={YJECLdrR(ELIx51i9}7QV;7s zl?H|U1eN9SK{4CV&citl|DKi^GCxlUPXXln^*&SCkvq~T`utXkwgvfAk6xWxXa3K~ zI{|2os|M;duypE7R8s}BAuBSGjRhZTO{Fq`IL3nlqs0)zWVtj3!{ie=hOnUQ`sekgM|InOdPz z#8%a{ok3F%z*o)Ftg#Wgs>yy5p&juVbK0%U=q&NbH*Tn>-5Bu~vW4Dn$^mx#TtRa> zr^&-N7VS7uAQ~`E{sl2bB#>0A_h8PdrU0~*%axbQrEMx`a7DmWPixyWcbvA% zC$bDK0j=p%+h?cpI9+ysAL0O4PUUb^+DqPB1Ubz=nrd>yVSn%hsCDOOpyqh9%k&5V(NYZ)&8bhBhA*UzEsp;mi&@1!pxGIuy-=H z+to~W)$F@`ZAj{o&EBJ7Yv2ZwejzF2L4vA67*;AxE}-9tTu-S)-Kc@o7$JFP(%9!dRewH}0!xnRvHQVpNo|YR^PtH} zalcG5YX3Vme)IgRu=cqf<0BXQ@$$3;_WwPJonKB*vRkXf&56Ve(5jM&!T`x;sE8KD zsE}eT%Bv-CF&K&_$RZ*@a)#xbmSjOGt*1f}2t|a<1*_U30xo{)+Z(ki*8)of7i(rK zgWOC$lu{tHRgocTG=&Jo=yAM7kSMD$D+Cl!Rf~EoJ?nKq#8+xV@*S&IfZsM;ck??~ zZy&1Z5jUB;p1^keepAx(ma)60fcu3UbmAzTE0EvEhvvNA)3x7tQNymy_D~6yT@qIj zP7I2!nuZ^&j!kH_X*f6O*sv&|O2{G<6QL}$gsO7IbNLZ)%tC1f3S$$bh3A-onb9L4 zvu*RTo=Q})A}-+l<}oc;SN+wNB_+5O87q)$SzAFe+Q8V(My(c9hCPPtWiU|iJb{sK zD-Ke(@J)rze3kc=@2!83OTs?%4apfcyV9OJIzUea?e<$LaPV0e@I zahwi{oaBW~|7|5;_x@ggZ7!xy71`aa>$xr%%nD86=e}|_KL@6&RwW6^rLMwWu^C9A zSXF-NiO1)fh3iADfTQ5_i~S8o;A;g1sudw#}32%Pqrx z*ur6Z{)8p?v>n^G8$@a2-LS`xoe_ty)+|rmd5L2>x?@m|DD>ci*BkZS_j$jP>PACwsbmKb zbzN29=Q>3x>gu(b)oTf0T8ie?$6{e$H83$#mQr%@d%qxNqMA}-N~M(bb|bDSiJy>l zhUix&CNr?QIzSSoF7l#U*43}?^Je&7mseS@v{h}}AI&qe@rc1PFj!*qj_*S6vIGBGYHG<>%Xy*3U8A2Q@DXeI1U=driMIHu%mwtD9BYmP0irDGWR z=`&t0d5eDE2nlD)ajWeGiP@*aRY?oeQ?+x_!0HyLqN?I|IduTQZGTTsZgel+#?mT) zeto2$8M2;d37R)BgYMqp4Jh0a;1fOx4^sCOIeR}h`We=`H3#^AckO&N(sSf!12T>! z>$M%185~?sEBy?`9}Wi_3+ZZNm9M#c~i6$EoMg0ozR)g{b0Ucya?FgR2(9Uqb)}id zyOln01DPE;-!Uy;!-eLFIT(fLB<2lR8;o_p)_AnU2@e=>sg zJ~h5ODF~Y_-a+HO-(M|}W`?3=RRx(+3X;_({uV4!(@ci}vieWoTRrgMZdS&@)zMh% zSo?%~iWe(}l8gRowxkq&!lPP-u9f0o%EBNV5BoR+P!Gy6egn)T+}92_W|*hE=nk`- z6KUll&r|XCT)`cBdv0O>xr*GK268W3@Ar4}HNqJK8^(f?wPY(=w5VCV{R;q0*lq$t zSPPZTtBel*m(5VXYOtM9?cSDLuac^+2z`Ora8;Pa_NF^Wqs6;#pG_Ny{AqyOKffdE zzeimWksTqOz^tv?U`1TA)?K42J^O4#!BVenQWdk*szSTtb_mc)14ou0v)u&#th8*$ zrSJHRMKfBr4_I2i2ohk!0-rd4eQr6~M8vnqBoFAO#e6rjyQ~}A^9EI4QA~?&` ze{5u$fZhDF9-yo|hENbK}r0H7urKq0b8ViE$NxS~6JSlJl81;QGfjl(wOT)wWW zctH=UyxtLqO@!fq+IL`;mhJXVl>GLMZ@)-&!KI>mt`A&cv)jOU0f!cYq4&C4AIGh@ zJ8nIL^RY)U1-G?8_ncjwgHYT*s!!*|GmlQBk^XYCh3F#r>vVq)M`Gr)yC&QA9jE*) z=N5_%wq%W`G`4%zjDvgF}=X(&+2;c z3F9nnsCL_NYjYGh>=2~wpHQ~1Z(VKuJ>yN}njoO_5Vw@odIBSwmnH$)!F9*Jj6+8s zkJR>)&D&iG3u~7K@0hIAY>^j3+P7k}ItOVyef~Nigt^7rs=3{3d|dRsO|w|ep5yxG z?X?}`nKWqzJ!xCxez|PA(B)4@qesl~ctK9yg+p$3dsJCKZk*uB}kdy>c)Cy7+=SGr6rKsGn}a$Fm=u}sN!f$Hz#NszdfD}pRR7nz*zMoJ)zwlrL9Cb z(h`qIiU-eLtMHk$Us(TpEk^Ndgg~AOu=ko3M)w9;@;&V z&=O>UI&2c@_wPg+AwhML>#wRGVV(GTm?m~Qw7*^r()(C#X@H4ktQq+|lgss*Sa0~v zI|x_JD}j|uzb@FIsP+`P1RD0wwnO1(Li(-49HY9e}WS z0&KNCVMZQ?*+Oh+HzLh^Z1d%Dx(6N4z8KIkwxPc5tSdMIANn*!h%qZ>4OMt~wYaGP zqwS&b)z}~3?zoic1-h7DuUHdmR9VyBFB*lc9&( z{GUi0ym5a+VwVC~Jb62nwXJblFppZgDRfij`6D}6TkS{46bCj!k_jCgR!#SpC1|Uy zf8@j~m!-!Mu9R)#7+|!9i~+Zq;sYq$W1)NLu{V$RYv8nH)3xF6(i^wqSNAuHVu7ay ztEW>yv4M29OYgjrS2U()vYyK9?^Vlwx8iGyyp|dKKEuZAl!g>{6~Fqwz#sJh%xdO$ z?{IGd=i=1B-g7R#lDFQlOf1w!Y`ooC!uZzc#p0eR*c4UY^abd)oZ4^!!@; zb2?zoPi@%CKa-wb3!QeG?DqRuO|9gTffYz81tp;>?~e9ti%TmAv+9}cS+?5pM*k=3 ztn9dM07Kn1vD#fM=ltjdl<;nYW`eCU@RFUlY&0Lt zF*ES8@!>dp)ANLRuojjPjenXo<7@j1noTd`P361Rw2@xd%VOogo9kpJ_RA9M2d0hq zI~1?+;ohwFBU|@G+9_#lBz3lE=4s+)QJ;CSRl>@ur9c&;RpT8D1ny~N^Jl&AiHV-c z%_rpPGt8h@X25bdNB4#O122$i&*(7;99ys^m1E)q`vULy#qL(&^Fndgs>ZdSEFwyV z7Ji`N{{pT4Q>X^-q#doUtd*Jf1c4poCVdMUCvShCf z2VDD=lI-MpecK^mosw#nRHId2u?))wf+{Ki39S)}4t?P2Kb__&^f*M3pZ5hZ3K;nK zkP))`-A2w;3(8yH2DOW9@%nu% z44wy?$FJf(z$2R49_@bu(7cphN6C>LL@mX_VwwQJ=x=~9oJ5(IJ85OE3~4D=3f!jU zuN!aK@Gdk--r8ncS@x;)v*AeROfqn! z@CirwpNQwSJ%|oQ$2B|}l*873F2&|IeSb2L%ym_76u&SeEPShX<_?l&96qaehM59J z8a<|wn`yd$Wd+BmzO%jbiLK5jR_0ejG@NUt!F1C5#i_p=(R!bLIQ?NXO1h_R zg$zB}GsDy~KYD#{Z;z*cPN{X^*yP)u4%%x4HVI&>k&3KXvRwrx$+zVb!LIq48N1HK z0V5maK&8Xx4gm2LrZ5H6Ag!=^G^2`gt*sziumqz?AC{8Uke5ZT7h@V1{Sd**?Os7` zxemYEzI+&BEg3vOmP?`SmI#|84||{|4XSQHW`-I-H}<}#7Fo|wv-Q*S!>~KJqI*mP z8|4}P+5Y%}sk;w_Rt|aGNWp(kalzVlqGmPgIyu`+k{qyDY3*6ck;# zP)nv#n_|`VvA1uiHXA6|k@)k&+i*=Ua>ljM500CU=Em&bj3S?qkKq`}Poa&!MB1oG z2kr-*H3m6VnNOhKi2>BHoJ(M>MM;RRw*Ijakko~K6w?!tk2P)*^#N_Mw~4zBFT3;! z5BgD`GH}%Xdp1I^nB-nlD zyZ8+VRJLDiM_^Mnck5!GClnawe^M#V6r5x3e6~$?XKU=G^x9hZuIX4AcoNZu{2Rrr ze;a{p15-xAST6)w0X3uoff}VKcQEbE&&~Q*Sf>_^jk#41S3|6Pav5g0g3iDL`L15Lk+ll&Y;^W6ZScP=u zC)6}i)3DUCdv6@JXZB%fR zK`xBdvqLUH25+C%m@G5Sth+QcLPc-3T3(iPc@w9X>Y0za12e6W@Uw&3NnS^DF21mu zk3RH;`}p#OAD-?L!4A}KUE3cQA3(sXu%FXfJ9vKB_#-s@6Vqo_)$!I|M4zMR^6R zuJ3pVPFoc@B@s#KULgnN`5%op9=HYEN!%6mI4yVf;9IGWC;z^W%N={tWAB;mmPw1+ z^r`gRz3LWt(ncZNY95E}KeZ#a*Re(Sa-L1iu{;ckMf-_jWaj-T{*;EO1@h?POE>k1n$@Sq}BGT zzDg#>yJ={1HNZBUJrJ%NPD?58@9&Z>Z@7>Yp+>`I1Iy8km*dZ7 zK{<%OT*;}~XScX^%1V&ZOv?f5#3|#^EeS;s#I$?Oqi;7ZWC!(BsB3Tmt&SKb%(|~$GYbTp>kL*SGafBK zAGZ82xzr75I-I##30W zfb}JNn2;2?Y5Ay^_$0GpMcwMLKvF}K%8n8#fV8F?l3(jv zOfH3Mfd~^5pnkt~vvqcK2trY2Tdh{Ha2-FZBNv#) zFiJ)pwqYxF`zvW<1JJ@Iy*FEMk06Hvym|U_Q(Vjwe{1gt%BfpZX7Rh3m$uA4LWQc; z3aj;`mz!zD3}#YGtsK+{nd_}YJ&;xatkwOaIm?D_1a7@a2M|5{(dHb}DC|^`n!T%7 zO-u%*YhQi<*_+b}KR$gPLwqG2%BCqjZdVha`!6=5d^XiPY7T#I3-*m!0ZdoRznAoF z@!;N+5izh^9vSBGo*Mdv89o@Fo#bdfwPB;_^A&z7Jy1M$9<;CVypz@RxJjGOPoB^t z)y(DZ!K%%#53@awJnkrLO^P27{q~NH?NrxNBi(nr;ukNVqDB{B+p__IkTwnIWsU&# zecGcnsbLWA?(Ev9anh4v7%G^EjQnJ}dEVn<5Pa>GQKv z59j@Gx?&2G^jvEnT6$vHAs2TmnQa@_2?!*Zp#?SKQ88PK2`oXI$0`hxO^ccc#c(mZ z5|WT8AIA3rO=2ci)Uqu}k}My#eyGtTNh(>3R?0UK%Hl}S957e$KMr0hMInA`^`-Dy zm_WFT15<;B=C?)qQ9-o`$AD-HpI>c~8ZLe{HE4Zvc zf5M&q+_wiZH2byTR;p>Xm(#WrT%^>akeoR8!_CIPnnz3qRa>FmFzTvOQTOH; z`*Z^o>;JOmKgxx`B3u+bf=Z-~39TIvNh|$Gyp2Ykcm3`bcuza`gSI<2{`~1McS=vm z$-C+0&s+GLyLr$^JW|71UHfg~{qi_Jb8yzmuMW(2nA;<|-L26vg)OuYIuvqmho-1- z)1;pzy#Ca*S#g+o(EjZ|Zu&k1_n?GfhuGD%S=1b~S^dZ0v6V|v)xO0Kpx!6yez&kp zOO{}M$usF` za|f(m^3Yo4dodpLKP5?0Pvy4;v$t(GA%E#)W9&w3MAi@w+m2LtZ!J1^wacoinkHy! z23j9wM00^pBd6y*9ZUR8?cs3PJsfr)!2OleeRs!a(m!06zmOjH)b){wK-@iPcWM#$Sy)%^0%*86JW{ChvQF6M_(wmsg@QWJR5^tu7L zZO1ppU1yU4F5J3njx{FEcoK6L%J2aD#asI}XO3S>Lrr+3&;-5znQ|YMxu1zGX&fry z8wb7q?2E~OmweQ?q1%HrMqty;!(GQCExYG=LK@Y!xap{YgJwr-n4$ZNv+gbUb+u+% zdO)O#!^onh?WkBW6&Ml#m?~hZWnIByEEQm?dQ>beMN2O3UrSQ^`Lotj4>f9(xJB!@ zx|EVvTUSjfnGJJcHRvHMFl)Q}oL!SD>Z<4HtF_lg3yPLCmz2`7EbF@d{@WiU-`?K# zR+9=})r#ptiZ=;{8sE2#YU^Mr<#xMWua}fkcU2O~*xwn-?P%=?B0aky{Y31`Js}?Q zln5N-vZ+BY^5!dd}g?9Y;Ul$!~mpIUGpcz0EP8sSdI} zU*pS-zJo%D%}TBhY%B?zvWLv|7lYP+RQ{JeAkSvcMw_^)2FVfj z{^G~ zNv#13FHsJW?7Pz_XLff!7b0$U+PmO|1X5FrXkMS*0w07(_aM6m!MxTvIp=Gfp? zUaA5@zYqbyYLX3VRLD({RzP6XWwFcRH~WeQGR5%SF>JitfublidLD19-d4R_mh1H* z9#EGC;E(t6+wbMu+wzUye*0Me^*7j(()B7V!V>gW%Q@$qi!y6kmSrhR5=p`}uj{%l z2}=S=0f7WAA0HpT{dW8H*Cawxx+_Nma}B)p-xG-4E%Kj;G;IFaY1~KFsiG==PCvSd z9n1E6gpxHCn205q5<&>OUXQp81}}By!cB`1l$#R))x$LRC&$R~7{HAs{e&^e?*92y zYHHc%%h?Ul=H-23!sqM#^U}t!bBH%$_VKvsz|;4Y7>3Wv#QD3J6C;t3QLNx1d~2Rc zG((R;n>M#whejOyJWOW{zdbpc)2Vn{wkFB#PR6t(&cWEdw9yZa6{IxnJudF947v(#pAEdHt{H0$P6f8DeM z3>2`Rx@BMxPQ=_=Q?`6C0M?ClVG>qEm_fHva4eEdfe#i0E6^rpx}pX0vr|pcngTVu zi)_azw!WY4vH6Qv(`(CWjOTq%-7UC(p*45+4Ti0nyC*N!bND;zH4*1b1h!eC-M(KV zSfS?~U-gf7`-LKxix8)%)V*T3h&B-d}h-~Ra5-;myx>o3=oauTU_YCy>MZ0{dy zDN-ENF3a`0TrbNXE8gGB^`dWA6QNK9No={@@b|ypMBd)sq=r0WyZ*tfJN1$P6yvsl zjr2Jpn(u=>?yZRGA;u7Dt%6x;U$RjUw7^QWg=;Y_a5n>}`66YU@8j^f$r}-RSoSGgxbw|H z{&QmcB8|PG4m_|Q-!E`Dw{Nl^BFlYYbxVMCEmn=Q`sZWX3ls=Vtf1t=ZxzJUUDn8Z zy9E~-dGcw0LqqQX#Ocj`b|OZ#y`^@)(Hz#yV^}d)aM;MF-UcZ4u*PSc#P?~qjc-8U zc7+|aasa$f!2AG7c3RQoz;IUk-4WRWG91n6(PwAH+9-pe$m$+z7Wt#K&9uXn7Jf$` zgJJI8t-z-U?zoCm$P`E8<+=Mzdf0={*%|&b^|T`#A{s7-yQ=xWlQF;A8~S#*^~{xJ z_v>@3ZL|`;ni<4-xO0E&8lbDWW>yR#_Dv~eRZS@&rD8?V_N2i=s+yS=Wog#FQcTru zw~yQHrr9*(+b`div^Y5QP&><#mL>H@bg2IEvHt$PUM`o*q_xF#qq$KHfyP4S^fBYdL*Na`RUVgd0UEZ#j-+ue;x8HvQufRn_NdD75{d!r_ z?RNY7-~ay0H=#Ze{BH}=NS(eMPoT!x+{`JDbjD9aKxF^!xqbjC= z7PZo@s4cM4Ew%Iza=>6~!)d2thT$vKaqS5>sm9Fw4CnC4E!?)aQ>h?Tu9R#;07DwI>YFj%?G75_#0kMez zv+w$hNnNNr>NVXBuF$A%SKh9Qqe<9{gP)U5Od(%gEvHt5Qwzueo4e;7exh)3s_eDI zU6})$4i8Z@VBzoCm~}8{wXgc0{?hH2T0`b5Y6w=(JSnW6Luh@asOstgoXDcNX!i3$ z1uPWDNZAIcRfULtg$i##89Ei%@dXI4i4w>_=%A=m|`twXW-v7Lx z=d7+Xqte&YmkNw72f=mrbZdFnS>9_zr+>E!Nbss3NogjBRQKJJ^?%@Aj8PFh0JQ+O zmfF`xdyA{TNC4dY*nx}(4LK|H^zC+rtyNc1*U|C}8{FHvi6h5_2=WZUAUk*L6q0Ps zQ1{cBe3)(SgWNmHYYvFr7GSNqZeZx@Q2)tTVu0K=OJ9MEgg5bUYi|$wdNyyzFAn@^ zYoUjOY4d+KlX}pciB87o+)qJ7Zgbz=7ukOBzx;3i>;L|L{U6J6`IrCa|NWQ$@-KH9 z`CPl==aUL^wp>QveLb8o{auW^mw8_clh;V-9^bUL-Fr_NJd#M zyj-s9x~{AJ_HkKZzvqwz9y9jGfR~xJr@wDLyL;O6x&8G_+s1Bp8yg#FvltnH5kf*j zXct-#Xe%LAsidlsYR#=OE8lzfMx6O0mK$-G_wLKA68P&0L}g~&h!ZEa6Tdid;>3a) zrfx&GtxTm#S(4y5ZpD&FnhgaDbC7SrArZOf18hG@V(I>3V+K$({&V2Z8x7%5B+rMp z?}FEfWXc4-{%J3MNoEBpwNndLQd`QBH`-a7Kl}S?_ahje;bIfW!NSbt-2cOGZuEt@ zGf7slFfRpe=a#+18coJukjM>^c=R!STYhC4HHVBq>(WSSDcL@g229~6( zx`0)SbMh0ib7O5$00aJ`bs&gHMFK)VfWX2`WdbRODLf7|d1t@tEhHX}$gQT?6Nbgr zyL>fu>roucuhLe{X|4RTW^X8F=NhH+CCuf=b3bel6xu5cifX-8F{IJ0@w>md z>FhI>l~$qM=1>04^QE84dG*53u(L^#$+JH_a@!q;_Po{&S;;qR zHBAQ4YKog~TzkV?R_fLEFF&{Yp~q%Rvkx`t{qJ6T!&_GAl%M_F?uQ3GePjJrdjn#s` zwR3mUvVQ_-1}Gw>YpWDMK%{d?Mn}5&L|(;6rp$^IN1Q@3HM(&#X+%QBLLKSQ?3`>2 ziDlGERVt;7;-(O-j^w$8&U`06l0;n<#cAA5(2*i-izBIQG@H$4v(w>DM@rd{B+``H zQZWeBFxu!YAptmMMD4bqE-Mu)9w9}<#tcIqQ449O+eMdKX%e-S_IJw*Y1HVbZqiJ| z@*}DtyZWX-RFbGJqamVJOvDX+V@~e{KuSOF1}JEcVIt@;mISH0NI_`8Pn4g=B75cl znR=Z3<9lnrOCfeu1QssJLS6l<(7v}gRVv{$H8vrv00`0wG73jK+wtH-S+WMUe#&qQ zRUC6w!IRsr2nQF6lH7-wWl+C=DH+)s6oS>7`vK_kdoQ(l<9y58|COD!E`q*gF~EJj zcrbkQ2*FNlpdK-qDx&Mux0kJEh&7AQ+euadidCeqJRG%hAOY?nNw`{8I8R zDIAl2IVxepx>nVvSNC=nM|1NDL!bHNrm+>-sGb;aTz>J`#TTsjN9Xs1DzW(N$ zKxb?n`PGjcw`NttMeaS&&Ft#EaOT#LPkdzKn$=#){oQ)Q*My{z z6W@Qd9<8Gj#@9^fU#1RDl_nS(85$ZH0x*4`Ji(yBvpgCs-x7*keAdN;YDvZ3SMR`& zrD9@kciPc>6qAYtw>#}rrcz3&WT(?Rw|V;l>m`qMw&8= zF|L$SvGUPT-oD=qaMo*#LG(6_ehOGA1qLgYkQ(l%kjyNl`M2AJS;Eqkl}eJN-RVS} zG?3~GXL^M*EHO)<(P%WAO{X*QHdq$0=uLIdhHP$b*)~+x655y;n|0a&O=gJf*0usE zTQv=?jX4T2ld&|BfFvoUQp&urP=ZpANvL~VUJ;JI)nmUBUx(l{vae5JC~L+6G`{Tp zUP|F--JVq;n`Qn6OmUi~Q5;9Y_#!k%Ey&GDPtaKnfHOd3b{DgYE$d;q!3S?#XHt@{ z@5^HI+TY@b62M=ySq%J=hU-|)@TwRnVu=I|du%On* ztbW(6T(?sHGPU0awWYi0zK1TJ+P1#!_&}4}6qDEO_O|`4Rrax1o6O-KE2UD%PP+pj zCKU2$Oit5T}d>CDf~M~yUUr0sUQ)9ECMkTQ}6%|%2pE0qFJ5|n71mfM6g z?LFO8baKZBvi=$VV4TM_w+c02PbOuYa0zKzm{msH{zgTtUo#vVV3tFL#l2dOkABo3 z+_^3uJgi-@;mxPKbv~K<&ePvmO#Tu+^1)!U+O;XxL&MbX-jxBMD8ffSv|c0H2OpjN z$A3EDr>q&Syli}IEC%rPZ|=YCj!B(w+Y3kj?EgM(Xoxl*=P8DJ&)c#%(bJ#9TBAv-84y%rg6%G5wSjshtOLD=FH;FU6KoG<`zGzohrRuq+z8-w1F80 z0OmxvYjfWq(VwUMGYv1Qk_J#yGkl0S)$Qw&~Tb|({2*QQ51;= z#j)UQo5R)$L?cq;LQ9a+5ER-;EC~`MBr+>n!KOh0V>hU^MWmEq<#fXu`5JQw=lPH= zo;L32^{qiBursCh$1B;y`mgNn)xan1iwH++$oHnxr<4lqq#wC-K67Zn&CTK@9TZm_ z12j>MEQ|3q&JwG>4jNy=O?h^!r&E%XZb}rzLP2Pxr}x3iYGcEZ&K`jGeQuWM^SH=q z5k~s;apK8k3Tg&z-zJ=C|tLI-%zH(=L{bkWbXY!GSR!t@*mN$Rzqfn~*SGP3Ydlju2SI@uF z{mPy3^_RvMoykWQx?jGNckj!Frw4vZn6z5n#`Tv(S6>LA`wzFN=Uy^3U$=7T(;o&P zfAoC!tKZ9V4K*7VpDoTgSxl_JvLSR+o}Nvg-k#j|1lrx8twx4g*IW{veG*27`QT*t z*86DHiq;3N1q@{w5+|KFq<^{h!OYq33by5INj-uJaX|BC*7 ze9gG!?a&z)oq68n=Z~)$?;Pno_t>+K-1#soS8-F%6Si(X`;xQQ9lw5fbU5iG`*!X7 z$pb&yxoxLk)?43y?HL!H3E=Pk{pU_S@3b>7Idg1cyuHx&XjUwmd8HP4maZiYonKDu z5Gh}Ns2rA%!->5wh15a4?*18pA(T}_=|YvFZkL3)HZK$!N0NqUi@CO#Yez&Zgk%PD z1Vo@nL22Ep(5nq#PZu;6CF9jWm&~E&)?>Cr1;+M*U3gngzeb= z$W%(C5-N(Q*<__yal5P99Vt1LisRwNFpacR)oFJc&8XRoD1v}}lU93$)u2-m6v>pO zRIG@l1-eRsrAF3Q@1QyZ#PJ`Y=%}rxr*dLO#c#X$9PI84k;p=qkh$E z(qH8Am~of?md0EJC-&lP(R-&-bfueCv!tX_U5wkV9jg4lRn=!3j*|=t9bjFG8&wdrs zT)Cyuk>O8%fL5+Be{NXQ`tbG1W7{mvDYz~e9Ul6Po5X6f%+s2Qq4&SF9Yw}>fLA(* zn(ui_EV?<#$xrj(?2Z+SiIHbGw0ll^tI-mWwI1Th*{qDRtu6CtvpVH|fZ@(KzeUv&UDD-}+x~ z$)!YSD&QigZRCWVFI8dM8_C8#f%&+THeP(~C8qQh@rBo16h-2J+a7Q!MI^4d>DtrZ zc)E*e4Yy7>?SvCfJK_Fs-}mIbKXUP7tH%L!+MNrodc*l|zCcGVYb^6jwL# zv>BSUrDkvbv4v*j=YZ8?x;>u0GGY!aJ@{s^ug07*P1M4|0y7ID0nu)^+wC?(F|qb> zyRfiuWNxn2YRObm3ymRX&#K6pG-yz(jKP5M5vy^H)kEiz0ec*|McVOf8^u-5t;=pV zqtn+oj<)F+aSQ6`hWhshjzzi0-0ZamdDCmJLp$`bP+CxV%JKGXa1mRwRG>MZ|IQ(;o(aPPg;N zf7kfnb>h5Jv0@o)mx;Gtq!F#!Kdl~r7V`_@g!SU0GeHzxcX9f}Hq0F%3uh5Jv3#_YneyPok3KC`iYI6F8bg4v%QhdFausg8`znoS z(+8j8Z96%UG`1|h{t{ZbLTp$apL#-Sv`5^0-!&T1^8A8)dOL)OFF3t%-l+hw?h%Y`1M9mv6 zO`dp;=Z@5`{cv;Hy0PN`-15YKpIVsoKM~QTCth*g8Shv>w(-^{zuJRH*!%s}n!doA znv(PLYS}Vz-1^`K*fm#8G@Amz?RQV6(%Tv{0Q~kRH?3XU>~#6tcTDa-;OjN>rSzQ( zk32g2ri)ep_~j3;`@)y^%^gwaoU!bqA6f@s$IgY@@0#qLy)^9G-*x4#UuQw>{%$TA zf%YFrT*?h=O$)r{rS#j%Z7h3B{HPJVWKK4CWOU?&t(yVNl!DsT27{h=`FRh2_o12n zlj~1B?!3#-2hqk;Hm%vT=D?lq|-ezH}47`_pD|$_UN`d+a7-oK(p06>FkpM z%uUbj-oDF~xYIjKm{@CQp7*Bnwm-dnZf0)F8C%9yjsZC5vhyCf<6&txhnL=PnMSl} zn(ln&rG@#0jVEu?Cb@5V`{mC+v29^)LC<4t^AJbzDd(Pg|G(TfH#2wId8cVkG|e=X z#RaXG7&N*!4r6q-9F=M!_IojFHmF01TEa*fmw~FG?6bC1%dSt@-;yLrW!J%67+gv2 zct)EFuu?=sLbyW^vk3VJuB1IPkJ=^;dDq3r<}-=)KO#^(aY&5;?XQ;;Uf^!hZA5V# z#qD;x)9yfk1d=34lBB)Ro|~IX(^M+i5DjiM(lkwy#0Rz7YeCkmEOaZttcYe=?1LT% z1QM2Cb&&Ph zsF#sIOk6ZO&fCow+u>;AZStKiR1nYhIlcSk_1OqjO$!R^;-alTY{e=~Qvl7lAt2a$ z$I%eZtlo{OxwVn)p;@j}_SC_*E=ioLR=GNZjrvpV-iN8fST?Mq<H78vyXD2h;!Zb)+c(^~CdW6p1&Ujz~nC*2--=VS%#Ry$_SKSZ2||NJXFw*WxBvbTBDH2`>O)+q_a#PaA&oAR??Q?qjb=MSFjo zMu!_$y%B(V_29y1zouI$eS90DD8BFvL?Yg_F5UJLifWx)_3c;ZBw4X4j?~9?K79JR zv(DXkK{suG=jm@&wP01#*4$d{+TA{V>&S8In@(NTXplBMn46RL+&7&|-)xArYnlLB zP5Q_O*L~=H>u$a6z_-6Uxj1JmKY4ckb6RaxI32+Fnw1*VMp3k4n9>~VeD0;4 z&%FfTxD$`lQ1X@MciwZ$-9<)4Bvz~(1JG!-zWw=cYAb?A?|kH!fB#n+t!CVeN5@8I z4$S}<9vwOVit_=q=NJCzFTXZ(Xc`O=iT8c-1M7}oCxqB=!iJZg-2tFA)Ecou=9_=> zjj8>U!cN7i001BWNkl*`LuMUq6`!w^RS92ErB5>_jnQ|rc5X^l;zck*< zsKE-roas%iwot<=d#NhBVjMDSwU!pj29@C)E_3=BgX*j^qrBFQ@>!UTL*dM3jzGe= z8uGNkBoTojl@O^&Bt-(Lj8j|AkuLafx7|g;O{9@*Qyhy%9Cy2_o5&`KrZ9?HFp+he zMoeUmIh}IG-0IRkaXD)#K!aDe43lyU=0=c*`JE?Q5ZuKVQ%TMzH&ylYQ#P`{uE6B2 z70S{T!CjuS#g%1K=VwjT;l%3$%WP3W3x{0g6C86+dZRZxjl(xSj=4&^l$EkL&YDYC z#L5U5+i(HF96Y=CLX;XO8SUR#&Ms?{~UfnU8J~Iy5wQzVyH-s1)rO{yxRRQqc zLvrsyzs2G+PSU@m_dkjG1&!F`s|R(YIxy{8N+VhT$-Pf#L<@iq&#Qw|V&hr>d|+D3 zglOv)&1dr9Pavi15|y=*TWm63dUW-CXYSzK{?(&v-+TUt?t9_xPP&jwaNmn}zx(_T zUby+PZrZtf+jlF-WSt)R_X*NevGK~Qozu6DG#a#eRpY?H1i2%Ml?QT-pa^dvyZE)O5 zZ`6B%rnYQr;W*sjrR?w7ai)Un-#_RQq$>J6&_B%MS@ zZa#gBh#~+#zW>SDLo-@4$cp!D-?i@ebpV7gmyRZEWp};!%Jlw8v(uJp{_yB0jfXdX3S?q&A>dmD0P{uYb6eAoD_?=MiVGRFLtTYgP{J zU?)2(*Mrj{L9cdxS)T2h9na+Jw%MgDZy&F2&L@B%5*A=)D>x%oh@cos!%zlCK*X#7 zp6{R|yDEX?mP|#W(1=ANin`sX+l>%YqhU-A1PL|7bYo(_ZdV=PixcvnVlb$ z|Kdybd?Uz$U)vZO54#F$n_5_xL;?`5|NT~QV4h(OnL+;g%N0nI@_!BhcM3WXH~t6E z6Z9yNZ4K-=dJYny(MDM&JddKA%g+^>-gjKOk1q;T8GQmxH_~tTzSieATc+5X*;cK^Z;}TaMGeNSo56*J`JB*I5)qwv}4% zdUNZYS7b?J(HPYqp9ipVBL47AYu|YOasby~Jy8m3dxxQx z_}xz(fAW^$BW?BNTlPP@?a0uOc<1%2&OLkCum8&M=xBV$_a{*%W^y~n9%233762)6 z@Q`OFQPxH4*EUO1E+G(+vk)knA2__b_m#bV{K%Mj+hW$vxXjET^f;?+YUgL?(r%vN zaXX=k8e$zLtZ#%pJ9hi=!^;f%T(Dz)?Z!3wmsfYb>W}TAVRK4zc-q)Kk6F#}-dFar z*E^#tmRXwlJzHf6)HQVwS*`C?rn5baW@`p}-d(XGTBBHF5y}7&kziv-km)C_UjyH< zlm=^=y?|dw-)O=uKt-KXb~h};xWRMT=2-*<>mSxaa;r!NK=$o0TZXf5B?fDAJ>z$P zSz7Bo9fm|q)BvEAB0(8<+07H5z3@=lUlW51D7tESVPG%pnKm!;DOpePItZNl*AkAM zJ?IjRO^=EN?a#^z`SmZfzysW#*-qC`on&X0j!{yjX(EIW+Gi~p&m{06yWLA0OZ)y! z>-MA^rswjx6h;dQLwON#Bvvd3v_UGF3tk7O0j5@qMn?c(zp+^)yKth_z);iu$B_U4 zDKR-yLUYX+tm>DBTC{uw0Q4t4M(sLR49bUi?kdlmm)4fI z5@ORzJUKA1+j(&N-#_?QI}dGdCkvglUHnh60+7h=kJ}~9-HCoMOE0zJ6-k;5mmFrgNlv8^T`TTnn9G@jl#9G6xp=HB{CJ?Y$KjiDz z<3GP&0IQ_{*{%u-_fu0HzH+67pK@^1NajpFd)Ki9k#Wdse5yKrK)r$xg7klue#SYh z)XnyMTK!@bm1G<+WQ91qO+>H$}Z)hm;E)`69=-cw3j(`rzwq|*7d zvexUGtZ9PkgR(04O=4TRtee>K7Osu1b;7pl-_6;O%6D{W$c>INvbilu?n_DDvhm&j z(@_jHi+0S7wK2gDaH@f2)>ws z8)z=h_jv*UP)a6AsuUZMLIUKcA%L755JH4i>NV2rzGC3rMO?^I){d(u%;o(<(`-Q= zAD96Q7zLo5iJL~Ble67F{i07UEQe|JxTdKNO#@78R%)6Acr-I$s;L#2SkvMTf{N@XiyMAc&5^E;_@Zlre z>FOfcs(ujyWg1@rK&2Ah%$zqm@i;B~_@EEICjju|%#lC&0*axBs;6fc@0s59#fSf! zW)|CJ{UB2V{ zQ)c^D&HO@JbviPRqfS@$I-n@gm0)B@Tz1hIfR|orKmS5@yDmw1W+q)e8jUU!jRtiS z=XuA|xp-@LSdcS)XE0W;iM0;>wY{C*U9e_#BTG4GsOk@EelTOqSAyU{z-hlKE7wc_ zn4g_@`qwe*zN6b-a4FYs-k`_l^nt0O=31Allyb%l`mz$vSPdZ7Srne7t3Ta2v314@%jNTz{@#s+~%j(e&vjGV8K!tv*)Do30 zR3Ryg^f-W(>Q%uvo%ssow;6BLXK^9)#e4dujR#sK-vVsA6&=B}?5$?I`7 zYf8It6_Fqqt2(o)vENp14fl2FUJdoDn*g}0#E~vi8KvCla-*Xfos_%XG>SM@GK%6j zj$(nB6@wL|0u)6Sb}A9fc58zRjOnd{*;fwCgE6Wkuy6R z<0j1tr0nr-K)Vf*+t|k!nvQYtmN4nAEh)3Mi#4VQ2d4pOFbbtGISUX3(TZgNxYNyz%-pi$XyVWeoOgnQ(*POG zs8X=&DA_i4q$<~p@#Ti?`2|;^*s{SyzIq@(AQY>ed$4nl2BFcZCp12OBLK0%Xq7NB zM6D(Oo}CZYw)LwGO2_`!Ws^GBpzZLw-1zV@mK z0I%$BKltb@0IiQ%zpkl$Z@v6VfOs-S32!`a`Nrc~+kQI#{EG{I=_efD(l~NzD)F0P zXee5@wh3TnHcc`_>t!Xr@cb2|vcxbP?u;4yTtXtU{83J%%&wdBa8ZC4Fuy)h>UC+M)fP}cv zj!*6SAegg6W2;sGI6QTjRq&*$hhL39ubG3{*@CZpH4QFkWW_Q7?fJl`$Hdx|TK{@r z&;E@0kfyHjMD_;6bgsQDRI3MV%R=uCDDCkQ#aqv>Jqrq?GTHah!xY{%G4dU2F*IPZ z_)`bv8PKwUsv3$Z0GY7@?Ao8LU*00_Z7&1;4H+z_ll%JvZ3tl$vifBLjb@F>0f@+1 z=@HB!rPF#k$-;oLG!scmft6rxbh**yMmv=Y2}O!yrCP1HMKOV6Z8i*6BorbL2oy0# zrhT9QCIf1P_Ec+l7TTvQnN$*HccHt10VoKWsjCRu^npmQjFieQk=Y;Y9$WwbDNM6F zz|}MO-xq`K3PgH@fv1aGh4a#^V$6pO)mrd)z!vZ}OBzfC9tLcD?V6TM?9#k7s@p5R zDy1jJdMyoAE!l&9%@!ale8~I1{ot^u){nDNoG2Cy?F^a(F@x9CE z>j9`AJ+Cx!UF~HQ0-EMQO>-jqG-$ALht^IQR{eJ*+$e*%wKyvhiI$vEq){T z%AWS|n_4T!S8K1+WBYOO&-S8zd zPwZ+?dwBY=_VA*Er@l2-NzAOI6j3y`YJ68a{VCz1^;QG`4z7bF1tX zHvnS=n)yJ%n0Fk$KA{eTs7jMtG)*O_nk47n6NiCcq(9ndlSqKHhjh-?Dz8L`WWxd- z_{>mfo^PvGHr58#VmAZ0tdw#G%Hh4J3~cDjWUN@?{E z{j=f;Uzh&p+8gWZ7JBqcl|u1n6pHs39s1N31;!Pi9huCWBndN%1_a33*E%zQhCL(F zH$m&vbil^YyJM578q|6sl`=IdXyq6p0f4m<#cFM>?tuA~eYAN!nvKS+PVW0r>*lusz)&l?^c(<@^BR44d*Ujy{Z9V z$IgWZADJO0+`R6Ud;j_SGF42xY;>7XAs@)yJad+~)2^bgz4Y3~Q#Oex zdjF?>apyBHDOSgya>D5ND1d{n9em+O&uczMCq|<<&gBI#VGVwAx7-4ak*_lZ%DvLs zY`y+O+1Ki&*`Xm=6VhU_S(;+VVMaFkR#-)=p;Ur=O^q{iTC-(lZ+~yhS&b2D;p&v* zs!%`Q__ai>ME);2h4DWioZnn#hJb)z$~=NuGYGbS5Gz)!hy=(oNZAW#tQbn^lv2uW zm(wIwQn8XmDvqU;iiNV90l1W%PA6{0h#Cc!%Y)GxQx1QFbR!Dl%rHT3BkT>Burab< z^Wu3ifpY$p!*BVN^*}>Fc|c`wPIguDWVK& ze)@8H`$LW#PaRf2enFgfDq4-kjaTMspWN}V+I>JDJ`<2U_>;!97Xyg4ZjQEY2GIH1 zU5zWw*CqRI zHar{+4@XksJ9i$+(hVG^y}$Wu8zVt$RyW>$ZT522j-3nt`LFi)=b|nQ4GE`i zSy)gny%LzKcDnqJU*Gq!n>Uca37dv)e*cjBG&z<2*1#uX`7WGU~TDsL|n^1T*C;_S=LEzZsLo7b=3 zydJ>5m-p&yV{68BvK>#oc*^-(PdV>2m$d*p%h7~*Il1_K$Gds4NeKLUKPcshn7UmaZs?TRLlYlAD zpcc*|f_dg(7XQ#~_rLo$ZfZ0et)bRd?@_U-{fEBu`F~;i6qaXDI~mZ-Y!ar!hRJkk zy~0u0&1LIA!5Yk9$^OOm^Ne6XvFBmRE~w-z)G~?h@;LJ~4_!G=JghBUbI!SPrS{xr znxdhkQc7uiJ|Tn52ai!vTe9BCskHI+k7J1djjy6W^FvH(+EUb3Ck&^U`T~j zQUr=XBuEG?AIwYLobAxawoL}0?QHW8cDyqycA74I3C*TqcQuU}acP~MwnmdSrUD0M zKtkACQ);2ZfY4qG4ozp`clZ9}uf86=-(??tMZ&@jOo-ZoTI!v3i0@8_SwQH~GZ#>EqiNFn1&(5p7rlKuyhXHzg~%)vkRD zfAN*Z)fYym98b%JdG3hXHz^-|CVgfHl=9c?%qLFP8fCc84wK?xP_3EkCF;4I3y$ZD zLudEy3~oO3!pu46><{jr zZg*6+03*AwGC7@m?+24tTsl5Aoqp-7d)po93I%Z7y5O^3{EvY5@{d z)^Mng+Iy(yff=K%BWem>ylH53IPIpB`ws2+$qUau@|2Wz%m*HMr#)CeW2?q}nmyO8 zP$(CIf2>@{StbwjFtC_6ACuQ+Wyrfc-p^_ErrCmMcN%10=kZB+Y7KZAlmJ2)$f@Oz zTT22m)yrRzZ5@|u4>!vkyrnE7Q=nPVuC@r-kTIfB`CQl+4%mJLkSIZWmHXgD59y4^&vf?z})8FggTLM*A7AWc=OX~skmMFJ9FK}3RBD%Kw4iNKMEJCz4g zm0+b?eKL<&l=f?mB{JLnrUAcBH1FxFKi=TsP>`pK70fp;{APV>ipqxg}8l@7k#?1PhhaBY9 zyJgRO-6(F|n$FCCp!Z#Hv*V6~H)ArS%+{&3o_|W|H@E@7*iX2c+e>jAp5IVN$Lx2* zW_4OjC(iv=))1YI8y6-bLD?obQ}SzZrz1QL3`yI39DakXyB3`cQp`#zAxH>ecjx+R zwmd1Nq>@BJb3#^Wu3J}kOZ=vDwI(=y@F&SPf8e+pVCx+mC1xd{Oni}#M}qqGFQz=& zE7cXypI}9bD!p3@Jbc>&xnxziuad>ZwQ=tn4j7i&&Hd@uT(FAM zkW1t9$+8<^`l^wS@yeFVP?9+(|LiN1?e7F4t~f5Pa39%=-Trg}7J^%6-c!-pwwE#w z1I}y}rs6p$uce~Wk9iSjY`8Ht)JT&gNmE9|h`LEP=_cdLTH_t)Zcz zA%QNT3%5AJ3AV_y%40y;E|88pvQ=YdP=xX$RRzxOR(jhop`Z2*L~AHL7BPmiDcIYQ z$6~|cr+C4_yHZXrnaP@A(7MzWcvgj&OTR?vSSM6UP>oy4vh-r64E0madcp&1=9;Rx z1ZE$CX^@C1j^ikfMWpYIX++E_vv~1zlT5@=+6-SRCC#gWaU4Z)WS&_8I}2?l<@3N$ z)}~3DALIrZWrcapvu#UM8_?vZQ#hK-N3sVrVF9Xs$2nUA?53Z?TtJYwBoxfbHsb(zKsc?-GR>2<$G^g*+q*Sk=X&yXt~y;?H=rJ{{W z>@@+5dp-dw?Tx%}!CNnKd$5W1t4=)gBmgo^pMCf#zhdTRZlSds$Q&%n`fKre7H@mA zv@us#O|oeE1F3hs1uYo-HEB===6rjE$|~m6EN(cUR_Rp(ue?c_{n}N~p+L_1$Bt#} zaLBWtBDd^lfooV}FgQ)qZbzkQno7w~OiD_rSSh6xbCM*Tc3XEs9LGih!BEVKIns8( zRuoWJa#pBSrdZvIl>kH*WE+)@d3XX$Afew>WA~n-(fafl0znrJ3U;eSV(-mk)z>;h zwMUx#yIvT8!#bfppS}0_y;_5)?A?tlS%%Q6mxpMA#IjQaGRQ$D}vKH!Sz^)&?)%mEHy~=C=D1&R(^*n$)(MNFUO!ieUIPJ^ALXtCsFW3;mgWxR*Rov#4bwQf4 zopwb_<}Btktf38AdBh5eRm!Q7tiXzd z5K$BngdjZ;SV@*LwL3{7kd#tN#VJS%hiy`&5GzO`K_Vh|VGSea8zZM1cs$^SUb?)lvrX!ZRWHoDz|-HQdlaTI*%|`g>VeyU|Y|&?Z;EyOlF2_rvt%FoRn4+Cruq zl*YHjdi5p}8q``q%n(dM8`Dy8zWZ$w9&b{(Rj$+E)pOCTmO;wg*MLxHmF=P0vi(vo zRGa&Dv?N7=eyQ@ur13sfaNDB>rR!H^O9BNkk{9je$34~jhvoLFZwWT9E3dLWSV?RU z&)(mpPdUul1sNcuk(g4fI3>vnP@p&lMH)eAjj2ph*-bT0BnX0#Qb{S9LDsIF71C5e zDo7DE^owOg!T>SF*2u@5mN3zc=iRJdN@OqSJ8RxMgvR%np9XeI>Vi&BL^iLoio@)f z$Xq-vEE1Nc?J;ZhU~G8-07@yPlujyyh$3@}s)df@K`G^PWwA8?F2oqop_G(TS-W9k z82*W@6LBKtm7;aht}J2Ss$`W}YY-uO5{}pzG*j<^Rw+v%=zvv83v(r>1{bz$F8oD|H4^Hk1<)~ z{AV8)4{8w%10P6HkYu1x9}K&JmVw$3!ubjkc2T+h@~3S{T>vUwQWw!`r5#_OlhvOB zer#=t{i)}vni-i5Yi4LnLESSQoR;18FL&<7Bq9+-T2>3ig1OOXG~!sPgjJ$#_!@#^ zp+-hVMn*sJl*XX6WkxqdJ7D6uqg zX-x+iKRJ(oo;^_ZScxxNi1bA-S=mSDwcWgS z?dRkk5h*Z(BMtasieif5IF4f`#X_0sL0ZA6+m~VkV)X?egVmUXdv_5Q0@i95YkuHo z)CV{k)!G|Zo}yNNGDrDZ_nH-*QR`Q(Zr*}PfFa{Jfvc%c*gv&r=V5^}@u{z>IX!uW zl%X8F^j|aS4eSQkPi1+6oqdmXTFjBSrD?5G2E?SH(xEg4B~yJ#A*b9ewazTsgX*Nk z>|wTYo7ymmm!>Yuw(!tW#>IHl3M*Cbc~PeIDNj=;gei-B4h-9Br!Oh7KD9+GlzE?; zRQBuO)1kKaP@A%Hj9ET&W(HmhIq~b~^k*W&YA})8-q#r9x)*YTECA~M{H8#Y>fbpI_Un}!3C<@lr3VhRO1P|qLe&+_Zz>9{ zo(J5)2lnDK=)pmE`yCTZNGct9_KjeGk@-;|wnv#n<`%YHUWjyivrw!Qgo1E-lwj2$ zv?bapq=Zz;dhH@1M3cBhQbgKbP(ORm02E>gl4+`sQvjbpV7~#xaolJ$1d`0_LiWQ! z^`ay`8aw`wzIhfJHm<5Y%c^dE$gc0kC8LU#4dZtDi<%w+WFo6)et5*)uvH^?MfZsTX)x1E9 zj?%q21ByuyDPw_3mNzen^H*s2HxSuCYEPsofSH7|p#==0WdUM_&~H-^pdj>vGaA<_ z+na3Nm3!Ju(r8#2ds_pk6+=U0;Z^!o7$0S0TO_@3gA`N^G;(12>01o z6+(ZJMxksh5Bb%Gvk};f4a#x`-+QuDq*Ri;w>jBBp{j|B9u)vQ^Yr&>l0EC}Ys-r2 z6_d5{AaK3_k_xXG73?3Xj306-sSv*iev01<{1jtyT;;TegLX4l)VI7`56BnsftxJl zo48twZr_NqEdI90|IIvN;GnpcP+kSH-}5I7!N4wM#+&ez*{Fd_7pFlHZ3e@#w0dD7 zDywM;>m~(TT?fE|ytfI$*_HJj*|R?c8xnGB3VEQGNjTS-!Z;o+HX zgT<@})9lMorae1U$`sEpj~*A1%eoVvn^JL#J9m zmW!#Lr=X@iYYJToH;bNvApFf^#%9dSMD1yYK^a8EASh$DstC^E0YPZ{PKQ1 z))>H0^W9PBsG7uw5j)qnS;aZ9{tDW{wmHIKV#|lWU^uqP z0^*}9pQ^$lv7uL^qpV^**2;!j?DjIf9k@XIZ+@27^+Z-q)ybi14`R+Brw8^e{d(*| zuH5o8ep3wuvFl}`KxX}X>3MR4g$iHI3hxAB*jV0gOB!7Rhkl);*S}oP_M}oS2dF|t zl3Td@a1(@lDbC~!nGDZpx&=%rl_W`%6pL*32@+CCm8vA+Bw>ATL~DPPQfZ1Vx@~mR zG)>dA8ONd?M}DbP2#xQ6e_aHDQ}Mcd<|M0(*@!G4}*k7H2zV8 z^8LnTpi=WrYRbj6F~l(mh^+oqBT4sVJ_Dxgg>p&Sx5%!=(yl%^) z#ag`+m9=?4%B~d#&P$$`%3O9Qr!t(C>FdI}VC^I4S-c<;Q za#*jjvhskwYAaMWASnYZNx0iJ7Cn0I zYk=F8U7^}h6eUSQ!^5pcETu}4q}`SC9pgb>Fi24xC*5v0Zb)jlvEYIm#7>c~vFW54{t={s?;MHOf&awpEXqJe@)xRV{A;&EB~N5Y@)lQ(oF}ImbrF z;-N8X*qNzTEGYm&*y9hOPe_!^szX)K4`lVVz3U$<4m8esgaLNb z6~nS58A`?C>o08TgkWu|Sm28u8kbh0p2r2v8M!v@ExG=61lMG~hWKAYpi;kTOYeVg zgJ(9q`EQlMhuMWOPl);EFvLODW!H5#7RnN5_J@t zR}^el>4j5Lqpdx7DUqb2-C>y`O{pWb<*Yt`B_aVLr8r_9;(Qm>6wS56;>LRKTub@- zuQ4p8M#a2!Vg}{p*!752W>u^m zLOZ}UGv27D6q^?vq)d}8iAcCd8Hhk67%FxW)i=YV476o&J}QIvLF*wLuxC3(*)yi| zffBLZ2e5rQ!Bw0@CatVBzVV4`>uuVQ2xdRwT+9Lt_b^0;VjTP>0!V4=SnXLwBU%!k z=G@a60G@W(8e3SfZd=O=Ovjk(UMpkG(V|OVp^B^tyOxH|D#2FoCCyu;D*5jh>f`Cs z+-}2In#PUWatiFF88}$m>+CO>ZYcG)5Oz=w3-+=K=!+U_S`^f=%I%ds`-NO{A4RQj zmEQMg1&2BEp=S;1(_e%i+`cEdPJmhKvg}I*Z{aA*i2CVs=ytHy4kuhW2raJ*JR4a= zp>07nxWWy-N3!ffTj2AHNLdRU`$DGjeTnIML( znrqvBQ?}R##}Hrkw$7{^+ht$t)9EX;ekR-PI{eqsI4!z8>xYV7D+dGQ?bwjVwI%S+ z9<%Ey&EzaF-PRKT1US;k6qGWnC$uwXtp#PP^c8}Xl!}!Ah=n6W1ZjXOGqX%nCT=tu zQB%M=Bq0*Y+SJ;r`_;{xud;o<)`zNWd|kOF3MEpJPDU`ZsdYxNT2eUYS*Cp$+W9pH z1_z#N0f^OiTl=EMDk4z&&HJpOdgitIk1T zdyOiaednNT3>X~tt$=Hk`{YB+ItZ_?rL1q2>*&|FSg>pbli1&}=7_v*X1fE0rS1Ca z7ZUzm4MD7VSk2X|cS4XD;a`a+eeER3%=qHgI3Mr*<*cg+ zxi!!%QshMuQ6wUtga(OzW(G?sqbO2JdpFStQGqg0YeuZQpT(y5Oh;7?%d~W5HUQU= zB68i;L)KYb8*Ccb{m-$=-es-;$c4S_YnyWgVC|x$M~E+Nh?o>BmaJr&CI*=5ve})Fy7Y!kf8o+vUnQkmr;$BZq@WQk z*(Zu@9>+$dd|8Az@2%;q`dTl(IFkE^A_W&&u?ftBjDf^nS>(}2g$0(%#w``U=F%*( zJ$v`5DTB)sy%{>~NF(KPS4Z*FdHYL8)@RjWngw(;0o0yz6u6Ngl+ z0M6XanCn*V_C&^&72XV6lrv&LxDtaOLSF=d-F^wb+`-rcqNTQ7>UelodWJPGH|98_S(rf z?kw3Q=oZgiXwGtn&??s-;FKlFC=w!$j3Sj}42ueb z84-9I)J2m_7{EzakLu|0&8_?X(>{Y_*+?%o7rR0snl+c3kYuJxs5j+M)S0HS8{aU5 z_>Ks`#Hz7>`0k(N(%pQ`@6683aUqlSdl0t17byHk&-vmUa5Bs4L^A2;IKT0iuK&bu zf9QMPy#KTR*FOLtVVxzq=5S3ESZZbxDWf0glC7X9XFj(Cm5=drE6@t);CIQQ3jpIQ$NuK_|0fsuvFrZV!_$XL3+)?ntxRR{ZkJOZ0=w`TT+u=d zpbI&PBhO&p6WAkzwKErd6Vu$6Y}bJ~qhbb8+g%iV$N zvE^7Kz_pbq<)rSt`#diLe6Cwc9~Mf%XBF8H&Gzg8GsE4vNP$Q(N5zLgRpg*ajWsw= zrCKjYxs;{;5c7$1naDdt3GN}67Q+@P1#5>%R4~aU2g34CcZ7}L%;*?^xq6b@zU1~Q z7UMbe$(B3ziiLSDU4X$#@?nL;i2=2%8fY{rjs=MrNWDDF*%QH8aqK{YRh&4*mA)6^ zt!P0TY5*G6mRti8ggbi_ZZBY#c3U|!aP)GgEI(uiC^G~QNrseC2tpKT(+XncZMxWN zF?Q>heK^>yQ@)h*Dv}$vMP+i`vp7#aWWQF)cCQ_Zi+}c;KeHFHBKe^bkMustsY$I5 zAkNE&+~Ii1Z!U*t)l=jl!#m_B$w5DIq=TtvHlTLuJI4Y@p;(EA5JV6HB2vt8a2n`V z8f!{G0L%?72C(g0GwaV89$gy)Sb0+O#4AT%`oUbTnX~)1IjIXZ=qK~uZEWp?f?%{dwh zO=x?L^XQ~By!8C8JukhsVe`62zW+p;%0*~z07$83yp|tZa?9tLup_WHrt6U)M=*to zp#U@yt;h29SiTi&zKkEIP-VG2HZZ^tH76E1gM{);2xZqMgLS&}l2Kl|mls~mRgY1j zm+C&Y7R5s9&srza3gh#r>44pO-Gd*C>=xnF(TXWXCvc>iCQw0vI~QDxrcYZ}U))(&C< zwNGW~e~t(BFD=9;VdZr=brZ&}z?OTkqa+)IAkfV76><1eg9wb7}hC04Tvl z9~|5+WvZ&X3G zoI-t2&dh8s$im3Vz`($eQz|?4aXff-y%|=uWV1Bh^#XD!U3~6}&*B2*=U%ZJgXqCR zxCgFzpjr5Ml&`{ekUod~66$?8`y8zIKy9V2#p0+cHtKHhef5rel@H!(1Ur&4Hp)o% z5haBYUnw_&Wc_vgi&LyR4NWaH39kY@5*MNE(G4LkshQ*FH&jgP(loAZOA;3&O9oO& z{80q%OAGnOWlH|?Lf<`?!NdNl;t*PPF2UAZ4wA(JVuc1%L$Xwg0sV$M$bwWs6bWH& zWk3milw|x{a>#<4C&K$9z=G})kE>0}P*O?BS{1_(0z?V~2)&}2jUNjlAxHp1d)_4L z^qtL}9Vrzvh=g9xq*6#_91#guoL%Hf6eGGMy*4_D$HCX29}Hm6Z}H34^uSRb`Aw4N z!?O)_lB!1tM0g3OKIMwrT|E}GqrKKGIt;|bk|uXel<&|E8|bAZK$H@JW6o=8gFbaf z-C=m<8`JC085&s`16Y67@Wu;A_B?jPPf*5HI6k}*<3{|>U%dLtw_UVp%X((s_0rxu zZ++nQTkd0(KM3A%{Mz?^^ty8{+`4+*M4HH*FYdnc)(7wU) z17H2y@5oepPlLH#3p(+%O&|Tu_ndkDsZz!!2bu(dVZ+OzYu zZ++>``)+^ORm!5_!t^f-7hHDsAN=Rf_%TmE`rIG>FMnE^WAmxUzxP*u;gmB^T)l2( zn#k97?R(&kM{fVx-R&ct-VNOY_l&Px@xG6}H7ZYFg-Ipv%7aE!0)|cIqlALs7}?t zs;=%ndh~uHWi5TW=HY$KpbD9b{s6#Q{}c`uc^DJV>aP_;VNQ!l(_&bOJc=(@n7bf+GxRqD*CGHSxWHN{O_&BOR`GasU7z07*naRCAuk zdEO!m=f9w2ZK&WK11fjP`U-I)-85dkOQoQRX_ktg6dW59_Mk-)gX9CQ>Y zC$(ctR!5+@{LN&MCI|~cjgk?<(#r(36zvaY7z}d&VaTnPN{yFRDrm0*u&?l8%yX4} zWSR+hH6|6VBNXh>7@LPZcp)Z%*ovvK5of1kqTdIr4m3oox0|xi^uFc8~~acTLECm$N@t} z4%m0v=wJTe7H;6$k>iG3bJKUrD>BWEtsB;E?p9kpYW$E<^*GE-edL~`KN1cGg%lhZs=7v zem`50X>MxWxVE8NZS{z8Lr07oI(G6tH(vd>Xv)W*apc+G`}&rR+ge-NYI}7*;hbXz z4Il7}OMc%DCM6XV5*=N!3JGh9Jn2M=OD&=f?K#quQIS&8%CoJfmufi0|9NET;6WgV2%t{<;+*@3-Y|x8(-#4N$2kzmBX5!9F${q#;=tThU5t*# zi4&LWgWOZcz?-V0JXBMeX@LkpOvj8NI7(b74+QS-K@4b3qIe$n9OkG^CmORD6;rG; zZHKIYB~#ExB0|ZWL}S?jbiC|MeybTw@Y?H4Drh#=cFWE+Fl$pCQAo2<8(&dpO0MfN z#5k8zOlEEK$E~a0Y#cbP3IH-yZ0t$h-?@8BJ8Jj1Qx6@p@9^zgcmDP#cPx5uDFBR{ zJmLq}ePi-LV~#%Qpl2SKr9)nF&DrG@nR{=2>Y=|spU=AhFm1+!A71y3Lynm=^Xa$V zpYxGvF-qLK?bEleIIVk+nvdRJcEkU>vtj*KK$w2m#LIti?xDv{esku#Z_S)<2CnRq z9Xe{zMJHd|+L8l+{)6lP_^+QFaQMDYO&GfPgHOfjU`TN8_f9OY$Shs7>X$#fxnaXr zhIsOM#~yRi!GaU*BY+4OU43r0BJ<#FPd@VZXL4`I1h#x@^+^zM@L zl^5*fLni+4`itV~>+9eAisLx1JvaCE>;KW**a85(`}g|s?=KlPX73p%9Q4fnF9kvu zqp|{=_rue>)zvJXzx1YSZg1GI1p%iVHu1YZJ^#RCrp|fg-MO>g)A264`n+sK=7GOG z{^&i=y16_6Og(JhOMmgL1CO3E>*+T>n7hbKK9en*cEps+PrqjMvb6*-`QQoPzwX=P zr|vWL(0%8;@~(|DNqa*r0`7)3VWtHL^kKUw4Ov%>3P|YwR-02$H$~_q@nrQ-OysRy zxt1QO1mA=B6vUSje0dWB7UU$xOEMO47r|8AWce9P+U>9eOaJ|lZ*Jsy!Sve)f@3^o z?O_vBGUkOC`;$d-ngiV`2>kII)Uo^{!_=&Ve%8_`NWx0W#X(2PqA5A!oSTJb%(#L$ z_(htnq+_ai>4yJBPw6sK38>|UZngDGTs1HL81NJbIB?>GOf@51?CCRg+vSsw0cq3GsE@pZ^ClL6q)KRhH5EdYElZ}DG$eJ=nUar`u$ zT3M#-jz2tf&BcHE_iaz*@_E7Tn=ilj@{?}?!1&1{%*=|M7s@L$`%T{m0IvVZ?G5X< zil}eA{N6)%zW@LS9KK&DyyH0c-|?(Kv;eSX<;GW@o(ljIr|kn0uwr>-X6&R90Pu%v z?%c9*J3|J558m~xOdk-D0Wtzem6iSd_xJz&yMMg@wx@DAmjF27n=ilj%2RIwz?ey+ zgq-2zALG)nZu4XRcwQV;NPv(1B?yRTY0D!TRM}?9v%cLK_ z=b6>Z)(S@6e)aulA9x7>CLb~(rfWh4q{l%0F)$1O=EM3>IpSg^P;z**ee^cZF#pb@9oI( z9XZ;WqehonJZK~4va|<|2h1hNbIN;^_sApUzywA`0^|gQM2x@zaEQ?Jz~kU?;2b=T zoEQfrV4N5y^yCLTPM${|0Vm{u98pa!Ox!k4s6HU`@i@7haxS?ZsECXcdcu2w0}ui- zKqgL4AVAK+CmM;^NARv?3`Ewj1C`@nZMgqZ5_ya|J&^j*SJHMJV!8UKoAPAr< zEcij&C`JrK355y0l^_4LJ)_csg<};r{G+)PAd3974u6aZ5Rfwwzb6DxS0ZQ~P{SJ$ z)q|8dDrHUur3E4YxUKwyd$&*hcAa=O{`77y|E$%^k(F_4krANJfL;Kw@SUY-yqq_C z!IkI#&hdqKz+||5#`39+T69K@7?=9VD;xGU}bbvep zY;DcYdu^fGuZsE{zqKnj0zhST1pyl19{^zalGVz(g#_qvSoP`py87;2yLUC^yzeI@ z8#8_<_%lBcCQ{jX2|NLYxJufTXyW&vLjkWf%s^DTUTGp7~8&O$F_#; zW`L!OmIFYqKDGKut}XZ8>kFc}tXpNYd+_bz`OD0oOFsA%&V*ildqmmj1J!54L_Z>I zehXFyxEEwqv7;2U?8cK_b?q?O@{}XOPoKi?0&mO`$epIq@Zr8xlE0;$!NSkuD>PZc z#D>K1vjXjl0JV!qiGyc&(xM71Y*qxENF2WfoCD{?0Xb-EGXpvAAOt`Gf%4^b zJtE)^a~PsPt{#CWHkpwG8NdKR^2PyxhzVO3Q=YW|Kw{Fh z%h%YRiZMSa@ZJ9!Zv{*kCX^H=GEpmd7n@!&ukBRonT=*Hk}WdY&XxmMDqA071W9co zdqx1DC^UgOfVx`{6%#1d6H+7=3}Wg!AeS_)>c5#wwD;cf=yMOg^6BE$MCN!ddKEc& z>QJdX|IjN#_8EM^kIy{n&MVw z4^hh6=l=*o^|xR#iw_CLIQ&noy#yE1n2EB;n)#0)vn<8WqOrw~TcAvM_&Qlh36W%q zRTKRiPdRzyan8j_4W8%uVU!|G>WMI{kvI&2K<-ZyHdz_g_(ywRfcdUn)FCaaQ&qGQ zvMtJS6`&JFNJKk}4U@!75*wW({Rjx<4t$-Q`d9nGNCXWG7y+fEN4UVBQbQ{8j7l7L zN_T;10bu1DP1{%HJJ0f@bCLfZ`?Z75yY$3NwyXnbSn9YeQ#LN(y9$!1~_m7#<4rItTPM9Y_~;UBLi;_7%m!$J^aB?a)GYfZ=x z8OThQW%e^~BI4J+aom8t`wrNEyLr87*SXErr5LuQ? zNC<_L{KQ_h{25V57b?li)7*_58kjmg{VKU;5}Lh(R!^&rAH!_{mNdm#R;+&81$i^0 zME7@pUWhi%HWKe;tKLJ%c8f6~L5Gy5j-%NdQBNhDxCfpvbf!`cI>PoOy#_fVb$j&I&3<-UlELvP%#RT9F9EGmML0^75qF%NUbC+7H zL_idrBLY`>A^5!^e2R#6qV%zNQ4}27K?|!6k>t*w(8Dd61@kJF#e`g~woQA;PFfkU zpXnY55zNRC1e#kbEAi5=U@2A3Y8;8nz(jxc`9-6jh`xx33_0+Wk7+>yD1BP3Z~Bvo z1gO_O*?yDd`ftllZ_y*$^(Zd3g^k8k7%*t`S3d?1>;IiAPW3$Rk3YR<&aC&FcS~#B z@u$x?|FV;lGsW2N2ml+`Zn@wq|80gZehkI8i?5&x)^tHQ$!Z-uY~Z(le5U7lfBNa& zb7sEVxLcfwh9{hP#CeyU0;J_m;B0Am3a&EvOS7-OIUT?N!I5%D4DH1fQ1pvepL*lf zr{3t%yLRBv{(T13kDId3=t(0_yYR#{%h$g%dwx<9q`Q5%UN^1Ve94Jd+G6P3anP{- z=l|#o&-4EBv%BWadbhbz*s9@6ryYLI_fG}CHWIk+d@8;MiwPMue+5t>5=flMP>@ry|p zB{i#%aXqrOEGS%wMC5r~T;|Id6CS}RGDipvO0m%$!o7=3AwvGuj~Enswk~M`thfPY z7rB7J8`_E{YZSW_Ek1R5^IGZL#8P2o9?M+;HsYNgOCoJ*jXw8BswvzEQ`D{|OJ&*k z)4S`R3-8Mat-`AJzI#~cxAe`t~e5k*gt9`eSa2C@eUWkg9SCzbMC z4^SWA?@Kh*0)>@AvuAGEuyxCZt?$f+C+>OfoXbu-_S6|u51sgKJg8NSU}z+|c@F@p zx>Q;#5{+;B9XuWoUVCoNtf$`yyz`NJxIN0N%JbXuAcQzVRhJ3?$mjFXtQw&4Hkjwd z+>2Wf{CAc;2_xT-FnHvu$}to^R(_kK0+5RLN0BLD zx&*(1!f)fjQ>n(3B7=wOJnpRAII*s0f|AwSki|dzP4N>z&xP|a7gmx$utkLXdD<9> zV-S)Rhd4zoYLhm-$qj%POf7PG3PWU=5>{0J&$Q2TbW{f7EFDCS9w$!3q}7uV5GMo< zh$t>WKmw1*IJHT*zV)*Z!%>tUQ4X(kyw z+L17D>}phViX*GQi0Q)=2VLyc$+*@}si>1=5=K4*3Kqwq?dqRMzL5%%9a5h=7l-tGWMHT?IZr%}C-$#@_wK0jeG`9gjS=R8UG%9P$rmdXws_KftL;IPr$}2N{`uFHo z+clYULy?qU8RFK4?Zl~DUDxWGDu4Y2ao|w7YOmX`yfO;_+qUdL*C){dUoyJRcBOQQ4RpxH}42Cj{SsBE%?A$)5vi{bT9-Q zF@7ijG^`I?dMC&Qz7?8xK&zF>QVG>2%(&;~#}+>(*?<(mq@X^PHU|HXIzrl)QCB-z zj*9909QR-bVd_l7kT1UipFK)s(jLvJn3^IY&+|yF&WbrgUKu838XATe;R4G^ZNd_d zIOp8+T+ee|H=obDdDrt?;fH2N@u(L46=`PlU;h;b47ea6EErlRfS!U(WN+jiLDUB*4o^*;GHD^@Xa5bl1isUU60*w#Kiqa%ZgPMvEma^qH*c6 zw3a2)XY4y>zY(gYFj#vcIt8#S$<&l0BdMyo>ZJ2ea2%&wUCoK-9&fgVO4d)`FOnrg z0H6!6J@4}CFFNUh3Z6Ca~ z2mmg+_Po9W>qUUQMhy7bZCBp-@O4uUo2b+=T(xu!0PK6<_;fn0Q=f9!zN1CED^)=E zdpGZX`OKpS?A=%7H07{;k2>iv0C;Ei{OBkh4n59*@h8Bja){kVmOv4lszy=FbMq4j zpeo%j2!dHC2!??qArQlAVIdWkWpVRHaq~$LEZHdZHZE{UNp*yDQbnaHZDRJ6f}hWV z5^Kz63W@#bZk(u<`PsIU-y&aIJ>5d4*{e zoRyfCDnVWSIk!GQ{(aKC9%al?~ zoFc}DKl`A<2G-f#oV5@GiG^w=QlC~{WXN#(CPYC1rT?PpjLL+k+XhrOONE>Qe9~rO zv-|{38BRQ-yMDOvp&f0zym0jx+bWqj%-PtRul_**di>s(Cr;aE^uEJ>b^GOwyITOD zs!KTl%$+s=rN>?;lIxqVzwqu?&pcw#kiIwF_y690Z6QM(w$GrxgX-`6!$aS@_8d$5 z006+lcfWAe_#r2scg%689+qpBTlMe1{h6oKoeqEd?R`T={&4WHet&uB+MU~XBeLq6 zN&tB0^$%Zo>~)ApXpB4w)DRH>-1WzYe{<m@ho(0v9kUhrv`nyS$ghdy}cvu9rT z6*I~kFTQi)*+&i>()W+|{`cFjEkwX!qeY1x{NAyPRO^c0DR;|NBK8+z-rzY}Rba_3XeKllm)H0^Hw z=Zz1Z_oFjTy5RV)oPErWt-CVWbal6CK-j)z$J76Q(K@CczvsCh{ch-2&;8OdUq8G} z)x1bk6y&ZO{yliaj|UFz|N94izH9p~WKNf^l>qSm8w+PX@tX3ZptoLn`^#q>HDE~J z8~%OmyRR=m#G(5P>NBwSJvZKe;nnAf!kfe#HgDFuzx~&>TQ+UWmS?KERsz7nw?CTq z%6rjad>HKA6|w-Z7IwV@Yi;GQl1|82(J;nJU>P-0;^=wG2vw>j2@6EAYNwq}@mz%O zJqm?QcBBtaak!WVtrmHa^y+U z%41|%Jt=I5N-Am?qm5w;8KPob7m5gLqv-0Wb?`^RKyb0u|H`D3kXlNYleR+~#c#ux zl@oA44vYhHfQ$XzVm22?cahk3fy5CII3fy%SuzhYkohSGgfOdWQ%z)DTMM+n@-6yf zIgAfb9(jkV>?qM91(ZG&$rFxrL1qL#K>+4};~*1`7LozA)lKy@l>Q>5s~aUB=r=&9 z3u9oMp!p{xNicYITVgMZf7JxU0*kJg@kAiAU0 zxBM3<`x)on?C0NUX=?4-y-T<5)sDkfEM51&?N9&X&yR9(0tf&ga?WSJ@J@L}X7JE{ zWA_{0t55B+k5~WU>c11fjN|rSzGTh3*$bj2T)%qL@+E8P`}XMCtxHvPWwtz%Ezf-P z{<4qfFB3&;YHWG+nR)55bal6?nr>a(yt`t_n)_~l=I)yw@mvoLJKJgBJPrUJyz@Ek zd0N95GHTGI1IMgfx_0iY4|M(P*t+YT*BABdUE6PP?|uX8ckS49)6f3V){;B$$o-Zt zSu^j|4@8=r^Vgn#r@S&VNR+5=?Xr(o|MBX(2=K7u_Fuku&AitZ=%u-lC@_r$zG@YQ++4n`rEU1wp_|rizU?=E-?@Dk3Ljj*E3gyJKDw^HR@8~`6JQP# zKeOeT#q*bbvS67Q(aRRCSUC5is;*TPRoU*nx&h$EwGFeLeBw3Ct zbC19I;=F7{X5f&1qxT!pvrp~vC97|~_6{OA_)F7PE?ND~Yx4o5;&#&c$0OqPm*3R5 zt7*`%0oC2Q?A*HZ#YbMf<2V0wUD;|IHh!wP?E;xTP~8N%H(_-XgfIK;Q$HkGNe$a$ zRKtX%35Imp2pPT1sK%f<6oU@|{4a*a8~WIDD-gaNk{L~*XXFzT5HN{}@F%hE>}E*S zG@7SSlj-?5ns$NeQ=ad8j!HG&loYZZW+6Xrq*jZLTi|`LLXD1(F{2OEhkGvM?;+8^V?N5Dfm4j9MMlWMoJ{hdfBWY zd0=Q#I^UpcKN^u`^&U0)v`E(I#{gyF1pt8By|M>h)>HT_csY9cXB(Qg>T5;)6#UUo zz)Z-E%3g@R3MRo#CnrtGe|DtLxu{!__ zV-AYlyIQ&j&mxksqHh!GP1Ou2Rzhbe#*t}_xNpvF0C3hp7v|O7V^Ml<{__QxQ8aP< zQN;wa@)@<3Vff%8QS;&z7~P~a8&c=H2x6%$fZ1cM>4ds>fQqpynt~<1SNN}rWZTTW z$T+?+XpfLC)Shtt>`3C6xK%Dni9w4Ow8iE~eorelMlq?y#4@M!Vq!%?qHzqCab$q` z-LwE@kTS^2GMP+SS&F+UE`=LM-ySKAxiTGO0sF9TY9wDIoAyYx#2+5}2wHfXJcDt} zLHIta*g{9XL}D0o2m=t8_&N-kgQ--?anq86r2qgR07*naR2)QN21GM%0`^afk*k${ z`vhlLKfIobL-HgF;MIhrz8VZfLg`{z>mZTh##bm8L?q&Y=Ch6KFmJ`ZN+4Z7`b;=m zO(_XkyZ|UE0Q&jL6>I|tnKMo*7%R3p2q2Ya6VB?Ux0ZeM#10?P#>FD?#Li8|e8glJ z{>1<@CL~08rX4Yc$e2*#H~|qC?mm`g5H+6IJkfU)10_%=SSZan3Rj|5v$VOo_*4~C z)hk0!)s!SO9CI)S1qud|FuSaJEUO-sG73gr8S*|bZV*a2)m7pPvDkH4gJ)Km*T-gp|gT1!U_SPJ~rL>-%t7vLy)oCrGMT|xR*IJQlKv|Lh zFd;q2Kd3|)h*dob&6|87Bg7~{Q2!w^SlA<7*#?SYv)QAjtUXO;Ny!w%6mHOBDWFMw zzGN6ej0c^TcC<%W&_HLKP<_=qfuEuju!Qca-Q{IYdv3NUf|<{lIu~7Ie2axBx%>js zn7l>SqHL;XDRzp`bYo{yJ?6k%fL0D(&dnfY#o9U|0%yR5HI;*LE*B~DElT*UkMr_T zED#BxCxaO9E`Z=L1n6z-`XLIRG-cq0V2*x`5@=?n{fu*TU1AJ5BZf?!Bqpt4$|z>8 zkfU}+kaiL|3yQ+(JLwHf5tvwfBax~x8&Xc9B1Ll&CW(*I`Qz7W5wM9hKTN=s77S28 zh9$qYy!9*7Iu%5jOaQf^L;(oAHVQtqH=e2ZiA4=kwn60}LWFWtXWq-_a=ATBDyD-NUV^bUWm~+0`I4EspF5ese09>wsgM1_ zPXfE;{9pc&s2)Lg5h4=Pr46D7b(`R0e-<+zTZdu7 z4ANPnw$$NY^wKDR!GHJ+bTwpcY3aTlqx)zJq6H@dC|g_Mfrdd#ZKv(g6-Gb~0NP%Q ze)_5=h{*H2TrStr(t?PoR7&We;?xgN6|EF8&?C5WrL}!Qp-@d2=F8IAvCi#27&U=o zA$S*@ze(HzuF+C(bzaZDfoT{)Ek=i&e&bq;`R61?{Z+~Ss& zTIq?vb=@|Pr&6g@D$Sx678LMNS}WvQJ*k}__wTWIL&aM^M zKtI>+i(=-H*clNyFb0TB)`YrJ7y*$Pe%NG=|5z9rU@a0LQ1%W~#20Ol#!&&Mg~S># z(M162pn+?HnUy-n6l19kGo=)hm)3mKcx^~2r*M&0cdFHqRGLrh)}i=+Bgxhu9Dsoyx303SW$IUC<9Hnc6p32WvSg7b#XO4HmYDb!4vj50SB- z6_so{ERm?#&L46I+*ADQVG6DC$56bvtU&m{h=^uXbY(-pLnJQOX!RiU#CFI(vL3)XhWO^BGh z@{{15uMO~l)GT(#kUdxS^~lK-5M7E7jozgBOob{P)D{w-iMzye zZZ4P0ct~Hw~W2rPCBJ*#YR#sh5*Ol$znU>5f0;RS436w~v{+eJ?Cmm`t zD<4)%f*B?XKLLbt!AK5Zjj2(IU*e>mYR`IK7%F>@wdCQBX0%)wV#kCu-WFM8Tl~(X zIFOjchb=mMVKy-Rhf+IGdFXbMP;v=JGsecUr7ykibd(Z%VPbH7Zm!BGevhdMZv(%B zzl@Y3ym14r&V$kx-5pW5R`9c0&X%VK;i5=eXON&$YI-=6T*j z%JDq3wKBj=D&^~!YUYq|wg?f}iCe9WG^5{4a5_&S~Tz$wXI~;{dVl`x-@jM*T){P+$9<4fk zR3nUQ?6~^hZ^F?rF)Znue3ecJ3Y#P>*4Vr!gLx-r9$d=#e5h2zff>9wp3&$b30k_n z#lu9F9@uUQ)PE_sR`?~N$*n0{d^ju94*gpUOL3BCkGpe-Ol(y8LZY2YQ#b=*t+G5J zA73-DE<5QhNW~L|`S%eAAv1!h=ZJ)A7DWau#R*-H9E6PWASFO9JWUDm#9g(dnPQmo zu^ckuAl*$#s!9fGOso?M3L3)<;YT+6vJY#Eu}y%zPJ#m!5yiz5AUuQt#Ue0(T)LLl zG-*>K0_4O|+)km_CmBOAzaeANYOAzdZZaSRtvkyCzKVpUIT}zk(8cPd;a_h9Y_| z7(GF)6@{N$Vi&c8`2XlLrp_GEW_xxVqZgxI={?pWM8q=zV@hh0mMXA>azHm36E_i?-AjZHGX0i(!17SjM=J>N9+z*e_miufFxA}s9F6GK*+7wi3Os3aYib!u^~gcwCU z5%ixYh7o9 zr#Exz(qca#1+8Y4u=|5)6;+5fPy>+^0`L6wL;asRL{!daTu0@AjB&A?jKBo6P(==q ztZr41K(;=vmO+hrh%ae0{YX(d7_x&D^&5`U%rS0q^0f{9AR@P8MuB`8L_y{o3mf5V zF$8MK7T8=^E9!1<;l(05JY#@rZ2%RZVE_z;LjoZHgPfahY;LA957V-Dma!CbQmD3@ z>FrHLX-;-3R`>+4Rj6dqui;cFFm0ewf3_hI&bq|s(J<0Fi+Y7KEVRfUju_~F=y%Wv z#{~M;s02>LiHPLmUjMNn6h3=sQh0fxQ!@+A7_ve3@N^uJB%cvQH^g+dybWy*wfDbH zXkThqIyQ8WoP-c()?nJBrafr&|EMsP3_)WO=>WwZnI1Ww5dg$IDJMVx;9MCJ+5kB* z$7PJj<;-Pe9w2h`fN>|Sg)a9H2^i;$hyfr1W8fg9P~Izv#F;p#2oQV^-rz7cRgoA= zEyfBU!*XB%#}JGOrwX73J^_exxfDRv2v%+UiY5oXk|3Q#5acPAVqW81Y$M|w2^mUw zD~=9D1mFq}M~h>YoC3d$uO<+Tb3coM#V^vRkFwG6f#WBnJ*Mpe5+@PUOV~6~=_n?s zjR9~d8zf>y2*UYLJOTnjc_|p_H53BnOThGX)c}Zj&&{{EjFThJghp0|WvR66JCXsZ zLAI~mi?s(REkVIP+b|7}cU3cLG#WZ9nNloRhXom;Aln#yYkf{i-wmmj(PLbMCaSJj zRA^Jqy3#D*XF)O*i|U4cyMqzK0_A-52(8acAX}8MYk^kZip!vIutac*!P{}hzAtR7w^@*fganNlt{69lP?%Dq6mKOm zsUvf6$6Yhx5+F+`io6WPPEbi=M40?xuYqFfMV!7R(;+ZU>0*JNf_nQkagc{y=E%vB zg9P9Kf`g7DEVzIUI?~OL1GrpVbVLk@5g-G`und7SN+G7uaR7ig$SHwP0o>q;I%t#{ zjg~X5JZSXqxTZ1fV|Im5O!NN6FSS8T{3Iaa+z*FLKvr`>(nvOPZ?3L%Q9qmzfH}-z z2#&JXs%>Qc;4@2r)~}%=THX}tiBwXs$bO8HM^wyCk5bnLjT*O}0xlnzjZ9$4#qU>9 zr!^yhsREfjO4`m+LF1!EhL$e2^hpKctB-C7z~kKWJOE0iQl96jr2|T(QmIsmIZS6~ zIDHZzGGq`uqwWhvC85by^TEG;AQ%&bzZQwgsHR*g zq&p-Maq`F`0O1D7fT8^$iqCgqx6qz*+28XvV+m6z{#?HVEjxL*`Ig!Mz=-T?E575j6=x9CD$OzBylZsn8TRIIrltcCz+i(>V0B2 z&W5rGXBh7zTc80-r6Mfz!u<*mkOL>lncp$uETkrl>unfMTaD`k?~Gvjl`= ztQHXL`6YQH-_o9&6jfEEQLaRn2CYvf_*zL#;(r%p>C@9W=8*ESBg?jI^NI(x#n@}D z8v&Dy@m3>U5uIe85oO05T;8zNd*JD&C7s#5b6uvqsI3#%&4Al8af%J1?qN&C3R#qQ9JTe!h_7!hdeOeDEraInf=p2qXFQpjoWXS|7m<%Ce)KX1o;rl^iD-Wh_pPJ{ltW^Xf| z2Rn{|s+U>}HS4@v})c7Kdu1RI<&$76!h7?JkTNm;*8r8JWfg(u5lrqOw% zfR|*l$1AtwnN67ZA|0 zUCm>Y$VOx8&`id$bf)2AYY zx-*&uz+zSHK2=%qWqng8x%7oddGF}&5NVzwS#3WHJ`x2{d+NkA$yBJPk}uFe)UQ^^ z^&yAKApt$l+p%qzPNJr^YbbZwKH9aT(-*l=wY=ij8cIpB(sMT(Euv{e+s-l>M;@$L zymIY|b$tf*o;&kxjc5xb5+TmL9b0$mpV68xm5iykgDDlDFCS4Z5bdTd-dztiuHWPa z-}{P6QRBi;8DriRdKCA%hR2(u04pvr<<95tVbSPU1R#G;k1`^}WEgru5O&cjWL*LY z#S0X?XcKxcSwFgu5KLyZq#=2(EdUX7z(H9%sLrw^SvDCO!LLL0RlSL0NB>)5BU4P# zlah(r`z*;CMww0=UUr*@#-I9coRn`5EGm3Xt;Vz|#H%I_6Nq+0bL+w_yE7>^wO38X zajMd((}(uEVg9E&yi!Ss2(Fs@ae2zw)z;SHcL<5q$Z5F6(9UhUzIWmeO5`w1ySDE>_waA&pAXFa zr>^-gG7ajRK73jQ0BzsNZ@hC?WAkUa0ki}}TYQ=X_dV4(Z0~fpYBsQMs=lYQvB9FK zd>$0&)g=|Ko$d{VL`m^+qdtFol=ifO5lugeq>I7UR=;pH>k_J^a0~|YCm2$$VCslg ziD#ve1LZ3>sVX~Be{s20kT^jupQ9Ek1EcA>m02Rrhn1nPm zNa<4{ar64dHl&UYn3&A$ovicoiOV{OYXv7pZ?jk%HOw|y_BBOP?sG+)03!Q?$i#Fi z@HwPVa9x@}r?&WGm?YCl2w}Nq+|Mc|#h~pVZY-)Y#PQdjcDFd`LJ*sj+E>E!^hSN~Lzpf+T$ z?JRrYo<(P+Q{24W4nD0>64Lo1TALLW)z+od5eKo4H#{gA5GbPq)1GMroFK==sYD#f zW5kgmL*_6{F$7?U2*CBW5cJQo1&gXe3d#AlrPxx%%dk=kY}6lGzeXoE4e!;|5op0YIY02po9hp zy(P;xYbx4kXgo?B+>y5dBW;vNGX4*yXCEy=-JvK@E9UiawbkP1<104lGwGJ>XnbV( z1_Wpp>!+$eUq5}+-d!urL{{x?zF_VG<~o>XK*+gtPUu>exp=}p#|-MY0DNQS{AsIR)fXeM9)=ZxrgNZ-00ZMomRzkF@c&Jw<@#;^yc(y8OmIO^bIr}Z1uhltj!Soh+i zvz~isrZ%{OYSBIedYy3Av12EXs_Rwjy6&n^R=@oCt23XNt%o>CW2KQ_Ct3*?9ip-#Ovj;}1Rl;M!i@ zw{6}&>&e-V-1#_^5f4s?yO5s|MyMz&6)Z38Q(p1)Wi|litO4I>z@3_)2}`A zMxcOZJtt116Q+;5>d#l2PZrMm@S1P^JQ|V!1`Qkdwe!9@bf3NI>g(LRyJ5}7*Peaj zx%*#eX>Lu(1|xoxCe_q-J?R@?-S41@b-ilyd3W`))h|9W^QFgL(M8bIdqDjOXMcI@ z-YZk z!CYHD%0Q3q&d@<=0Qhv3`_WQMfFJ$#vgt=meeS^*Z@KO^vyhD8T`%6+t*+*$7yatJ zH{RDZP*dCWA-#K>TC0PclFZMFFgA4OOL%0t$^MGdVlqtFOQu(rmk15n|D_( zUG?IlqC^21dg6Z_f9_>x-F@S~-+F1z*_WO%df!pm^6c6bYahM)$yv|57O3iAU*DjB zY;_e2=WPh6g8P@_UfIJJe&Z{K!T{1i+#Ki0S|Cg1q&E1Sxg)qTAfFQ$c&tclHLFSAOJ~3K~!7B7$;^hpbQJh333E^kKDXV#DP4< z9LIq&U}dQ8*ySDqmsVZym@+HL17m|)wirqJ@Bs*n5#y|^xTSdu2(*@*0{;YqDAR|= zt|oWdiXqPrllaE083F*NPMRQ2luD)2%mE@n$wIG-FCO*?!88HjdUewdwDDE3?sueJW)c*ERVYT>4hX zkU5X8n=-sAEi0{WRrdT*{d1gaP8h&9M)g0ke-9nEGUbe^?J}me%RfI^|M-fH5Rqpy z`qv#huqOaiq_T(f?f%bC)+ZOiBss0AMf_Ac^|M>97&B=k05mtY0KkxugNKY9yzlh! z*M0x@=6S%Q#t*;d&p*gkWSg5>Hmupyt+wmP3ByND7(RB&=-*xWXON9f0cNGeGU{?J zJ5J9&J$`xD)!ln^1Av{|c4aHF!^RFBHg@RfNu&OB)nB5_pL)?L(~g|FaPEiM^6Y*G zPdw#YUmLJ@zu#Z+Co{~zp#y$?=QY`iEOFYrVau?wL$A5@swe;PbTqXQ^rE>;NgQV`Nc(D zx^{Wy-sg&{`XJ?V`JLOO(vnK2D!Ww1g&e>CxT|iu!f_nW^|o!^?xdVSLkA8THgNKx zldk>d&)Zsa?Z~}npPs+I`)8`=cV;WH!^aLAK6coc$)o@9lfYKLkrPH-bMsF`yKh{x zv8J}`s0kxRO&Bq5%Glri$A?SoMR@+9m!=;v^`K*>-~QXXb8UW@(fjSwt*&O*_FW&$S)d>G>eJ&l_xvJI zqH)89j~h02^61}P8Q^o&gpt?&sLkhc;d|PSySgT^SQyq&)fyMNNOL@ z--G1ug-RmMx$C;z^R)Smh`TN^;>dX_l|uF078`XwK{Kg35FrmzNH^qGut4+u`b zfgJ1|GO1(4a^y?MhzEk*YuQX9ae$cagbAD#Lk6gg@pjShbzM{2gdP9@-yJ)+_LH*L zH*DLTmv>ByN>nR_Smv;IHti7FMAx$P#2#G%VEOi)J9q9(r_0L9(jb-q5PyB(6oF`W z$UmUl`B$9Xy+^mj?=QLO>RUFi-+~BJ z4x4oG&o4aSnCWv~o;PpS+h*YMs`9-@4!-=9AGfu(5mDbky?^tsUrs%I%7_WW7tjAh z2RrNgXJjj~pDtQ{!w>(^uwe^h?8NiFa>UnWh#EBH3|@H61=))11Al$^vA;i&&$|FH z^{`2o{_49296f#3ldmn9>jNec?dVgEc;MEDpZw=DqKlvKUtd1slG9GR=#-gH%xaAo z%S~lGAX-#s`ta?K&YK~5AW9Zml8!IQ82nJB~B^nb-gN%iCL;S^%K;fZkW# zc*XFsLk~Z3#?$vc8y7KwzWL*GyZ7k!(R+*kc-74f>l+Yp>Ws$&GuccwbKp_aE;;!J ztCp?-fT@R0`oV85oiJ_O{xc@O_43>h4}5m)|}3*aP2qagI?UyyRyW zW-GG){>uXo-T9cC&jY};!>9i6Hg%Cy=hn=yTs1S%&a;y~OJCe;*U%+dS(q%Sf60x<2D90r|{ffiSi z;wgT(>!adBrx{rKcEkf13Mq`f{ae|#iyS)zeQ?bdZx^l&@Eutri;wo)s)jbt1AwY@ z>YMuvynDukUril(M86&kq*Wdjc*uF)pB5~?>4Q)I^uh9(>$ZsaYZ{vg(dAxiTbt{7 z2+*&p^6&wD0ANE?^AQg}^`qD3T>aKN$3OOb&k79|TM!ulRHU40wf*JVxr?7zx#5kC zTd$wLbZ1*00J0A2R-PsR0_vVgPwH6%09#vg-+S%Dzkayt=7pE!K(9e-Z1;?E0KJiTg@c=G<{T{kaSar43ze_pua&kI+~-LzfS5kh@M763Liw|S(l z3`FRs&9}|1LS+S@K9$l!{M!1he_ga{!M0s*ZQ6e8qSfM|wjXybOC3L`9spMEYWdMy zA3w2T)2#K|{GFw4dy3dU?&(Vp~ps)6x^*&@W8~fZK2Q z*P?en7Hv0w&WE>LcNYL0al*l(ga}ZUN#F6ie_eaw_4oblk$g_V=(k>ad*&0f0btzJ z(FqwEqY2Gd*^2DM>Ei(4k3YG&Vf_{YAcDCs&wJvYrvPC8Bc`e)3aPR?j`PS}kGHk9 zib1?~#roM#zXkx~r;QUy5ET_M!c))l7`2CeP zZeHIYB+ZmT6*i{xi3F43joGV9iwYh z%%NqO^uu>PwrZ*D=W||p`>A`M1%RoCPV%c>67}xk001Z0xY?C*IHVL2z3|A(0C4yT zhl&S?kV>capD_ghOb3AS%Iv-eOaOozethGm^_u~J2;O{Y?jv_S0RRUaIZcNw%cSr4 z?ccBY&UN?Q`k+9x0PyBZbA&g=_$gze^}lIdgGRIf@W|hv*t}s&d1ZFQ*r9R4zrIeM zxU^}rXLLGQJS8LmDBLvR?h}q0OYMPjk!}O=`?O+hz^iae?Pp!lgAju1U#WpikwG!aXQc)Oqp*v-u9?(4c zs!+9{Ev`&KU;0agK5z*RB%dJ!2QdZ2h@7BoT|@^Exj36wo$XFY%KIWP z{M84|4-5W8vjU?ylK{B-i1}3=5l>ux2TsJf{Kz6A>h)C3j`FNFq!5N`U3~~hzq^V!%tm(ln}jV5C{qCsm}3K!o+pt=GM?^wM#A zch9E9lM&sjMs%w>tY6(v=PhZ?yK-}+_B%lUW8r>HQ!604p2s;CjdjF;zT(xb3qIZ? zd<2O$G&QZ*xqEb7Hvm}I+{PFp`bTcf-@0>6bE`-{&uLrE?V3pgK&$78J&BWg)rgRf zFWk&sJjmUKwWvJ%s~KH*VG2aKC-@5SpeV= zFyHp6l!*L=)tj}geoLz|54)o0@afT-L5w4*ntf{@vH#hsb#aBF)Nbi!QNZ@d~pr#QB;} z*Y@aL=bxYD>#o6q%T7k-qhNp}YFNLyYxk}r#tqkC5dgMr-nMP?w&WBrX72B)YJS_M zZDxQ^7AysTo_%|OIxslbmV0ORyU`TZtyl*DRb48h>3{V8V)NnR`AguOFZb%#%YQ^t zRQIe)0l?Pn+;sz0W_pRe{MajJT=?~IlgHHcs@<|_8vyNlz=W#m%8hF`eX?+=j?$xE z_oc0}g$V#)$%0P+pjV$BI?Y^L{_WZCMMufnmFvK7_du~e{dk4>n~1Mkwz@~}x^8tf zaZT5&rv$Ydw}cl`)X+iyL5K{G^H5i6ACfDPO2dmCVJQxhU?hkw7b+?9@cdZ>Kkc>o zCh%+o3VE7FLSu-Z;>5at=BtclA}aZw^xTFJ(y#;~Vu*+g5dcw`Z(R<+xr2~GNP&}P z41f?h03sp>@`ym(hk)oH1GT+aVO9vXSD*~WX$+An2!xB3pE2>Q z*+c?tdGe?)2a(B>e;Fb&A|UXjcL5qrXrzaMO(&pxnHkV5M)1h^0RGeA^eVdEPHVV@ zno;%f;6@3xcM2L=MK+TMiS(a9HfBdou$;@cq8kdW0+g}aERNqlbxm5&4kzQAnQdvO z|18|P`#ZBfm|EX$|N3s@d(>nd1^^?vRh>S(@12WQOB5bB@yrLct9Lg803tdL^N17C z#GZBH)x1p&{%s?O-Lqu?(3p33=e<-a1%MiNF5A(FQq=-PsLiASpvCoe=3KGvGOR`} z&@bN61nTmUnlkCbXFY~iyT)#4w4VJQK)vR3;Ze}goXblOR0NO*DdaeK^Wm&284+v9&dqY@sbuAeUv*0MN9%$$aSM-H+b? zBxL+2qHc9HhkR*zp8>tnWoeN`|GoNx>YAleD(wJ3Rdv&1GhZ_00$p49ROZ^=5=d{etzrK=5y7TY$ZDGz&`zZ`z6|2 zmnbYZTO#fL&p+Sy>;o^XSQ6Xr^>rx#*uImuwFRDk!5l#&Q||w6>Z}tdip&j??`qc6 z0geJ*4KlC9Jhe-s%$kTmADStouJHL`jHetaizw4tl+ES~b11UtfJLm4o6GwE*wECb>qT$>+SrmqdH0%+i6h6*A^`MOwpDWz zm`Q%_jehjHY*{wtgwk{n>MJuK(6i7q5CC9HTmI$`SE?)#z;|89ru>VyHMyJ`nsYLK z(bCpehf9#rg@@cRryPFXWv6GdWzkn?6FMRP7?UMaaFk`zV7zCtpRxQ!Y4hz>xj} zhV&QD+gjTmy6usN?|iJ?%$H@#tX>u&I{K6&&%NxdOg6mZvx8LMQ_7r8TYQIFt5@Rl z55Khk;ZtUO<&Xz&f21svnRM{J05CfUY6TTpqGL`u^1RDSC{fgswtVr*<%?Iwh3{6) zGGzb&8#jB_of1iTVbaf-6p9!50gH1HVcM4qMD2|KDfC(5+Nh1T0LCpoq!Cz5#=iZQ zLSiWxLxEb*v!)J(2*inqbB~BpDI(>x$T{~sag>#=J++YRcLX$~T)R3)0bFZXf@4}R zq4)bfv}ErCMsfctCL)xsHS?HCvDB(s zV=qvj(JVEhwO6%?YZD=j(xD>HjW&$V^�=%;gIvkMe{{1ZZ)+zb#sMVBhWzVs%*> zgv&YS$WVIfA^=hE$}9k^Yi8zKx4F@Szml>m_A)RK1vJR*Qe^*tFP0Ib^Gm6T?ZbMJG@=dDz=bnYb+uD<;W@IydS8YK}}0KoEd#gusH zuzozPYjFSoVBNBB_U}H>s&z?^{@n^o3c``_mhZP#Y}+j}vuWS1{nwpyi_aRKmUzc* z9d5X5x@B2U-}~IMxhw1vT{>aCF89*Up+UHqu3~ z50G<({CTYDiWPacqJJ1Qbth&j0aoGo!87}CrvYzFX~h-YALY&`0Hkt2QQhN{Ay96? zCQG#e7;m2bD06`2I1OUPY>0OZj{h?|E z3=;g!AYpOYexyDI)G|%evN(dI40c2t42ky zTc?=Xyk`Od+MWB0_(l@()-SlOROm#3I{VX)8etX8XJLNpj)3# zrfF?jznKRcK4vf=Eckfo+?k8D;y45i^LZ&4)AdpAAA$&c<55<22A86$h8){M5#8w?1GK3O_{_9E14%BAl4Nj`J~ zblnc3N)3Iw2TMzg&D+eaJ8f{&QZtY~&=2l8cyQ0b)v)Hnf6u)7_A4e#J8SsZp{o|I zPArS;PNC;3Yd+I2jw9<~V}=64!jBivo4LT5aKc#Wnd$K+`)=6GtaJc~#p13g8EN8o zJnnmmo#2{tKIi?pm)>&mNn?j)=VgJ|BF3dQ$`Zu^AS)-6cOR$slY@qj83G6kK3+8U zqxsIlIxDGz;J|%gRJk939HREHKdYX zeu}g=;0e-0eaO2*TrYlt+nXH0T67B+X#R&xc}pV7-B>>1iGT&DELI?_0PfV^N>dC169&oq{pTi`m|Pilx-Lp6W;0Rn~t#wle5CzlnR z+o4s4wp>1`b164Wu0C*>F=m?arlu(W&$LWHXf4mT+H)it2nNF8uwfXA)t{=x6!_+Z zF%OOyeD6sE=T1JiI88+Psp@cDU0r>BeYByWO;$Pp?5%I8JX}*(TU%FGTUS?C92QAc z9BJUTIztvWFC1bPl^l;3*dm}p>s(k3R%1^^`);WT*#9{>y}%9+}wY-*P>Wd_!1bXmbaNB8^d$ewo(?vf;B z=A=Zy_U_yV0KEr0uAdlo>cBs~e9yJNyIj3VOOF6R)xpEA=-j6^5k(uLAl-Joba3Ax zN@+%RM!PO;fE!yGW56P5kyfosa`JO|F&qY1X_J-VwYQ8h#t!W}#3;)v%+1Nq)(2I) zu5I<2Q6;Lbtahdktvh&1rh_jIza_E_DT{lzpjv*LI-c zhO~^d(zebLWu*C*sEsTUikbT;DLa!4>JtKh>KeLb`*F0?s%{V9m;xQ|PY|i4#s5dm z5=v@O_*8-&8($9cofovdM@;oF6xIgR%f%R@l$w@lSr)Y@r4|*$_&?mRWtygCS(GK5 zQj<_>rIqfx^3Ty_q(LFq&Yi{m{+vb1)uqK?~$geXdD1? z!@*}p_r0-C`(O5I`ka0Ch3*gROfRW2R{~H8ow=x8v>oyZ%qVF2C*D`7#M9 zh8E}DGo;s}BL?0*e1J;!r48b~uIy0g(w<$e=-IVC9{+0Z0siu*%BmxEb@dGmc>xkO z3;@`ASio6MrP6>ZU0qpCQ|w6GCF)QuPEDpT zdbZC>`@`U_H}&bj{{)FW<8GJ7<=)z_?B4$2SMGcI!@mq4>xOaQ z8Dg$)jIqXs#&1`D4*=8exI%3Y>OG|AfRp;VlG^^`P5>Bu%0PV=(XcT?dJoYYe9;9n zHN2w@60`@c@VH8g;K(7;WfPe?wKNrS)f1!i)`xGpxkUw$qC z?A)@;H<6016#y`P@)-_oTmFgGN55XW4ghX@*?XA4^xr& z9=M^S2L*#RK0ayeus%cmU02PxdBIiZE63lHP9JvmlrsTf<$Sk~#J+=Ks_WOYdEeIR zLx)!_T+^Xj`|@^W>sM~5uB>+TsK)xnwM*9lz^@;zR{IAFe`j zALyZ@2kY%V;`HHthxP&6{^yi|+=}4&<0S;V`25UJ5CPze#SOaIK6%8WBi9gUY5FM^ zDpBkNf0F*|x_bZsAOJ~3K~x8T1c8qyslMUrB*}#&www~>>ziP+?~}9Cq8jj~)O_nI ztC+CyIU^(T4gP`^#wewhX;~80O2kHWP|H6umfC(eo|j$T6Wd8Zo|Ppmo*pci3UMC| z6c<(4I9_2i>H=%cAld|+`gNG2sFzeKR6kA3U05&9Og0}o3Lvn*ZWR`KvW99^C20sd z#h$Nq8e5VD{AILmkYYfA{qx&xw-4+RAea{ko~~VjRoxW-( z*Ys?=e@&A-Hj6QU2FqG?;4r_$p@BC0AAf#aqr+Rk$}-5JAHb#ZB5)*edI6ewz!lh1jq^o)RwaS zjZO8jc#>5V2dOnx=laad|9m!ZRKGrhd;Ia`d+O^N03ahP9RQZkUo+?Z1uDTMpD(}Q ziV5vHw|;iUW2+W@jfh=(cWm9E?B&1w=eCEgOVpj;|M%>k1Aa5bP;;kJ))yy$1Do@1>8X-85Mx!Wb<1eA)SzPiWh@&0pVn zZ0+K&kznUuoyt3uz52u(H{E}|v+8{GPS={5{m1|T(n6@Tp{6EQvD;FCRLwv1^8KZ4 z#g%v*VD%W#{iQGe$=}TQ*ZZHo{W$CgqE|_rfSxt>XHTv(1@2kttUi{N5oqBX^-?iN{A3Rx8 zRYMFTD<=~G)-3t@%Ma$MNodLEUroIH+_qiX{%yuzRxetEh+TSjZr!2$<-fdo>q9qr z8XSm0mVLSWsTqGgxUVuTJ;Gb_o8=pp^P3lJln0x)n@uqm4q;h|aq9521|;yIQj%40Q~E*mwAc){^8#oC0e|8&iiv!;KiSRHSvn`+I4CB%zIC) zk|k=>q5P%4yn35oiBhLf5HCJ2t5=s00Bo;_FI!`4q+&rb1^Mi7sYx8(?-K)P*(Rr> zwFos^3?*w^Z<3{OyzIb7ga14*u0;{m(}^}^b5}`ib;`qq{))Nf5>EofLN3ZgWMc`j zsznz^KuKxG|3aa>GawXz0aA*L`xzimer~J9EFcyM#8KFMc?JXtXF=Zbz!(EU_~Bs; z02s5c|3c6Vr~*6!7u|fnktYB74B@N>Kffy;$>qIjS0SqK%<*14GQFdylb0B9&m4Y+ zDN+W&2vA;BqH14DNWVT8eTIhK6sRvr$~pi9TTzgIc?Pq0bTh{%z5k$37_T#ehwQ!q zT1)$c^YEs6nB+k29_QVTi4G}0E5`)i41DH4006Mhsr3LU)Sp%#IQ+Y%-(AqDv{!z1 zb~w;vv5F&&D-Rt0eCPi9xCH=6AP@|+$w~JjTAjAn)g$m>g9P!zEjwrYw9TTFYlR_V z^eD&$fL%xG>rIm(LxlEu;u77>H8pWY`S=KjgKe@h0N`M>$z*^C1ONeNY~I5F#Y5)?d$`GLFq0iuga}(}>wmv|J)+Fxxk&(wub-4t7}`_M_P^7b}FpZ|7;qd&Ua4k6JGt>MkMdH)T6 zI(ORmQzwipYgY;YTYlI+=lunrzc-IjdnlSQ^RBBOy5y$G!%rJ@&c)+us%pPk@!j9< zeW9>8-%}_%tCb7aKJu$4Cr>}GZO8K5e4#2t(jzMWeH90OGxe^?(N%k6urY(Te826% zoBo`go8_vBSd)48)ela)>7t>h4L)n?_?qh4Z&!Zz-2E@)7w2j1lWu%?cE_-SJ-=CfBJJ1^ViJP-&5)SI;Qh>G(0yK}a0+Hv0H=XC7Rp|G?d7LD!N zTCryF+L^D-u034qw(K$lfYpoEJoc-{e=+@nHXU2%$YXRPX|^}Z{)z*?o%*|9Out~z zsDT9~`3?1r8`o``H*>-Kj}};zqP!i@jG2G9=Kg6nO&NCDkO>!`RZ~^7e#N&>-}@YI zcdirby^atv`^`_NWsRRaF0UZ>(EdYoI(@4EWlOK!S&_?RK*TzpndRn0dmHavCDvxOxE-eeP#CNBXp(@Fnc;jtsq z3i1d5RM*g#-Z_%weq1l^@|zBt0fGr|ZAyeKI84ROfFD{o>RcQPzlqaHGM6BDt0r-D zZ&JsGMD5A(#6wyDr^}!s?<)xcm~Q}dJTeu;Q8_w(v&FA%%w=a#@s8 zMw^1X2bImYK$FD$}7;J~XfCI>@em@4B+~#!;u9Jp2MC7FwR^s+r(^q+))s?p**0 zLH51?m@@RzSS*$#w917Lxbd>=&K-nf!^SPK=U=N!be`j-H&2~3{lcYlmOXy^lc04i zADEKhQwyw^%@0h6E_wNdS%dq^lU4RwFT7cMxX#CqFv)oLvStgR1Ppn>W$IA%s6eed zU+`mFebGiMID3+34)R7$D&>wZ9Umh)hi>#P;fBNaPYZqeL#R zOGqNq)JHUPwzwSx)lBCcijp1QevuT^CKmY3O=5bbCJyI|Yjy36xl&MFN&s5>KVL$> zAB?r|@&zY!&@>IgE1El#$ghk>qqIq$Le4}NutyoC?4qt64TAu|5R$${`R8_O2LQFP z_&?YGfB=Yc6P4z#9*IPB~8-HeED&zM8MpDSm98KTV0-5$?{^J)cj(xlbyQsLa{=s=kwEn!+1JdSkl6CGHpu92>70#pmCs`^DMmCk;#kWcv_V=Mf6nj30}kcpB$ktntWa?_DN}RVKKS5}pZH4OQ`|V*Exl2?Yk2C>U8hlt+=eH zzP5hN(yv>{{?9>&Yw1^OqpQ|OlUS%vG&zJp;;zb?`F>nj(ei3hPJUhOD7v_Rk4^mE zH?RL4u-ZY1IX_|2zCD4<0dMX+QX zN|{)r2LMWt5zAtx1p$HqL_!DwLO`zF5^(wia6VL~OjCsAVY$*&EG@hW)$=!$G0&0e z`Wjo3wnyn9EM_5rxa8sKgh>?0-6zz9MX12UjGM#-MANuHp1KCAZ1}1*iail|JW){l zI{~O^@o3W4MqM)g_{=>h4gPkL3K5_xEY}abC6>`#7(qPiKDCMPx55feo2bB#3;-x& z7BC=akN`8#1PUOI%VT08*w(R>uX+c$0}KF~EV`@i$oyTqU;1v-fqM5XpaH`O2SdSN zFc=IPl*KGFfB=XF5+s5nez~ex0bo)=6P???jJ}jK03ReGi1Ziq*WOMLrJ9!)emDEo z_0n&U_{VN3xp1u`7t~(p?n7LTs5hxMqmU_}|90xSLa*1M?(rj~^Y|&giXZn&&_*4A zR)A*Uu^$88k?b79+E=$$pflzg`YO8PF8dU;c4muUtk`G0HM3r2>8=6BPMvTv04$xe z%rdPM-CdGVbG@de9s7m1+@8(NC7BYREwaw)xuoFBdR!z`f<#jGj&<}Xz2#G|EF_^+ zFl+PQ1V5e+iE8dd$^H}oi7y020CnY;8;$r18%$6J9RWMyA`@Pp)b?jZ#vN)!N`!KJ zz`&$n2+I;O%J1Le3%-byn3S3pP=?GP1{eky04B3w32m7PJ_KN7 z+@%5R$)5pISyH{cu7*yuElG(+CZQ|}#u!LkixQCm0&J}(2|J9NI!FSc1BS|YH zUbJS;-7i~Mx0iRs$zz+T057aV$P>U+OP^9&^Y8pW8+yZ&1 zJ^%nkCa%v#V1!$;5E-RF#Vi&yjF4gQ!?1z|2@(Q44B-L( zT$b|_qBPwZC2~LmBHQz z0@4A%17iJPx8`c;0JZjFdXjP_BF$3kUlabZbhex`kj-r~$?1bJsr$a)YzL|N)Y?uh zj7dEU%_cJ%ZA2u5U?3a{2Ev@(K)?ux!tr>Vd(bd`1_c5^L?Dz=pu9Ql&ZJV6Eyx(9 zj2J*f7h#NFxNKUM6){2>2t^{1fDxd~q|`z}#E~J0+-t`m1npxr90hkM2rZOfZhOPe zEC0ONDgWjZk{1Jzt1KrZeTTNHfmS(=ytR9@^(|6kN|kP5k$f$XLP7GYe@A%dBXbQ? zbl;clil<;*^E^6bL-XL?%OTh66Rh=s-UBu5FclYVy%(jxkSDvAhfF#yjTZlWre8D&2?We|JQ_2D zz$_FO$JNK1n#`DGSthkW2^uDLO;Rz#xzHhSoP%c0WnXKA9;)1x0q3TiC8nH zBpN4jW;}`s%rW`usWnfjTP#vdoPjoD+Ud&{^#S*cIV`n$TxVseZC(gOoVQGfVFUxw zSW`o^F@($_5R1iPu~-wcnwZHbql^;iQ^0NO41qDA2nayrTrO;}ApYZO7!k-6C}Y&J zc%N0S4kR3m#p4Z4QLreO6buYT!VFY$_N*g48WPl?n&my_NWu28LE9FYE|M?aC0b1M z<+Isbc>o1%ld|cuBjQo@TNx8T*Ei&Q%~#uY6me?X&e7?8ZNVo=;J(#Kr4mT5ffALC2x24LG6Py9Ef&z1hqZFQ|#^T-k4G!N7s** zjjR^owbW2;f|W7tz5T|ieKDW43vV4J9#hQ~=BUA`lhH&HKg#?l_keEA}Lzbgu-`3DMtZiP}NzI z{;)(sS0q3P7=VBTP17`~X&8h65l|Tc0ppCClm-YzM1CVGNyrxpD^pOv(L#!vHbogS?r85E2T7nxahviD{Z< zLjym;gUSshHOt3ceQJt@!)(q2#qEYdd9j{~!HdL|(ZB z0LL4i{yb#w3Ox$;odZDIA?h>s1hfN};a77)MP$Gz15F|(_ zrKV{SL`sN+sp3!pB22;@y-P{%0s}24CjV-#qV&GN;R-nP0>-O{Q7XKR6`Zx%lg|t# zvNM z$Or@i0VEhV&3McL-c-mK5#D+B$rci)+9N>tnkd7D@Ii1M10QEEbE$VuoQD zfdB~v!{LZw7>rTMkl#S&bOQ%lolH_f$8XfnPm)Q45#dUSnp)I%yPBnXf0@7|cr)!tEb%A=MuEuF1ToIq2~J??EQ zNjfz*Wcc^z~PIwH;E9xTzlGm-a z``#DV>T(`zvB8)oN~mQ~M3WfIKn`$CL?nbzN-3oP1PM}VS(a%TB*0hh8E}`zfDs^u zy4*k-EJTiu**w7(h89#yvz^N}lsjYDj=z#5V> z^pc|IL5~4R$GC4M@*ms<Nb(i)0>C9FrOYPc)#j?$_E(Wru)NGy`{S2Fh449Lmbh zZiqHoO^uW?$|w~&gydU_HHNmY3EJ-+XpCv9jl*zc+WG}go{nwFMk1OtG` z*B|(*gJjdL4sQwFEyWyRe-6^JN;uS16MFgbiq4+_g1d&R;-w|=-A~TXc9%~Q&i*LX zXf^Der@3exiwD2^dE{D^T0PK)YD>wB^*rTp%;Mg51&>seL&a(2@aBCC?cc19k*K}? z50Q`1#f1Cr{9<#mLDexd`LWS40ZoUXbtKyCSUb*y3dZ_L+h$_6Fe6URbN`PIq;)8# z?z!4`Zg31!S5Z7AOQ3f8B+2|gHAAvObit;M)Kbo*S}ytwjP^IjU~m{58AZMri%fIe z<3ba;{~!Ydehq=60^}77j#QZxHk47z0t#pWF)4|&0Huay5lVql2mmn{#+VU@05XFx zB5s{z01PNVkPx}WjLGCFFklp1b}^Udn&%-=#U^~GCJerfOCBf2boeBJj|z;oiBaA! zp=ua}>m_3h7-fVo1H~k#rRZmrLB|B0#JZde^rb{8Mr4vL6@@u;U6&CdVJ-U#XQ$AU z%0vKVj_B9UDpk8vaK~0eii|ND3Wq|WpoOf_j8SHa>q3P82qNQFQ{m>S`|hAay|cxj z?|sD7HoGg8hf>NKEgEMrBN#{{>7ct$A~1d^7?F39N%r+RbcnB?ae78uMLVYO-l|Hy z6s}d*X3_O=M9YcXft35TYf5Ck{n?cOGE^rTifvJHi>cCQ1=0||DE_^ca@uO`SiFW!~)_KtNuOQzpn1r2Xi`X1y^vh5iHVLv$agoWf zN7?aG$6MYYsiMe)gs!|(uO{E0iBj+zYf?@&%d0Cz`-TCv2qC6VbRNeoiO!#rRJQetGLsZa)BVhz!Kq)XvAz%TTlvrR;Ml4FG#VAD+ zFaQ{*h6zCe22yUpMWBd`GDI+lLBNpL=K@k>>NF%Y2$3sG)OJyAwy}IGScyH~If)~B zO}W#~n^h_YA`tZ~YFo@!j7jZ~0WiwlFoEz|b5xv{GnwAeK$+%-w|`*2*M96dQb&DK zb42!H1JCYHCu(zzZbSeux|a0z3+s56O9TK2DDQitz$l1`-=dTOFvd*NWCTElu{{s~ zD5_(Mg~y0u!d3{0)ZTcn`yrxShOi*Mz zZV1kQN^7|xIMLLYXj$2{#?fqCXW$b6YJKC{<2yl)o}a$qP^jl9`h^($; z5y~(c56ZborqH5tCBPR6NXoPX{X~?c#DS^{d1mX5|<^_WS4 z24R4*wPss_Iz>hjk&m{J(kxO8s1mKtm0(n=jhx0sLMln=aNxMvOH8>+1_M8;p2I*! z8RHj`F~;~WE|+;2MlE2J&wB`fM2UEY2$p5V<8kCS9>|jDIcp0$2`WNULTsR_{RWTR z6Lt;ea{{oKRRl&A5%m>i7oy`vY=Vp^>tM=V(&Yu@b_()KCSi~D2>aAnu*18%oc-Sa zq;ux;T5p*(*;THsN3Zn5Vt zxj^!+d-5KythtCl>@ztK5o58KX_`hF3lqaI0)z;yhB153kV^yb%r_z!B&h>E^ojRS zXwi)LGftnW_`V)n2Ff^r9zD!IIA=?lWrdduC%eBfA+_u^I2B)Mz`{CuREMgjSiEFx zz@aVx03ZNKL_t(3NTK8B9-+dhuc@m#E#Se=n>=}Yr;=TwFj_f}f@dFJSlNuJuq0Dy zx%a$}jPj8uKhuyzP)iw38Rf9RslX{;mT?rM&G}BZwFsM=O$ZV`uW5sO3sVBODY&WLd3*9|*u0W0qy{?KYHB z@eTl}#hpw!=R6E!3@AlLP1E8a(lF#HUm$?5X_^EvV2HEqn=Naz6`>qq^|aJ8O(ZYX zAQiY&T@)o(mzdf*FI5H!V3_89oEm9r{?Fe%weg~HV=EQ@93?P6JGQcEVpaLFdMQ9v z#*C{iwt6OK34RQPRI}sbA-G>{NkC^+(# zh&$?n)Q(hX)EfXGNR;z9N7{j4Fc1g^1HqsX;5UhJwN2=2&N|YrWJnD4-3q2#xQ;C^ zn%1p6M9BMF_I|i+ud5WGYF?$ooXunhBnZT>jVS{vMu9#}J9R%TRi>}HqSOBEJCC@| z%xZQDc9>$06V}tzQ}N4@FjFsmM6`Pf_vk@(4(?`T`g^Gz>3Q0^JC!}r-rs0DZRqx0 zpo&*l=h9@8c!7@9DMSP$%pnQokuSDR%>g(W+Kt3<>?cGIlpSd z&e_(96Bi*IV;z%(PlY^vgJ~8Z+gQrf4th1}ZM{x0!fQ;MvPB-QUL+-${9mSN2eU+q zHgJ}A%G+`DK0}%ChLIdA2j%P%9te%{YN5eU+j*uA(cI+xHJq^JV-#g*q4yQA-GyjXwRHFV*u{XWcS7d zIq5U0&ZjRrMgV|-mK8(FmmE->OQ5_w0QfBW+UWx$0Yjw_r*vOK^s9YU?`_>3V+?{J z3{$JAF>1yM5`x4+%9uL%U8W>4x0f4UG&SIS{iq0{K?uLAj62&BB%xq17zhLnLz{?M zc}Ch_Pwou>%lB11@y!<5A+)-2KpEfq@u$nWmGgS&TbT9Xw!KOZ^^M}`82lb;Q5t?P zv@1gf48XGSkF+<7A*rV+HC@{Tqc7wnED3vi=}Y0Xu=;Jr%>#Q5E}gUD!`D7(IMV11 z?=Dkf-!j86W~_P@04^GSbvzbNluoj>asM~&9G$Y5*$T7&)%wLFzh=-U-J%+$mCWE%{Jrd)l&spCf$ zX=C&1^KLn?=YTg!k8vA7H)1JvAb}N!IsSDh7{2IUph*wL*Q!HX>QZ|W5-1pQ9#&ee zy~3b$Y$5(-o@h^>hy>)qEiwQ`fDuMnPG0uEWH2eTtf{UwfEmaLGYmoy7*RG* zN&%=ekuoMOJCH~BGOb*~qZs9$bWpAx2%2zXpl_s8b;JM=C;-*oQQd;8Y8J)yQ@|Lt zC_{qC2ms~lE$XBwWr!4M%X(GI)OrCDkk;s~pDhs-&g3)*=N=0Vl<$4%2%3a}1fK$y zW%2un<)kmrtTYAL;y5oH&=D;F1PN)AnLed+`mo}>TNkW~n`XI?Sd}rnnqh|8+ztv z)tlDLZTnpzefUrEm17V2!v@>}haie;qGeD@Jl#X`YcI6hqaq1coDS?h$hY>TrANxz zl}?^MarkLN?!4*&KU{mFNiSGSN0J^_06ZOhBwFxb!e>cH57*~iTPld0QNoc>aaoZW zH}~$^FJUiMAFNg`xSBj^2Ip}pr7Nz?>0!p-HG>400J56h5M_T#2?AYy+qAQ$j0b?) z!*z@b2}><2C7gOxk}gHED6OfgQ9pC?b9jy^xPN}22MhjWgXV~QZDaHg6wK>u97rEM=$LYd{w%q`gZlLmz+E0 zOaQ1oTt^*aQ;Ve-KCZ*T0OEojXozp52ur}-HurIu+?Mq}|< zO;wFhAsFNqWZD5Z!<`|ON~?aN;IZgU_IAcPP^?%d6^ zG&Hr#_6rm?F;(6aIHrt&CCg?>M1sJB1PPtSKZ;dtH)oj0=)Cp>w#bZ{i7tq5Q#vr z{vN#^e<{Un*7H~i^AtOr`WGF)Q=sP3_u5EWEV6vL(O>EoA-|w476kX-{OGRjyN?~^ z*B-9BY}|F~=ljdv2nJKRZwLTRp!`Z`+?Vf1j~@vDzrXH*^{c-FeIHSRc&-;M7x;^Jh-!I?*vrU1?no$DCr{0hw78-IqIX#xPk>cfyRxgQG=2ylGM836=nEkW(a z+xLCG>i`e}1kWzbpWdq@01PWDd}iHu#EM7FIAsjvguyf|#IefiY=D$V19RNVFcJu6 zM$$upprKCX1pwjT$VxNB^7`H*QRVUAI0skj!;Y6JFx6<%<^%Z?I{(%cDRKTEB1J+C z0}TTSK_ud65(@z=z5$eXQ`u!DDA&uPQA$epwoN;pf8^!+|8eK&2_s*6{B_G}zJR{< z#JpeK!~Qr>(xjvlxvj%{)O|N!cDInqm#ARI9P#C|)RJWc28_r)C|~jOZ5&bfS#~Nx zw9`b{rn*G{bu~plfZHMBl{mHq6FPHn7n~R*J2wjee%!D*Sw*HuEf!O{WJ{@2BnsrS zZ&89Pt^4VtO!qyvCr2%eH?Cp>~i{ME(dI8sulqs~;X-(%uj7tT64 zgmrR5g73#9A~8u4%@@ViC|i_y(g1`YADbID{N(CXsnu=bSvBcvAFm2~cxcL-^RI-& z{D1hhtm}o`z2Kjw*axhMIRWwbf|n_F+Au~LWsEW=_eFq7S)4M$02x{gErtk$@cj%F z_{B|Pag zQkE$|?VkE5cTOOHpYGVtL2Xtzbi|AycMqTx5l6Qvo7%lo|Kh^@NVq<3uCF}w%6C7` z-?^Islb(g52Kp8iT+y@Z&{oC8X^|+kzBzE{rEfPbsMzb`H7gXF)}!-;_HD~E)AQ3J z4W_lfA-d||;g7cOZL}BxK!6Te>3=+_rz_$kC-qRzTWjlozhWZ*Fu;sZ;FZz+0N|5d z2j=WLIJskKul($cfU&=!>9d^&=InAfFg-H7d&ley{Y}M@=qfIln?OnRB>a{Tg z0by-r^|PC{1cOKnVi?4-D5XG8|vl6%g?^@R~Ntj%)86x zt-9=%i+T<09!ZZ>Y}@nU>z^$8WT`AV0%ISpeWR}C$mL^ioOIQ>W6vL5P?BGLuzKFC z#qYiRk$Wjq`N`?N9lD6rh&hKL)4aYI*r@jW%g(vtSJU47`@75Mt(tc8MLh>}PfL$f zY}+&QjZYSSx>QZd2=L}&UiRy157#ji!e`Po=TEy~((JcBd+{%?>ykPrKWFmQ=MO%4 zpjPwq=6tlkM$_U*Xr(17_iio{<)wbMD#=6XiaR<=so~9xtjr6pJa5=(LyB4znsIa6 zkK4a^@5{xXE!FFY0i1u?IhWsh$$$R-_VRfvFS&VY&jCHs(jyhycF%m{<3*n>kyYC= zN@Sh#T1F8uCqL&GS4|u|YCu6rK|F5m+_LM-kLJ&txj^5K#{-wPX?6ak=kyuUtFWXX z9yfRVv~%vv`SWKlk{X4e_gB4DS99cw(|>vPl<{Xx8dp+Ye7LG+@n=ild2vRpDeg$q zV~B9FEB?LxkG~o*cGzd{&H3kJFX>3$xB2Q=uW6FWs3&w)Ec!l|wQY65rRVe= z(z~#vz>J&Qf7&tUqxoOXTG-N=Q!h=2F6|~?bwQV29g9i|&A7RzV&B5gmVW&1=Z&)L zDsWC-&PCT;Fm%*FQS)1Neg47RIWyGct~Q~4iR1QM@uU+D`WDN6Gxmjw76Aa zJZ^6Nar-Cl%~|l-5~l(H7hZPmHMd>*?`PloYW|8VZ@Remz@Cxx$gXX>-+yD)f=`z~ zVr|40FCH!HlhyCm)f}06#`GyyPCVnh(+W!pst#7onYHkpSKc?Jq*WYbWTjtp<;0O= zh6z45ZU6YaFXjueVAH2--mR-SGUfDZre1ZyxbsdcEGam2u~6QnAwk0082Ynv4+!M1oqv2nB;ON-53B%RTS1^ZSh$m{*){#mwE? zb}gAbcgZL7(N=y16}K)qW6F8m2KLS?F0|ri#nv55KAE@lv-x5Zg*clZo?r0a`r0GE zIdA%D7oK_Q#BqhC#dXy+E5BSi^WQV#O-)W6g8MRv{rF0JGwIdCuW`Nh{@)Hdb@<|0 zbKZOUUvd?fA!CSm@0-tO<>$Wihd*vy^)*OG=B(V@vC}T>F>GK?QGppZ_if*~;*)tR zznCuzWB07WvR0=~IkWuBWMwPdEbmh8# zZTLZ@&?YnE-E&TFm65LAqz8-+*%=+OGlmr9-nQuLCW{gZt%`N8DId~Z5z5nre?rWp z4-e^t;H@LepCzqy2uIt$$K)AgR_D7?J!7l?gj6i@8i&E?4qTF%iMF5Z< zh@4Vd@Yd$No<&dBgZe2XRD!SIl4)W|o-_Cu9 z^nBv(f2d&fbq$BBgeOC8el`H8pFE_SS)6ybCM-QBO-GyyCwSN4Lr`=_At+oiaCGCal(YD^$ zRuj}LwVcv3(;t5E-m1##^(($D?@-pETf5sHx*;D8Mg|@#E-iZOmHWIk z-)Bg#C+_~cC%CQPNPKG}R<3tV|J{`*jUA@P`Nzzs^q+TJ{)a>RtN3$He$JyWKTuL$ z3;?y&b!i!q9{s!b=-<6t-)=Ad*;ZHV*()>skryARs;pkWazlCh@($hF-}cZ=S-F`X zzwIgeai!wYqDNkOK&z#2w?19E_36@QaIe4J>)0&Pqkp%1p1L!V9%-m=+`DUEZhmf$ z{@r@?@78ZvpC|8jZz}lf6m*~+K{Yo^X_mlUyOLVVaiTV!h z;|j?sBQyPvFFsIJS+#!UhVu4h9lEvu^+Pvj=Vr~;+GxPAzIXra4#O}k)2gbhHVmVE z=XUM8v>P^h$h|i{+!SpBP)h_yISaW=iHVNpNlrcccYEOJ->b6c<>&P5-@Rx5?)``L z`ODqU935i=hWESgso(LkA39ha2pAnYx9f0AyWyjU{NaWNo1!rlvbePP@s}UuZFIP* zCM`YEy-%0!eY*4;();mylI5Prn0v$Tt{ypdxc>4L=T@iNF8h7u{zLpZw;<=QFF(|( zyaWJhs%z6S(t7pp-m8E2o_)JL_otV<>1Sr8KmOu_Rh89WuiVh4eOae&?QehRmh7CY znQwpU%bD|R9H#H=Rv)goaq8%CBfeg-A(9>$e#+oWubbSyQ=3PA_k;+B3;^=-bDntR zVF#ZBy7wB;y=T8}e}Bw}&ns`b_>^%YzFx5*O{Uq7r|Icw5}1j8=n~&@x0fr9Dg$5l zv?xKw2xTn4xZvLBAIK}r1Aw~2wc$v(W3Mh9dv)nPsQ1ecKcgq!xli|-|9n?CEfTG7 zJg|FjPF`;3KHWR_>E2^dpBEo_8a(SPXIwO4(v6o@?XPTVjOG;=jGuO1n=b92y8Y3k zIEQ4>%sGQj9X@2t$Pb=-*)mNa0zG%?*DEVOx4x$Kr?u-rnr8A#if(%9;p~Du0622E zCY%;&*Q0B@9$h;R=>6tn&*&h%L+>8bAHFM`7Kt`AR_@uGm6zM0clQpxyLTDT_sz$i z_OcPl$hhgrhiVU1|Md0x;x^@FojXjs^VW>)ti>OGqQZ0?)bE;y?<9snEvx2GwP6^g z9otRl*sk}8A^*JN!B~^TU>-#Z;5b0r03n0{a6`SowEz~Sz`!s9ganZLbW*XJA2qG2 zSR90c0d2B`@p4Zz77mAF@i;;JpTT`OqK#VCmpgV>HAaV*m2}O^0f0M)^ndTit<_C2 z-b<%;>wN2g-T+`yHgDJNJx3b)7UmBuDFlE!2KSq@qhd#`u;e{3axh1iZ-$1!^ zx*gxPc-g+HW&5hrgT}?3%Uh*~0bpF);)Q#J5D6J%jf|Kb3idC|27tW{Ha=FMyevHe z03kw7D#?3&Q$_rU_34e(i45W0K9QKVd7dJXD92x)AHR##T5 zufP1=<@rT<-+#U7se7J3u%{9bhL0KY>xXYR<*X53&0V>C{u-X^3x9g`g+ILt0ER){ zTlp#gTsz@cF+V1onG4+?5dhA<==8V#`Tj?5e98-R;g#oJe(RJ=Zkqh%%!Sd0CRMid z%(TuuJKQ??&ZfpD0BGI5^sjF|GUD{1JqC3B;pqUP`Y$HBdo05E*akY7D?FW$Ck``_+1R$pWA)-S>z1u|mIlt8Jno%;&6xSd$Nbd=SDbh0%@mda|iYu1jON|4Y}>Xn@%}%qd|A^me7>hnz`uv|>YN&4nfU-8N{_w;d z-THJnW8#?EIt)r$b~mLkm@uVb0RVsqx7~L`Bt7!xKmR*JmVLySp?5rb+vqb#&7HmI z>*ed4O~jo!z_jZo8-}sq(Gu?Ya$v@d`5KaZV! z`taTZdVITXqqoLbqP`+eaB`s}rY*x!#wwb9gk>_eE4+Ap? zj2b-so?C{VKI-d*E7mPqp;Er=cQ=O9BC}t4_p>)Y4?JxY0IXZ^m1S9Cc@Egbo3G9;$lJEzhqwRyY}Nis1n50#*t9!u z9yn&y`o+t?U8-aVPWjD^;k3vXue~$xoe!+I34nc09)9UvzZx)R)ap44e_Z44OC!!3 z|HbR?E}Suo|2%EV#0l42a^_VRul#&|leEH)yL>V+jIZY{e(&iQqYVuJP*`4i%|my# z>(O=CSz~qho18F-FHK?!SaJ<5My(j%A81+W!BBcI%nYRb#0y3P1{S4<0bp-K6GLRc z48{x#TBi%2g#8V%f^bGA1TrI`%X@YOfU3smFJ^tQz2*oa1PFQe+%x(Y6$A(wTvGJq z&fSc$Ai>`b>I(o-%bGHK?)plBApbaW=+y3=0tCmkYt4A~PB<)r|yeDD4TmaRd+ zU?8xj^3YEQtNRt^GsZSn9*Uar2nj6TcW8Z0BSGw$pT$A#y2{!YzTYA12tXZG3(#5` zUzhAT^zsiod59x%>z+Yf0H8Q6q^c=K=|8^P!J`jvmB&Htp8BXm`D?rx%EXTw?cY=R(d(Zo z)<1adq!d3ea8Ml#6tQiT1fdhLgKl;z7(xVAJeEpL%C!JALTF|vmmvt+?)pOTQdqFKh z`wHK*j5J>Jf4%G3LkFsPBYrh^WxFnIru_24k!K8FHh;BkV`qwabmk(lI|BfC`kv>W zzV|s^QExAM4FIN%x-!-j*OsD0^iViBe9RC4c>2EQcJJ5&2$Zowa_EZy03ZNKL_t*f zvln*g*6!>nXO0>_!V4M>>^V5|KOd{CKYV@m_(^9JwJPk=r}KJVcE9>}QL@eB2;jNQ zJCYt5II=$gJo$%b4;`rDwXkg7s&-vwUo`!~kz_mK&`hll0(~njQ{=R zNAoYeY3kT>PhI@QG9Drj3=BVQ2mmblY^gftGc7%B;E4VJ@WkEE9y-89B3nLx<%h4g zy=eL`Mw~uefLerLIQX(&B6O6f-_YLcR;+h*=>2;Re)NXjMjyOB>&!`K6tybs+NaAm zD}||;+veYYZDxa9iQ2ns-#s@xlwXurS93(Gesn%JH{2aT96!7H#Qm$Mg+pE#!fus%sZE%VEf7p7HtF#ybXZDxIa1Ao7J z*WTY>|4>0uUR})*6)P=0ZP3X60PyF#pBC0r#+J@o(Y{ODX}_Fw@);+6r4*0U#2^EB z{GMmHiPtcUnJeA|fQch6i^XEzz@czx#F$|K@c2E??A*2+04zr5%v#W~Tl@2;o;7;> z$Tc2NyMNDt_a&kQfElmPnlNcxacN<1i8H@*`|i0P zFFyMhrw<;{|J$!ODn3V!83q7iiG=} zGynkpcJEWQ)iuFDkW%<+{_@gJ?IvC|X~3x`ty#1R01zP<3eI@;Rm-xzU-gX=wqGw= z{?%s-PCjRB&w+iuU$u@gd&fX96#VSXnH5`iiI9s|&3o_DaZ}IjfAWwuieUfHxog+u_P8K*9hv zELk!C-L_|3I;r0&Cv8}|im%@p!O%zle3hE5REHr6j*vFeKj!_FGpWndriUZd)L z2NwKymioEi-I*iK9iLZR*se#HAJ+;kx}a4F0L*`PX0)M^zp324?;p26kW-LfUsvZ4 z0|`i9K5i+H2vF(05szC9@upZT7K_D5Mpk+xjS-{-!J@!eS$c%8i|=lTQmzg#W>`$& z!m9dMK{$hj(ubGl1qlMcE8lM1QB%i{JD?1f?b+YIr~m*6F#v!uHlVnuC@lg2v$yV4 zh!y~zU;o|K+ByK(P$^bIbHgD65dd0cq!*+|DjTCsRy<~zs~h&N-MxpGIVYSJ4g@KH z1q=bpB--B75Vh-$0Z~g9OjuO`VBXFH@=^w@Y7}y$(W2n&Qv9#dbahf#ldD-&g6j{} z?v@&`#h|(=&cSZf5{L8;F3RO!XKg=FEtew?H^ufgGM2Y@||4GfWESw+hZRd1-Q z2_x*NJwh4L@HqhJn`GtUpz=e~EVz0XdHjtB8Rb)HBqu)`0Dk&*%RB%2K#irsRt1ER zs)N;)2deaC!c7}C13+4jA03f$8SI@}T0T3lR1Z^y#I(AM9PlwYjip4p_^p;KAnYOjSVz6^dMNw%%PC+h{ z`z9q1`Voe@fr^V}ENoRMYu>h+1K`FDTL7TAv^ml81ID5*Oty;J8CbV_aHU~gwZ0D9;MXd^R3v%`Dca+Kwsw#4r z9#t(JI#?~57y%gL8{mqx{uyhEuU@j&oAB=KdjKHQ=`PRdhi`t=Gu-&ikLO_9h+D=^?27bh}p@R&(&g(iAwJP+!OiPcbifxL;S1wuW&8}kmZUD&0%4n&RFAslU z@4?*soF4tUZri*=eL7TGb%@VIPN{h4VD-TRhjb1$ZukkDQcsNn&{?xO|+O+Zxu+1B{X+{mClx^R#t60j<6jyy+$!_1g zOW%jTYsYQ?$ScTG0g77{27`gxnj_n{xcQto_3TnVKDTY&C5p@#0B|UrUy!Tx5XSI- z?!Tc|zplOCl6l78B-NuIsM z0ATaCKaK+^EGzZ`JH7rnoVAS^o#YT4u(fy$7~$ z+)QN9+@b;`r1nr%&A~(Z#JBwiUZP^D46t}p?7J0fQ68GBl+y#eM41`hHmcaXP5((5 z-M4*bUU6Y&UalI{RR<1c=H;~O*=_e$dmPmqs;)Uy4XKg6mAK{8MZh2=7K_E=@rGDa zG~Q$wMn*6+0E5zWVQ1af5cM@uA_712D@NI_x~Rg37NgvOLH91usZ1TJ z;0d4{WVh7T>+kc!K>&!FR&6ZK8>?%sm_#=oKB9-r3K;;4d2Fz9i^;Sd1S z*EP7p9I2}ZfKWK-jUM&1(Ob{I`~OjQ-EmSB+5f%jp4kk`0vlKscF8#h$xDzN6iE^k zF%iUwoH?L(>gg%!>3OG~5%m-ViIQ^$0TBZTEIBP3+1*Lq_4}i`tEDyHW-Ko)}LU>j@{vI9lx&7ZmT>w6{y2PJM>-{N~>a0ib99 zt^i=1(*giW^%5mK_s)}IB8f@PBd%JFgpXTEpF z;#iUDKEk#1sY(^9uGOMc1nTL#43pZAj>jpei1ZXag~(h8wT{KnVBZD zB2dW4)<+yuga|W2h56u3Ig=q`+4*$MuaMy3wl*m#EZ)C$Py1e-yA8-)`q=^%uw8Cf z0NA^JD=Qz1Cdo1Y#3v=*^Xjtz!1;+yO5jh$T1l#&+@WvJ8nx18uZOL}((1ZOMSq3Q zjI?3J$6sw*vg+*7JRWD;;#GAXZE(x|cXb;+;OwyzmrkEOd-TMS{XhBbr^NmMk|jwB zDN1>Hc}37)5ey_HB_$*zc!`XJAXongI>?hHWuZ_A0Vx4MlEE%Gpm6R=IqOMvbeMbm zN;x5f>NhadPp-ng*Z)rDpXZvr#=xC zLNrelih_z_I`?h&muV++4>X~;+xku~DJu2Gcs^M6W|eA5zyEw(M6{^al{d!Is#EhY zb#k4k5>wIf-%i*OEtrs*>DsgKdP1u*ghzGb2=xqj7JOl8b~JGOw-d*H%X2G5M2f!V z1+S}&^Jpv641S_^x)Mb^w>ApPj5FK1e;VhvyfL1Z9i3}Q+`bra%Z;}`Fd-(^dg9X* z-`wQ-L}uwoVd|E0ZMU6PEn3&5Pp3XZdwuiKqL^53haT+!VAINN_L$xnZ>x?i!tlvx z;4L>!4pSm-EN{_r3zdBQ@Cgmk>VfN*Z$`v1caE%6KdVmtEEeeZ`M>%1!UZ3HCnOGh zC&N_SXnK!HTkIYwY;uD~-FW8%6CKNrwicq+$Ie&KuU)zk5O2L}WZn8%b%nBj_2IW) zf3(OF*&E|+6GafCKm z?vhXEd%WHjUD^S_-u2tWJw`^d*V~|N%ZLef9oB#NJ(IjK&Lwi(RnVlOKKGsdJ@4%A zc_7HfJ*zh&V!sI^)3dYEv$b&)@cY-y`*!VD3oExaHm^#ei6)npmzDb}{DFWh%gNrD z*qB%^N**Kt^xoT$|}kN0ao+|)ijuUq_CJrGc#&@-GA|N?))X~Q){$HNy$u%&q=P* zy;izMA|29e-rch4`#&A=$}&T=%tD;uONG)46@CspsBk%5N_-46X*gTvQ^H+_Y9$7j z9rd`ibO#ZlV+6x%M7bV_v}T+a00NZy^b2DskS57VtisNf`6-oDm4re}W3IVrQdLk@ zRvHO(KOnkJ(Wt)gqr?6*;14eUdiA(_M~=DcrXRNbD8^)w&!4_Hb;KiKQgBW`!XT~$ zhv0@VZF3W~Jl0>L#uwuaJ_wlzMBDsfx-?P?GPs~ZvQ7-!cmZ?X#^5l5IUMCRf6s`A zK;MNl8O{qJPrK<+gHu*CV5?6juy2kmyy8+ohdWBbh^lZ>ESgTjPJOt=Jb(J)^pOvR zPa&sK_C2$wD2np;Ise?TVV8Di9>TD3gYI}}5@*uVX67Y}9ziU+d9`E(PkME-jBiMd zH>PFO%xPFBD?78@4Xs*tY;pUHTTdK2y<_7Zk*jm3FHE`VelR0s)O$+UeKMzK=>8@0 z%dQb3)+Dcc!_+G3l?Y9gGDtS{@m{5A8Xaf9_JvT4@bhHmi}E;*E(pb@=$X6K6EsO#uMd znbXVXF1#{%rcgyddCllIIAzw)9yRkWRZ+hB+q(z1?(#7iLTS&DLq<%U%qvf?PRnd) zn;Zq&wQ9qzRU1;$Yu3uClbV&;sD0~(ZCebUa_jjMrw;Ad<5mgbDa>puJ|I`h%Pago zUoap`Qq{zy1aGXDNHP+F1Sz|}i&6l7o!BoIE|!#+m6Tm6_LXHP$0f)T030eTE(fI? z6dx!lFF3_t9Gvea`AfT!xLF0_POmK3uMpIfe9?>A% z!ndN*UFR=-^7C)6?A$+n&DI&~Gz~}7lxndauh-*YI|Yb7LWq(z#CtfC?8Pr;%WhBG_0Htuj7vO=loGvz#kpO^~V0M)R zW?Jec(&+lyuFBbR4b&)Ng5Fh zX^6%vj)`m0Kr{2zKU5HfmXh1#lLldEc+n-4T?}R$`k_#WuLM}lCss`W0nr+l#E3lW zys-mnlmSj&1am?3D|y8>LNMZMEyy+#;}YX66_SvY006pgBYP#f^$An=ur{JYbcg1r z*1P}!LqP?!{%PuU_AEN(b^wHp-)~vFY*Sg8kD}&n9duh~7NUm(0K_H6i-GY;37{La z2t8152o$Sbn47pSc?1Bu`n&Z2(4}{$_Fdb6#r6OI5cLt4XsLPY2e5N5twigVZYnRU zFlx+Ef^oDJe((x!T|Ae+d-D$qKU?zb%s(&v&-aXNa|2a^ToA3^bFmKSDH}@nsQ^P?RVV zibMsX0Qy4;092`xsGt-=DF`HlQV^v8kN}VX#Q-4t-nx4SK-ji=>-y!JORo4r6ctJ+ z%KG6J1dsuU*bn0qV#VnwKGBdNdJ|hDD79N1fGC{+H!WKa0PTBqZgE390NAl+v!a4Z zS?Q1>G6T{0q(q89kqRF%BLIY!-8urmp0%5It=d#k=F=}@70$XC?1>>^M3YIL6kNFU z(~iCCzFGX4ept;3aZ~PbxK#|KGnYdlqR)rZ=CtJu1%}zo)gaL zN6>UHYm`#jBdz+oJ=(n5rP-5h8=5i}_h!Pd9+paqO4lvf3;<*993h71pTDfCYC=*% zcEc<&i@5mMjI6Y3wsTqlKvjKDlDI0s^DhD6i^+nEW& zZ!}hh{1!$4$iI*u3WlmAC)Li$6yr2+*9-v8pS}<|V>=U9Ma*>1(TW!l@-OoKSx3w! zEB?}>O08o%`J$sR5Zn8>IVwJ?MeL8o}?O+O} zz)Tdl12}yXm$DxwY+{;suA$+>l0$1!019<-YFjuIKR&H5Iar+nKvI>&?tO3QlH1V& z*Nz=N0nGQdu64U~A)k%SoQ8D)3~gLod~B_(bO)&@auJ4vO64K;7cQR94+cY3l9TG> zWKw}zwQB|dXHT7voI`kaEQY61CI?1*_F;ThO-`y)ueMm9t=l&PfHPtFyb99hR;pd? zBuYG8hIsWr&3!2VAmYXI`KqcWR!OMeD4Rc~l*Y!zq-UlkR!Q{v{C>F%{#HUCKLMZ}^@m#M18B_?F#m}E$7Tx^Y6=}9TZsnD3XSO6%oo!?5YQ`?la zIMq@!H=6e!<7a$gLhBwkwCvi^k|r~{O-!!p*z*QW9{0-P&z}GCpLH75w-&gPM0`F! zBE-eTNwTD!vsV-)6bc1{ilVUAP4sA1p3n5dhX4KfUts zQHE)Yii>xjy9fXtLcST==aufAUhdgx?dYMoS+xM*=gUQlj^^nrZo2cFc4yVRL4Drn z)#bS^?U&s=a7LTv0FYNw`uWdC*i#vCcE{GUJGOqach}pSHSC;`c0=uqaZMZirE6PO z#oI4mNlZ-ecs#6!0f1l8^s{x7;+|;VaC(dE=`FISwaAvyfLYv0?OEFa7e;*TF}X?B zeJ!)^YneTxMfTW++Jw=rX4M%jvS+l&zP+)APHMz@y#&E##ham@u{*DYQ=oL&2@Mt` z$kL6qYYfb)=~I+Lg_^bTxpKb+gm?(v(YOvvzgbFBqHbv(&IOV~i5ygYoEFbpK~>ti zbBl(}>hU-g<-UE}eguFA=S#k(FVX- z6|`sbJ^;9F=9rr4+IptfpspQzw52NDyX8Qb)4?tUtK94<@KWhX7rCxWc-Ptn9HZ!c z2!+7ioA&|0?K8*lBi_9Rb?w-_Emi5Bt%m=UigF(_1$lVRwA$I34AItalJoMvpLuWL zYhC+vWNIO<#059xs<*gipkRCGSj>Pw$h@&W@ci^zbuw7Y-a~s19Mum1w&+f&BGi@9 z-zu$1<8=D?82}hCvY%y*z>@Wq`@cNe_grFSP?%Yb=D zP69y39_?iPoCE@N>C>rYhvxjJ$YLlMx_Q#Dy7jYINSEH729NF!0Brx=p|BQ(3$FrU zk%NFmmy7po-j~y;Zf2c~ANL$8yj*0C0KRhHzU>D9;DP6+^8+#U8)v`t!SnAfc!RkB zW0ZH~1ORmG(Ox_~)}^;mqN^ZE=>yMAd+e2m$KExPZzg19rQbAR2mt5~&cqi00H*$F z%A#FgF52~FyDn{bv4t&5r*=mx_>J5%P+Qpn!0{s|0HAY^_Ts6mu6;VS4qNt<$4>*m z;9L3$S|{YvhN^Vd^V6Sx^^pm8-NKJCWoD(1oH!H!P6%bMDEIBzb^rio&6$yvt<4Ax zn&iCx;R_#pJGWb(P7#Y@Cjs{9=+H&D2mFDp>vjUb>=$O%uB(mB8;9i%8{HoO*00>^ z^invAV!<1Z+_0J7AK0>PCjdP5;{925YXJa3955_*_~-!uu>Si>^BEm40OpyFQhMU} zX#f~L>P9^T_{@oj73IEN+x7#%V{>NK$*IjMqhXVJZ+-OACyU;>A-AL7?+XO{!C)}& zNFD&R?bePEqAIGYs47+4_3Y5JT{GaAR-jNYG+_LQ%p46NwCmNm_ss(VVErb6~bjvQ3C6zKq#_-avAHEveFTvxf;`NSfl*3~lDJr>Z)rOF&@-Z}b z-@)9h^tAZ+I9a|)FgD05DILFTU1>1Ls{ZtqvhR+b7*W4&g2(e*7b}YT_~@xaMMa9D zNE8SKiAY3}LaMU+Vj=TW+q$}Dxmywlg{aEA3D>z^C^Jq3qX2bSyUB?CYuB_7`$owL zjUWL4jue*x0;QTS1pqi__*Uv+A1`&*G(;_S z!;QAEk|OH#`BX#A;o&$D_tzGDvQ#Vk;@9&p6vQXSX=VRp>A8~^I2Zy--+%Sf`mE;X zTWfyhq776Zq`HyU5jcKJyWjfIci_`G5B`ZRbx=dmrjw8>-UxZmNWO_ycHm=@w z^Tc7<4YL0J)vLQU|A2^%n%B?D$$bBfPal4Ex?Az)f4aDNn%oY?@QAVcmbtf4!)n zSdt{xM!UD}`+m_n3mlDJ@j%V8f_Fzt3h({xlg2F?)Nh>q!GgI(1;z1+@eGA8oxf_& z_5Nmiw-K+gGgBs*%!t8@KizJuD+T>(PI{dT8fff>@_I_*m|PVAN-h^}_;#sX9i%7lxeX=q$ z65;}?`g>vV^1M@@9Xe7G3W+&BvT^&ibLVeu+#owCF*!D-JfvK#@cmX=zUb8X<7E|o zCFJ+}C5kej?2$bP1mN`_f4{3)cIVV;NxB;2OquA;2AP#`Q6N+iQc#z;h+rA~8SydU z7qXghEgH77XUcsHl(3)7(Lug15TF_aVaabie|h8i0^US2lDbK80C3S4@F@Tw0q@xW zmwn2Hvjtt!lFya<|M~MNY7=y3&yPBKaP!k5fDnqtY_ssQ<(+feckb0bt6t{GV`o_4 z`7;+E8voSjDZ|@$Z(SobrM#@-mjg%EE!nho$!0}S%&BVWEcs%k5>f_@?wgU7#vP`J zG0RHJW>0>8%v~co^=el$t$HvJ{N=!r72mAc^u4P$;wj>?((>7NJU`~n5uJ^)A71{=noZwt(>T=e&G|DI9vc6|=qV#QbZ=8VHKn|) z;@1O5)-K(&cF7iIHO16Sl6|1XWM;uxIPOmu9^& z>W<-A^)mVPcdTwZ1OVsHTzq)alcOdNZ{JO?r5_KkTe@l8(#?vZ@CiN`2t9f43*+w{ zeM4@CA!7y<7nU5@edw(@|EiIiB9?(CO9)x|pH+&Y4j9?DTJ_k=7YjD6-1hZ{3swC_ zKo^9@zgeH_1*6Pee=rc-q2G2Uyp90${Mm~S-}c0)$s^i#Z7Y;$`YtDPswGxT50$+z&PDwh@iutRK{g!vrgdz2tuzdb%lV^NAlkhHMjoI4msS^bQp+DXG+@z^vyX1Bl zK6YSHVe$T5KfV6^KeX0FYyGoyc5eP*&LgjlopMv1oZ9@pt~jADEuFvm=x--(nKZOv zlbo9A)&0J}iQ}htZT?}w=SzxgLX$%U6L?^?5U=_m753V`gAbq&!{sxSJ5BC#(>2rILga0s*{uF8{AHp6EaBre>YmB-cpsl~)}9`L|uGHtbrtUR4dL zs04!VJo4*X_=k-@QGQ*m#H5)j=m^(a|Mo38*4=q&(XEwRi^AB-=b$p zWWbG|DEM?95f=O^%xvTN<*WEwA10QhkIe*j=c{|P~VfT2LHO;9OSK?@SpQB*(jW)zvp998$) z#DqHmdh=alhfKVA&xRfUc=mM-yHFLV$~-n8Qi6c&yN>1%0H_L-<$+8v8+Jm}&QcEV4J9vXe|#3F>y3DRw7bNOpGQc?F@1Kl&%}oLL*KqQ3#-Ds86k$5)uIL5K_NN zeAl#U08k!Mm*ia%Rc8_Nu-M=HaW!9w&U|(8qe{~>OFQHcv2|QgKt!w_maoWBSmw5f zHmqSRuw0Ws-7BruSIs`gHKnZZhBE`UUCOA)i8a)mj$CaLMt2uimgXndow#RTx4Dqx zesick2SiV1&8o?}|{YYnzFpAryO;-j0<%{7^}vx-Yya$z*qN z&2^#yN_KdbnnooPb}E3PC;-S#jA@UE3Eb<-1Q2!LDy0eoph$Gn4`*&gOIe*OK)}xZ zx&y%WRhvy<6oFEzs0sp5q=ZtSlxRLVG+}1G-NDcbqh_$K=}1iVU=i%mHi%n1Wb8$m z%2i}7i_?cgKGfI_p#ZABd_nFniE7oX&9Q&r9AppzP(=;VAp6dg#E3u%5F|)Yl4XzV zk%)FDE?X7Z69K)@l#NsrmS-;cI)$S4*QOgWlum{b>gfzxI{LwYU8B?K_s#B8~`mrBG#Mccl=IrQ=Y2^0$CpL-uh`H~PRt zVOrC=3pLn45Io?pd4d{=>bVQ7QvuHKt9T=>mL2<{4pm*IU7>=l5wzk_Q#9+Vm8fUO zflVz}4w*?6Y6H!{l)AlT8k6B9uD)ax1X zQRW!w6+WPO!x@hvF3EH$f`MQOnI0B*(^3FxGC^bZ21cXC7 zX7Wq*;h<6^3Z)b&NC>E?7@#Bo5+C*fDuqx6L;|R4Pys@rP*71NBoy?kZ5g0cbwg!D zvjZ*@yszK9QH}JP<)vjm?b^ru5>fy_qC-VQpem(AB?u@Hl(nC*Yqx0D~=8srZTKCQ4>a*ijk)iZV_^o#B}z|_ZaXc2qIy9 zS|XAp$sXCO-a-L@chSSNSqWfimqHaxz`4@a48Wa`?1(Hzq?R;4kCv3_>r zN(bVm5fg?JYo~~g59Yenc#B#a(Uy|XqmZp(H07(xb$b*MC5DIsAO%q7A|(KlfV zgd7ZzriYttaD}tg7J(Jb3Mo>2(K#{IK`jErdc1M6N0wz-mg8h^oaB*ZnVnKX^XmYb z(VrlU4B>+A%8f8e9S8m`rg%IMMfJYL4#`Pa8xTc|XO9^UaQxRnZP+*wKy4Hhg?XTx zRoT_#QmMBpKM3`e7xJw1)gWJi8PgDRvds~Jp|aP-GuuJpa1;>{38hq}#`zW0wwnyq zk};7NGS!``GM2g&-@j2zhC?n zLEyG64H&@h;mOZjUc$D=c>q^^r1dvlnhur&TabHnHs zs19(}@u!8tPi9)-YsHJ*LppW6hT zT`e`buSJoe{S*cH*g2$w=YREk7J0!UQ?l&F*_Dzb|)-G z4S^ax;9Ql&F2BAI+8`EMnzCHL?MD*M8OLZYWK=g6#ytj6;uFX zTt1D2phVfe6N7Ku(n^5O?!wo;zHnP{T>Z+|#T!F}gb-vRbT|Xlf&o|of$Bfc3Y ziU`$*+~fdFHhH$m<~otS!)h#Q5ENDM2Lq}~DOJ5Fd5IJU@hD3OlB_SU#M)2=lLKN= zI*Z2ZdKrz!Hti8LcISk#Mm5_VZAs1C(gC%k7DZXjnVD=aoCSA;X~7)l`Yt*g@m!QC zSEAELUPo3s7e|>^DQ7*xYn5ce7`t|Gqn+#Giz0DMX=2v4#1cwlAXh_V2@6eXwX2xocX|r0iv+BYCn%XnGa@B<>2sTP+T8Fx&X4RU6 ziES!qxGDac$E9_sN179y!w|q`59*o=pHpn{(e{qzm{=Ho&<1zHz*haS<2h>tG=;m& z!_f?VH!0@;;-hHEO3avHhlW#pcbVz9Ds>^FT;XzNdFkE2aitWNaq85x!rcVU4R5rC z-eXNdz?h>2#!NUz|7x!c24JaU-#{?Rh#?k>BC71Lm!zmDt4LL(DwPps75$V1P@*VN zAV?`vR1{TJRX~&hky*hqh{gOhY62ZK|59d0<9Z>H)eWUW03fBRLID9#r79C=ND)ES z4A9s|1t5IU;9`j3T-C-R-37f`!;Pk~Bxs+-Tvp4GM543#fhjZl?Qga*Ae4|&r%rqw zi2`ppvA@z#C`4857A5p}JRYws%Y;biw14}@Fh&h?JFQbWWE&aLTAw>FSE7FX>Z1HV zpsPfj|GRW`{OSuNv3G@u>yW7-1*!1AcvL)GB6b7uKd9!pXbBHzuYtlZ@tos0>)_Zo zLD-4wPcu}Dq^%G$xV{zp|7xgLQqui_^nY2fT%`!Pt|j{8{C0}RRKrGKK;XY*Bj#w4 zXxJI*{D{O|2~bMejafixNC{~c0hFqW8p04#6;*|~`wxX^0909)b-PLJFutNFK_w(h zvLs8~FPP4S2*z{|U^dUy_ix;X(*&95RxQGk|aWi*X#9oWJ!`xHAWvgVSh(nudZ56jyIfD9%y>x zw9L0;9bR^5!$z?A&|1pTBGB|hM-36BU3eQl_X8-Et-%Ot7sppBDbjR5eAhqa>r9$D z!cz0rDCTI+-I}^C>8QBr5ak|%o4u*K!&kk->q6L7EvDxn!rAD|M;+-ZdXrNs0%YY} zn4=i$49EExZ8+VYqA9uS*zxqGwM{F*Gpl5Jc64uVlFC#(f^c1yHosigm8zzajnucV zPiMIf^#5ZG;wYU2qCDEwQ~1Wv5Uq)!$`hK_n=YH(BBB*e&2mI5%qeJ@R4Jtdk%3xf zQ%iwTl`2$a4rL((NEM_irBqebP)H4^fQYgzGqKHdbgCK*27>5CNtVPaU@APlE;JO4 zeAMfzKf_0r01Py}uVJ(cyuqTcO#=;Dgo>No9?W%M{87i)kfjBXb8A5u9sxLgybg`G#UR zwGG8e&0Y2*aCU%iUpIsY-HwUaNQgjnLm|^iI+w_Jy*0J=jw-TNNib0PL~uAjEd$OSjk4Y~uB}$X}u6m{w*r0m=Rog(sg=sE$c=!(HwMAJ})z>{Ugg z0-?w@`U$dQ3=$21N)?r=NL8XeBZMIF(NMXHDwQae38jQ7D%hpCgtJB2Au!G}=<|i9 zYva|02#6F3a{;D>f{uu7moJ1N>hj$!PJ~D3@bxOT{blhLapj{JUv*O^O*yI!8qtjf zJHp42X64wZlwd`@UuiBasH%4v%KX5g=46;@`&rlGa!MR1XdX9$KEr7-p%b;PYV>Yy zLUMXoWo(tqAQf$oEV*e|#~5yIIK#aZ(GWG~?a18!3!-jS%OeQS%~Q8aME5Fo124d& zhYd!dOSrfKX3BWe86E2p1pq^bYCvN%;xu7eDx_l-Pws6T4(#f|#`IvbTd+teTP^ab zLMyvfoJ65&x9F0oEyR+a`(}fdoGE@dDJx1)Ymlj79OX9?QI@60Rgl};dZ(zw1zlH7 zx)3#*FHFU`8CW|{4dT4*uxw-xBByVkQEe-YDDOS8tesrf5U%fAhLoklo7bU{nQoGJ zVP-LH&{~XH!oTzf6Scb21cHPhdSv#`E6XwxLTR+Vb*_Vjkll`i8tXKHQ+w9-N72Jh zw^Sog^m}}fW4fC`{V(^D|HE{3brNO)s4d(aeN=_b4!P9RBUe(SI4^c8zlnU!1JH%E z9X4012@&>RpS|z!@IaeF_#|p;E*rS2eD?aJ7JWKl3hsJ2#UE*S>L5D*>lCHss9Wvm zk5P>2I)1O^?zd~E%G$_A6V=7&#%=4R5*__oEP7py3>Y`zXDp|tq|^qg`HsJK%FBqX zNg`8RJr$M#A~UyD)eu!evMj5rswxU1s;a6e3RM)MD3q#{QUbC>B;5qUFhkQ2ny#KT zmKyrOVhU7MK|#ado%cteyV$>a6J#>RTRURjojZf+v>q-(K34#O`sf5dR7grdXQ zR^;xIlv8SGqlnp6%8GR8xB-iHfBNj(k4FE>A5GDhREzKOaf)ed0hny2BPB6xT>r(p zK7IbJM}?&HD2U=G0@FG!(~W=}I5ha;=H@ollMtdain?vp|24_vPWHZS@9HDQ4OqJK zvpH|h7OU1}P@pAoOMF}IZVZS$FkFW+EdkA+%ECmk)l3rGr7U^|wAGS%)5El>A}Em9NgXYBr?ZaW5@e}GG%KeOxfio=`@8zUfZjv80l@lY zTkTt!cGE%1f7qAhwh%)@V~^vQ4&||oHVsde72dYmh&F*fgS!L3y5(E7bi{d3U|6%M zvg%0D@|HLPxNa3~DeIlWdN9~5u7qu2;4f&3M1eO109lgmee||E^=fZky<_P&tBn*a zWIkhy!dVJ)JoAfY4V6{XZ|@1F+^4Xl001BWNkl`2>Z>HwN zs4xVaTya@s6pH`5sbd`la+Ebnf!`=*Qul^=opNz)^E;&#&t7d5^jmH!21|ih zVHEp;3L>STgjA{mMMj|TvHWu_aT z761UYj2)4g7%zqt`uy$YeH)Q)R(S-B%Jax_Y)p)*s#K*&h~$xNrO;etP;RWHt9aQ| z!Y6Xgu1&u}iM6jv6~R3*>TsH+LR4h_#28mdk!T%QKP19OIt8F?zSnZ+Fpip76(B7i z;o{7ytIl~O{vYxxnH8Z9(Tas@m5?H)fB=iP&jWywy(R|( zL2KC^Fp_D#QYR;~LF1f?3g5O(dqgQ=Nyf^brL@9JdMH}B;ISo%tk^aW0EYIsE#ME> z^8kQVyS~&SXeDB)7%2+VznveuBE?(+>+;H)(2|WG$HqDL0Vq*u_&bCKoFMPQp-- z2|E0<)=#zS$qQHh)AH`{es>p({nL_@&>~c~`Qgr-%x2!sOHf1F3NxCena7MDGV|fv zmVUSXl^5PK!(^l`>nmas)fzsa2nrB|QczR?1dxCND8P;jsT5J6lp;_`e+`HNGJ>ok zl~6`)h7AA>D2fCq6Cwf18jJyU^oh;&DgehbDj)@!smZ*AdMOel1PMb&+De!WI6>#j zBo(4c^y_^HTQYDQq*XelKqwGRtxiqC;g2BQ`#}^+T>z+CH8IT7V?`y7;XmdVcF9OB z2?YM}5FX@S8Ih@wwG&uTcaloWO7@6xu>8gaV^cb=>gex;t=9 z)Q8uS&mZOZ3QzhZ0ggaGg964W3l}6MoFcG9(Ux!~;f?@s{P2m>d1q_YN#DLua&HhyIsafx5l%da{Ocl>Qp3TcHsUxjk2vfLBKGKe698;lv$M41iY!UmwdV-u zPG7V@fnYFHy+*b8#5l&Eu#VuPoGXC&;?~4)wdz%0e(&j8S!sS>An*5+35f}{r;r&I|AL$XH(CSIJXwoS+84?io!6snSU5^3!|oV0N@z!AshEt5UuT1+XB@F;4IX4a1Q|3 zs`F`-j{5-(^Rk6Z(%3bM`S*1gx!0Y}p1xq|$)QlFdX1EXMC*JSJ*8Anp8Kz7GqckD zKL4>JCliz6+jeN)wnOu;=Pmoko1ce&cfgRI0I+HOF0qZGw`XuwVVE0OQI*1iV*apN zO4TUSccdsqJ{OpX(anz6L>OL#T1ZvZ5LFS85E7!4B15A@RaHd^X(R8JF`F76o8<8T!0FPm zpDq{JBOJP1=s4MqU%occBbNt5mie$sjOW|m^LXMtGBW_+clTA7Mw)on{-JI-8wdn~ zK0j+<2&rly6c-;y;)z5g@n$dfMQaTTY<4v43QbpF8YTxPHvMu)aM67DB zkZ8%RiUd6khL0J2R&FcwXy3Ol?I{2tA-x860cLyP-r`Xt=bWd@&0CIXS|gz0MbQWX z9khXHWdneSB}Jw8-TIhd?&B~Y@NEr85_>hZ^i{z`K}58MB%#_RlB!BoMNv$aVA>yM z6viO0BuO_8=>Y&s=C2L}0^s#XR00VQ@V-e;YNgbc#&qPwA(N+%J$L#-X~`9ivPJzb zgS7&KMAW=cO7FaXe66gs!#^K=Vb&W(1;qf+sYkmfUwPo>@q@N+*!|1FBW`u#MhGx$ zbpN{_nuLgpzF6*!@eaPFpH>mJY9Bhf|J@HxLc~R1uJFcq29NA#PD-D>L?0OJFCn@8 zy8^)a6lrwY2;rygeJ4DlJt3Gopc??J zUA|e2Zd!QR_bZ)K2m83OvBG2vmo5>;BadL=Kwo)A0^F{tN2u|8C;Z70ZS16Bcg`4h z_SE?+rDYZtwJ(k!PB8wN`ryROtn^o-CTA1E50AW6RSnS)Aw-fS3W^GK6c{OJqIjL!?)#?V8|YLvD`On(+>9imWDYD)EF`+v%MKMqP7OtUvh=C#A+( zkzrNPLRCG$fdD8#=dNwiGHRYbduhw2-2_qgON2<0L?rfCyPO3HlChIV+%|R8g>(6j z&v?n_3o^MbEWBCa_@NS{?2dM!c!ZEHxg7!EgSqpH3X55BcWv3Xan<(T1G{zW)9ETe zEk$h6u4(?If;Z;;^WYCZPn|Ux1aV}c7Hym6Un-dU!ZclVR8-y99;CYzkVZwiJBE=E zRJywx1f)A86(kg-8|jkn5&`M%?ijiTnBcqbZ>{gF3xCYw4)>mY&OSSy{cH#^>U_8( zeuW4W;N8En%UO`r_;J48&*1~AFEk7uR1+`ZZY2?Ae($XsI{w4vGut0ZXa-PV1C)mT z2(H-}2<+$1Va8vkccY4C7h$(SZO>e+oiWHeeiN?eK<#&59IHuk$C0=;12wE>K zT>OrI!t&br+RQalmysptSeJd)1 zL2o-%=GxvMiUMyE6kb+_0Ya0-`5}X3$134ef1xhJrp~6WrLA6)@&xqr)t{;j=I(1s zC9aaoOja@nFRzH>Vm;_n5;in;CSE8Gk+)C+(+H`ViEh+O0UbVwTktTgz#ka}rQ)F3 zSGUa7qCfbbnO%HA<8u7VqF)1j4MDDG&_Rkm6gD;2a@7G>022MFV#ePyvE9up`QtZ&2Ojj=> zMXK>8RIZSH{!6W%g`%GMubO0jBI@XmF)w1%t)8k;$b5IhSsRE?H-E-TUC0ZanEu3=Yh7ANOJyL2kA2=o%btCtAB`mz#Kw^;Vy)IT)|j z{DAQ}d=2I1Rad?0Z7~gi&3@?kV>B%nUN&3yjr4=Z*1_S=btk<#tAavT=WO1)xU_94 zUl`O03R{s1RElYgwcNH;-OoaLtz7~WARq`-gd|KeI*#mY5@zhpD3#OWMT}*){suNr z;nh4~%l<8LoG-k&a<~183AB;gXF2tMJCZ`@lMe!_^9o#OrW$mkX0DHb_gvUa1lTH< ze>-5O_VaKrqg;WRG>lq-*i0p$Wc_E}DYpcae(LjvLhk1gZx~D1Blon`XCsx}PP1Jd zW9DK7_%*{mPXM^Y6i%b7`!34lpD9pIoY(Ij+#LQZDmh<8{IuSE_VI*+ROZ!xOC zB)!fB9d}EP{uyEu(=GCF73}RQMwF*GAuhMyGRa2T%_gTN@t)ppuDVGS7S7{f$#yY} z89tn(dvY|TL({4j@3r4w{8UFjZSlPP^10W|@s~~)AgbBgSkr)4MfQc#z5c3c!nad> zq59LN?H(7ke9&C`8Hpc6KlM~^pL7ql*ZpH)${dkE2WclJ((=*841Oe@3+Rdv7n?}3 zK1_BEdmubc)^4IGytZ0fv|g_?to_8LT{-w)X;PMGy;Ia)sr_tN&jetACUdQwBd21$ z%4dFe=HF<%#0+s@(`H$9b)P?VaxBsYiXR8!vkhwPRxg=pIH`M-+q&4 z;=r53SOR*Npq9V+bQ{E(G0PgSGO6dR&=L%79s2S#v01LJ14}JFZ0Uza@3B_*)eDc3 zM5~5QFue|@Aw*vhk&162|Ch4O^UmVaI@8V3FXq34;aV4dZL=TzyMn7rozflCb+s`; zp(SMwj3iX4`tEu*4xvg8eFL{Ds;*PV2ZhrOkfIj?^<{K#HiJX9l_zbUb$7=ah(Aa? zsCG28NJY<6ME%wpM;9~}oE$OA{0ezOqQ5z?ptsZ>DEJyp`Hep7r_|fYspzjaUZW=< z5H!W<>(gaA4rq@^EQ8N@#e2RQ6VsMzd4nOYCPLq%S?mTnK0Lrq+w=n+%yz{LKsO~d zLMTo$bjsBmewAEzt8A~B8_37DX38=lb5MKcm`G!~VUbM&w8S7`yj zckF34KE6DE_Fm;ZbuetS&Lp*n@+oUXEJqXi8(3!+Cy%hRNteM*Ss}AE+zYjn>ZX+0 z@w{8p8+?fnREPJq=~-y}DL;c` zsY`f1p2`+qjm^VPk@0k(_8hgPM$MR(oRP!HYWLClqm-+dp{k^P!4d)A{sqeQ z2hEQkzZKoQ!T4*&tEZ**N6NZzS00*1yQPMgU{raO!2lL<*h&EWMr-S5KRAV4rVl3f zi`U>27&+s*ChF=sIy!#4AMD@bZd)Cn$U4(b1eeDy$I-wTmbekwH3m)Ll7 z&EtF*9XBlP4}hr~85-2p)!vR6`pMxWA?&|#A%S-pL*EW z-2%uo0`h2q1_Ek_qhIj8fL~1Y&n^#FCn?mCH`(8Kp-rYY*DDIp(~?6^ z{>az(4pnesqRSAsSX`4R^ws9GzU(Jzhixvm^Zjp4I1H7%@68U{HQ!lIGs|kW*tTff z^TG(E6+0bV;}1Hok8+9sdhsw6D5R+=uS$JOph^w`CG!~IgIYwquKYSIwknr}luNUX zjI>%^=A|h#bPNC`IU>aw{>aJB%FSLsW?EJjM()w!Z$p z>yZni9t!z&MnFh7cpzndIcjw&^r;HM!{^Rr=a@>U4%Y7Zt zhCtg)1_BJjM*GVJ0nHr0O<+4j6<-?&K@f;t^=+)VvMjH{`b?6KYqgt}s_XFUOgN{; zx5?G%ej>U_+p}z0n)#D5oywske|a!`3z;l>Lo*WyL+-mAEWH*ME~>9@_Z^mZ>413z z1XQSr7}QoS38G;8Jn>YE)quZ0T|9=3-lOA`E{Phcx2<5Fl2^3QKtQB?r0TquPK~iu zce3nfMB$5+r!-*a-?BX;HYiXoYjjx&kPBi0=n>e<8ZoFnp}B{|t9v(o?0^KP%i_}o zw1>0m2C6%@`3&xfH1+ke(18y zw1FLj@$ANG@R$}Br4wc_I{~&j%vPHN;-44b2jwl08ff;3Hw_a z947X{9<$%tLfg5rpCKhePp~s{^^<=OniQ6OQXAo<{ia(l7VlvD&x8K{E64DAUOMtH zAB^HpMD-BgyI;a zE>N->--c0c?_PA&@jN^JOiq`S01y8Ut$wT!0y=tlnn&UXmSy&G=2@(Atz8+ zxY5{Ok5S<1DgAd+wv{YdG?MIV4ccMfzp@Ga2wn@myV*ziZW>8}JWf_OfhgD>(Q#{F zZ}thzE!9InE{NAkYn^A!wE1B8Oh3IziP{Z*&6ijdXHe%s9wkM7O3(IwD)OwU1AfG! zBxG3bwImSi-~4_U3tfJP8|C+N4$2B{hNZj@vvs@84%iLK;wzup%Z}wRZeKv5_uyR^}uCR-i9V0il2uXE!> zw`4bu!&yFI?pq)jpCj(7qgu$nc6@V9bPC^XGzWSxv93(iA<20lPxqM1rsxAD) zu8i9WC*T_ui1(4Zhh4x+VUfZKPw&sky@?rSgW-D}{$8jO1v${Wci$Xm>ep7c8E&-i z&~jD0_S$j~Ew(vhT+4!DJ{!6*44*R}^i`3&pZ^T^#jnBk1&YV;0}LW~KQUS!JgpQ! zAb3(#{mr(LN-eX~Z>ZfhCQDpZ*3ni2q#iH(pt0eC(;8e^^etIiTb9A_-GxDN+mqZ) zz^+|tbnz1FI*2G<6F=|e0Znvj4i}qdE;cB%Z8ohmfAJ5NO+{YM0E{T{sGCvB98Myv zFwjJu_r5JEAh-){Rfl`E*`Fm!2a9pKg|tY=H5((~d{V+;rs8%RW%`IXZrdL-mI=x3 zkN^wW_Q#^PIT84Dzc3x&;kp?h1yahCvgyXo!A;i#P=nq*Z*V|mhi{gzNtvUiZB6&J-$wr4c zUx3W*`I&t_8Y!L8w5|9;E7}WKw6#y>%D3xyAX7!|8F66o({@KqWn>1mVrv(~pUZ!>`*Qp)`JLCa zZ&PYjx&hoG!_i^ieZT{Z!S{fusMLFSI6l{#3m!N}Is6ZQI6waaq{ki0wV9a(NuAUZr5U!-+g;- zEqvq(Pf|q!YewhtT93|aWYG|Z``+w`f$puAYOv5Qrj@=Sc-;RuXS|{DsTK{yv@Phg z{w*jnUhMCjG3TA)UI$tzf7{Y8(7|w>iL{Qz`LD!y3|{Z0{8SVURvlqDqh>d-e5|I!^eTZrZX{?md}F7q+MA z1_s{3A|ir9vm(NcPw_3|snIs}=hrW9m(R{hs@F|)9}m#S!NR+~AaYfzhB( z(SaOOpE=mL=*5s&T{15zIUmz4w)pl6IY{#APKkAk`NvVMXC#K!J^JlxTWxK=|F|E&e1_}BGhxdqoqa)Im=j?Cw&K2xF~ zfSk{&(%oRJ=y9P%ZsnYh9kw5yY@I14t^%bbWPdSS4T0YgfC^Z?vCa-y zs!(H_ja^4XLL8%HGT7NK2Vo1(L;Rh5C7WSYR6{>-1Vu>SLt%)K;S=9_BkK zXt??8X7 z;p|ZQ<+!cz#|1JD{C~Q8E^RlaA^~UKu+=N88mf~0t3A$)TSNfpr99nMqiNv{v`G@t zjo-*atnBN&-CsF7tBp;^zmP|=s(A7YKb&B+ib*CRJmLJ6F9;Bw=4tS0Z~WXdrhv=6 zv0&t(f++@Xz{jzV}0<+X`rU{IDlE2-OG}v~|J+Kn?WflKb^M-mBhM-w2xX@p((XPMH}XV&Poo(*@BQ7N z7vRx1WSQf0fjHzbt=qW4>Y@rQocJCgOL+G5HObOxSw4duntikTM_lIiEZmx13_Y=5 z!(VfYA2=HVtT8EN7_B1g^#4TLVzMzlBV+ze!kP4x#m=?rk@LI$Z;nBb-QS5yt#@>0 zf10=B4yG!n+Yc2xgGOdG8L}tqRAHtoezH#c)J!Fgurbb-ptdy5I5{I2y>V15Em`E| zut17jIo}la)~C7W;?D`6Y~ZxRlB?^hd4F5ne*gtO+*-)>jRyruQ-$}+6C6&KXQZ!e zT1L&y=(rd)-G_PW_RdTdc#AOoy{+^#6mjuhT){r8#F}u7r?=17pm+&~EiMs)TD{^U zzNSIkaYI}OD1H!!+81CvzAsmLYH>b zY1~63-3_4xHT4mV7k6qCL3g%4%%1zH0nl@Uu(qq}}E(iF9U)Kb;gQFR$r$UQVlulzF{I`JGH!j@)gUlSsivXd`P46EKU&{*sW* zEX+I{F5S?~IUTJOdTqH{qHZ_Ncv>DZBm0YhD@$2fd33b0&w_FGyE;Ecg`j31ed6Bc zd@^Tn;NY_V=`8%0!0TAZ9!}TBxL**e*m2IXN#n1t#e|v*vJgeKQ%Jz|>FO28c^(ig zU62}8a9e8g5dT4(2)@WyN8$ETy zG|}6Dmv}zo$K?mrXB8N~71m8uuK2F*@6Ac*g|~9EJKD;16}~;!(Oh=zZ5?H3hp9*Y zb8lBC5B5sUqJMj$f8R3zNczmep~$4ef9I+t@}a-MQOY*s=Wj$T40L@m&jL<$B#_rV zoK~GfKbY%?+558>|2a8%?glFCv{c{Fs5wxxP29D6n`45gtee6VN7g`AXzaI~7otI*JieScH_qqAmxs0A*ZVnhD@{Ny1;rL%TjinuW(mzxz9Lj zLmzyTr)JcCK3Z7K>HQlG6j19$7qX;6CnWhvy!NtJ$XSBl4t;vwV1#Ub7m--eY zKY4SEJ$C34pS%1cXh0viz{L%pff)|zqYoP-&Fb@ui=@q%VGml z4Hc~$)ypfbXna9;Xx;WW^{}-_WLh3~Q6hiBu_9YIiHr}PM!B$_N69+BHFfdYjF;Wc z4Ncbl6w6?RJ&7})u-m(Fsa3QJz0O)!+i7r<)Iy>zZ6@+`b8b*>93x;ni z7p?hUrd(;o2O;MlKMnBAy_6+CT2J1a6OFj+Lf!t2Q60bcnJum$dcogyzM}{yT-=us zF>xExAE>xLm>!>VzO&n15=riyo>{1{Q{w;l8x4wDoteR4#0l;1m+#1M;V&r>C%lQB za>cgIk9?2^{rve8i&1W8d1mGhQ8^Dq04RIHQ6C&|-dWm9Bym0;+>Xj09=|i|JBo)q z9EUw);4-!pcV6&vbUw@2u~I8zi6zKFtd8OQiwrf*R!Gv07cNy?xPWf>r(J2 zNXOO^gUQ3ukKN&9PTTjKvYzX$BvwyEmfmm95Q)9c_Sqp0LY<7#G_D2o23PB$%m9Ug1z82X>0 zhbuD+TeU*Fk%sE}r1zW>X)N@RWQ>l+gA;LPBeJ*Y6oMlCUN#w=#I72vw-34$?XEk2 zzYkOmFC8VSfFCY7#=#d!1yyYix^sHast`+6T7}SLEE9}5+<^A@FM};Y}>=e=5QS2_0WKZfKxG z+qrBJG+s`uWoH{F-}JrxdZZ#7FoiZ#oP9v=dFJ-#{Wkn$_qN2Pl%ClE`x7iHUg~P6 zLYrg0pTV)?ABMGsW-eOmoGQr9!9jifnTVa8-IIjzeS`&H%9Yiam(Od83KV0*lbrXe(prvC=i`LmJP50S)sar|8MTI8puX*d{AVTSsm>Yt zqT;flpD>1|!TzgO_z5f+eq>l!%d9WO`&*MMq;*cl*pcb#83;YL>GX&!c}d#Xv{(Y~?3!EwGNFe!CmsG3Ai2)p_7#bgXl3;E!IMOm=Q{rj~9_Q#}aXBhVyi~X( z3^hJcgZ$jTk?PVCyLx&AvXG?g{awj;N!5fxb^Q0SUl=uQw|1fq=?Hupnlm|9o6T6( z3|1H+8M{#(-Y z6UmW>zt^^Vv00*93xnGX9k9irvS{^fV)W~;9JV94Z{Au5E&O9TslXz-YIycqgLU^$ ziV66>;ys{E0#G&jAbC})xT#L;Pu2ZglbgIr`1_m^_am15Dzv4}SzMYn|K0wD3|!kj zvRotD9`3ki~7wgOcy1*Cb_;2no#1era^sP#w4E{Z{$-{jkd^Tj69O z_6sqh6BXgwD!5Rx=!5Un*KJU{U?3W(94yZulR+xtng{#lMqWSiDE7#>-Xxq z*WmQ)@W+GtQunw_(aUDd*OGuoz+T24Ms?<;71W&eKJrjxOxvU=cUv_ZWVTnIB4F28N&iZPJ;!U$ zRoB#8TKg;h;}ZLDVTfK?MTKa9l|(!L7NI4$UB0YwHqDMdE3-Jq^Vqwp?YCC^hf1NQ zB4FoLX?+oXOT335PIDp)ol^7s?V9qO%0G=yoLB7{i5GeuF3t#nFNziP$7lLXsXw+t zKSwX6_sTQinQb1w%}bK|c%h-y(U6xGJ))AGlrS`%GT7f40XAl+jP&}Y^fbfFIn8&8 zrp<@JJw@+cv^Mjh0#q(EZNty&IBIOX#hVr#du}hgtsW2A=hV7^@YlW7c$@ahDOpQQ zt9#gj>Yq&cQh8;`zkLq&FCf)7t1=j5YSPKLV}UJv%C8a|^<54!*7#B}*eIv|eO0!; zF1!xQCAo{}9^Z8n+u>kkiJ(Z73i~D1T*Rsw@uC*zMQg5V)RXDA<*O8>jVU)K5J&vd z;VoR==;Od9h~N52{1XtVK(x8&u8S%XTE+67ko7ww&F8Ql&}1k4Y&BS|t0-%&JYqd-fT8Hx{M*Z>j4aLs0N*Ih{OaaKRaoPC-jo8IykM{!g-tXg>B2Tln1I zz(*#yLkiO_qm{*LDwE@G`Z&fd6gKgZo@U2GZ$nO1tQZYvDso7l5(uS^OkB!7Efg&u z+uFU@zlhl;6ErIt3DhnQ#DX#WJ~L5{{ZAML1Vo<9m;+rurhh0=Z;UY1y4eJIEiW!C zv|IJi?4k)MR2NqqsPIDPQ#$JGdy~Nrx77R|kANGX{hv%W)5oQZ&v@^IKdkR2MYdR% zKjiPC$Cw5o>+9l{Z70@LvTF}|?p^=&ggH8t>jpNz7C-C5IA2+e8E^Y^Noq-~+y%Dl zLZQP}%K>|D3$wZ@R^vmxobqWd@*()Kf4G+y0YHlUeAmhyM6kLS_p=bI3`R3Lle<$7 zo*841EBNypn=#psKYwQX4^aic6OSf0kPoK8+akb?C;#1e%I{b%1w$lu!NOuRJ;igD z>uhtsDX7o*DcF@fzI872n^tZbwfikqz-)E!g~x4h${WDNPZhhIA&J1hOuNAB>>N@i zEw=^n5Xyunnd9ZWN`81hwNta$8ct=0RFyWdpBaq^jxP#3cMWC#6u_gV2-L2uRb2u) zgXD%u43F5qxH(qSHvFz&UtcyQrJk@9=`kplzcxDyq7GyL{adt*_Z*iS;-6}2WQUX( z+LApDjgg+vU=^e^$iU}{U`#NhkjpkRCo*GOmt(3BDB(`tpv~Yd5!vH(9P>(u8+hIG zW5Fk<1V2j*1J2JGF0H6$cWG!4D&wff`p@D!I)n80-cSOAUJKy!TSG(O^8-pTf-mTy z00HYSMo*j(TFmVPQO0mNG<)LJ5JvNwFZ>*bqaZhu7e}5XQ?IvcelOuV@1i)vZ2NyN`m8yCq2lRz;vWKK`@<7YX z*2!h!-cW}6r!icWmC9UPvC7I4G&D5SUUNc%AFKZhg*J6mop!)QgK zwrx2e-ix~$z}4=7A$hNRc@s2zr-v5Y)C9?WYlWLAa@+rIZ5u7OP`m+xb>E|*V2V){ znNQ8Ae&6TX*`?PHEDHlqlBQrx;Oy(vP={4ci1;_Urxf`p?2nNRt@?kC`2X?CpR(rH0?T+ znZ)}B;M+0#?;Kl0lOhm_h2^MEKGf)b1sQgu-8s zwC}z#6-Bg;sumQ9Pk7%iOzOVHouw-;$iyHi?WDx(LfkIj0X~CS1 z?WE9mKsu_9Uh3jB;TByb(vML?RouH&`8K;g%?p)T7&JHffxUFz(V?sWMe26H!W2c% z`&aBy5OwffE>$RSvz~HKL`X=%lKZ27V&K=(&-z)~=2i|8vsP6_B`mm|PhW;v-M@u^ z5`;T-j##V&R7L$>k=m%3ik{rx$0~DqUFX{*8a4!e=aim9a9@5m* zwAK~=BJNd&rp9_FrCBbg`A<3TBSACU&VEh?vDq=7WmLQvLARm+Wdp{_(Qqik9g`v% zyIT_@)6>)mC>H0t^sr+l^>;5`k&>ioI?DVo!a7PFN@BGeG8XE4~i=N~cz>fTTH)X3Cg3hI~9L+O7 zm^p~KPlV`>K`fV^vml|r3Qlgz&){7DjnUCjuAoUT5eSx3Nt zLTRY~8(ya?iwn(lH8nM*|BV)4G&B^d*>O=s_gT~&0MKD73~8#!)789>>4Qbab8h>M zVrxBLiuv_$@+9?5H9E0%(yT>MZR$0Yrk=N&JnP7fm?lDcegN9#TJ4EsjU=F{Sho&w zJ^fL8g5lekyR1ET+)0lSSifj6~^t!O3w343Jjz>YNll|1G5HW0M+FJkX_i%Ag1x~>|AepuxtkbK%{N(?NyjE}yRVqn z@MrmnNPyiOC&5Q^i~Snf&Rn4A&h?22HC^3xwe{cb`(t}WMajv@GQiHAlqZ>)@sdO( zT^zluUA}>>8)N4Bk5?u8D8~ILq`hiFT`BkFuQwR(OT!66Uh>RNZmZ4(WOKiYBesB) zbOBC8mf(HKwkmb?USAPx-HA-?MC6EM^396sD37>HY0zSKXy3IdDgP8 z2?#I<9pZq1^DckCzrAqD`%v2!B5;_y zD+x=NU)T~7gwI=Z%2fEK!y-?y&9)!74!!6DSExXBiV>5$?}Wg12SLuO*u={W-9Qi1 zDPLPj2oFIo@V6p&A)h&YP3(zZu-zz6zS2haohe@rO)eu21hB|))`dIX5qRbRqA|q@&IAER=vt zf8F0t&Oi_;oj?&}=?yQKG&w4!$vJ#a+O z3aK}P_l!3Y`0k+7zp8TGUdu_j_-D5F)dDHI*&kB>>(iw?Jn9)NuGi0yFC>aat|z)d zS;z0Ur`-NY38zwk*skJ}q)DE}^v%u973~%E_XE)l!ke2LPtP0mvhwQk@?~}1rh=*} z=K&&k#*+pK!XhW<{|4Yday`Y12$gB*%Rj@G&gHh!_@X18M8%?nU;E?7;7Rp^B;t!K z5ZY~bUA1|Z%jnL^Id`aMh`bqAxst3ljOX4rb}J+0u;En3Lu?$!s2p~wLT;A7lPhHU zow|aONBny&^kbZxT*?hwH%0?t&~@)KsbN#o??imlQ!5V-KfFOk!B;=osh@^O!-<=B zvrQ4mK?t3gtDJDOgK4^mC2oi;5o9CR9PV@%Fs;B)F*;(SaM&@TzSPI>6z_c3_Y?VW zR=Tm4i^N{JgypPX-7&;x3TohVusn^_Fc#gRj3Fchroj{V9V_82EF{!W-`GgOSwt8B zx!ZPvbRav|17MNE01E8sER12{EMq=^Ztu8J`KcnagoYhgSu?b0?V=8_+6hBRwkoP~ zJT`ZW(S1%2#h#y888EVvb!!YkkT)#eE3k549sjD$mnnUV#J)xD&F(+ZyYESt^WBc4 zU#!z@8kbr;Z;iH1(@T|OG-y4jBwjb22BOSONMsS<*MiR7*50P%xK8fc0!`^R?Rgdd z3fDAhj{2r#?)jQDof?m|9B9>f+7{hg>4;k}SNqJ6>E2U{u9UV- zX5Bv>=X9e;+1YZofkNIcZCB2(FMr=+N{0NNIT|8WAmXuRafdtlW$@mSeu<9Q`r|tc zLfq}0T|>KAK+;>`nsMSMBio>ntcF(w-CE|2)Hh9t*k_J9!E?Y=nIiUDPr+?Z{_VC; zkBep1H*wa7-5j~VRwI{+{@tiq;~x~0VG#H>NVYGH9k!K9EXx7=n=)0jZ*;-U;;V(RS>y_YP0~ZOduGM&-;&)eJs%LSg*-UgI|En~ zv5=g#>ns%dLs=C31af}c7JNTJ9xUZB#o8fbfu1#0v)#}nNVyhZi5YUX{^=_?AYfq= zo9=sUdT{-bCTP2#A$xfL_#Fe-b>{p#_Tu5_YYu^zhY+}9@ltvWkHqR#`zg59$Y=2I zQ>(cxZO9omrAfe1C;YT9C{xsRX7N9JvuC*aGhSx$ldChZ zr@Z_}P1Xb&M)CZYks|tXWD}Ed7IUW~8~Uv+)l`AjpJHJLHnamH^~r`ZvhJfPbt0`Y zlC3Rt>=-Q$qO;ZQb6j_pl>f&9tbsx8HNK7ymBms90>AuqL1C>P)K)K;+FN`xfclW2 z-B@hZ>>0isNQr-wX?(2ndZ5#GGKZ-F<9Er9<%Y7dg1i=0Z{btcr^lUKZ~7P$Dvv5e zW*X8W8E4SI5;&lbN%n3DWs58Ezi7!xd;YdDC*bjM=o?>?VwjU)Ma;=K<~7XnVDYQT zazvbmV?V(SRN~rElOZFQ4wY8YaQjEb{V`rG@|J_KK|S#g<6Ie6IHRYm04b^D=HWTM z%mPC0ySYs5>MzU?%h^qqXOzkM1IL0+W}#MdZTWK2tc6KOoatv#AHCkqY%IGz&DJ}g zs+C}P7zHL!TuXP>>j-Bfw(yKQ6<)ShN#UTQ&#!lhuR1!LlBR4*hDPj3iUrzmc?4Te zprK1-E@EDV>6VG zCV{B?rKU^WC+Wp-`8fL4>($buK~tBGU;tI1krRx(T8<=yeEP=}X3Ldc>jaGh^vKVj z&p`Bu{Ta-w%AnvXb8(i}=|u!Z;Kgz8V}Lvl+C#meXK_Z!uovI!eSc;_oqZ$cU5&X zqWGUjf|5A{w#U1=iVtD*q7~SP<{pqlL*&3=5@s8nVKCJE zOCS+Dxq&-b`rihk=(<77w6vMYc}z^41p98pwYg+_9H%0QSN2z%biGce4kvnvQZL6# zb&Wi$DDp?j6xN$RT}r`EZ>pnE%|4qMavmGf@LPu8`%b~xmjL=bg{yeKdDMpVUZem1 z$K|@aG&B0SB%k-#6gK?>vPjvmyu4i8vkdM0sMdRL)Y!&^l;S05E3J6{V0hDplRfm; zKQtz)x35)SV1FkMi8dY6_`s@Q7&hKBB4g?DQVs|7O5ig<4pwWdgm`yC_4CU*`RCyk z*1e*Cu-s!dJ`lRZY!PW?2LIW!HrOh$yG(%PqjaF7#8S6;Ih5wuPruW8*?xSa`F0{~ z;QC~?qs+lk5jsS76JL$+c~}~k@&7fJHUnT7;;Rh=d^b!Ssl8AGp}Hpxm`}`P_z3Xw zstICdIKQ`FzkpjHR!?_pL7JHaiMu1cgpi66r;1JanGHJ8OU1W25Qg zh^jR+W2@p({Bo8~9O0KM39~rR6qD0nZC3h~L$&*Fmfw&;IUZ zOXj|BixKy}FZDJV+IhW#ZoRR|YK`BBdK7x9fD>swL$SC)v4Z0LCtgR$_1@kea1+?C zM?`hK(Rv^ZreaMt#v1y*$rR_}`lUdxTDIHVum4Pp#rD9l>po2s%A-V${kwSk0D%o# z+UyNiUw)U}8r0yPk?{Mo=9S+;!wr;=h;~I)Ix#Q3c$3xi3iniTZv3! zs=8vpmwy9D2gZg6@!&lU${@HBh-ciOZ12Tq`*H~{DzJ3yl!coGbxq`#i!=*fUYETe zF`a=FA-;9Vt*ESi=o9F?%l#O0*WE*5aU8Wog~E81vNG2hm+Af1jIU-+=Iqi^**lJN z^ugK&H4w>%!>Auh6T2gVyPd`B{@%0C<}-uOe?m)jZ|&L@Xd_eP8YfOOr*braR2 z?pNJ!n&^%FufI86?_c@Ce_0MV;LkNVt-3y30PFVzb0A0ZKL-cDvTxU=!si@in-jdp zT>Sib02}&o#&vg~YPFB;Y*Urk8DnvlJ3zNRKo@_!U~<-}r@4HwKpv0r-*(r$(;qgv zIb(5@f;b<)UGLc3B3GebFISDYtoi@jE+- z58A$*ZgN_@_=nUaN6*7Dix27`3-WKsa&#C~Up117=1clsr>R_d!3ks+8n2Jy==#4w zXuB1sDW8MKxN*Jl^2PL84@OOq1C{&6mkk}*r;CLd6lip1<;OT4r%QuUB2L4LEZTHs z*Pqh(b9@f^)P^)wAVrR_vdWC6@vN4eJpUXW_S!|Uw^8XOS)2Ar<|#0gfe-Zh|^N5gIF*nzGKHX+%5AN@!$inBde zvXOrN+1MvprSPo-+b_Z2a3o1fQ=R?Pq6$z2_{3 zpVwLyStKw1tb7cZF5EW`-n6!jlkl?w&?$xn_~lZ1SI3%l6eETd9K(Y7g)KLy%M6|8 zmjeGy+Xf^jPpeH@?_y11z4ZVx-ez`L!qo;-gjKSQ0)d*2+-av2vn-2&08ic|J9bO>pdpL<6jzLyhME zPzg2H2WdHpDE(8 zfZC3yzTd=Vcsz#(A5_e}e(V1HuE)FjVfLABwgjq#)Hcgs2AIovlR#KgS8JVZ_35V~ zqsOj~ikbA}p!aqT_DHBHLni{58s}A1H9VUynOcJ~T3<*R=VGCNC(`^=f7*cO*_!p$ z-id%MXFDvL#dE^-#s0fzpY6AcPC(IbgZmYS@kn-j6EM25eaT4vkjp$bedYd-L@6|! zn!PQG*{I4w$rH59aq#UshXgZ;)bj{Quw0=V|K|q}2K}nzTAZ6(t?SZsu%5p*%4||1z#5d5U9;XqOC=WS@|JHR4Vg-o-c^&Lv23ho|B?oDh}m zi8$Qjw5{fEv6tXSM35YP`$i&@z!F{@wvYFM>{WQK=9uVSl!$T5)`_-=(S@V*Q+~z4 zUni{?3+R3$Bj1q}Rvq@ZjCJ}dM=Dv?FmzGt`KF6K}tyV=<;WK!y_6svGxXZ;~>q|W8A>YAO zHw5Cin%lmA$gOY}_8M8fn9qC=F7kZ)E-Al#hx|%%G12an-#=4`Bn?iW|BMde`v(?` zsC;%-(YiTgDt5xIZg%fw)2=o3Lxxm28KI4=$nC`~roRbe2zKm~D6i5z`S$MztuG;H zno=2!_x@lQk?&$<@N{JI@`X3p$ZuC{-}JHp0Q15}$58{Fe<-Z}66`U*=0Hhq;W&?p zqV>DgeuX{}enaZT{^6UZJoCHv@=cY`tCQcKG#mADrT4I?NIfV(?r;6iD%x*{G6byE zDzZ+vvl1lYFp%@9FIG%A@M_{_@>T@r->}zvgTKeOk`~?6r=Qzm8 zprW#(vZAumL#5dk_KQW|FDj!L31Qc`AQt8tE02&P-5lXuBf}`iQWA4fM!uKI$!MRY zHl5ml5^cS;E2}80s`Rr`omZ>S1j$nTPK|UB1TqLgU~tC{)fM@CB=FS0E9s>H2Hfp< z6)q|8{i5%yEUNfWhM|<&doh%uxk5?drr0!C_f`uCBQTTR3^zpF&QWu^Pq6}^aZ(V% z_!Fy^C>-kvFXu%m=Xsu&JNA_E0A|0i5X=xl4+fNFgJD8IE8#?JBh+i+RzDFlgdkg^ zX^a(86h%@qt#(FB5KTI9EP$7$El&6~mPfX2NaRvtM7Jx+wG4zv*3L}FoH7o;oM|cF zgXl%;+6>)A4f2TyQeOq4Ww93a%zhB~zF#a9ip63O1VI?GMNy8hBLfs2wEbnPqyJ|8 zwmpdm!0G3n0AT9lvz(0EI{fyG%@Tz?+bXQ;+A{a(mLR=Y^t5*H7I*jfj z7tUrk(*A0}tJ_-ZQ|0LRla3z?V9tz%x{r|{gsTn`T*4_?H8`%EC3k+D=gjFArn0k> zJ@M+UrHI16yd~?Fq)u=uf7vfo5VE0wYa%WA;uoyf{iQ7R+IJ~&OY<&HOqtAOd{LRw z?P;T0N?1uO2uQt~5M#%mI2OS4>5GIAQc9IWS(QQ=s=K?CwJVgN@B09>Q7nQNrhx=N z2TL_7WAt;oRIM){ZgvyYe!0mi#>swAis(!Aw5$-1xT?}|lwe~>upjs+=-p(;zgGRu zTBWx2Y6QrB7!>_tYimnuYir0-vc4fqHCElXBq62s$5m76#Gqh}uO&w}BTH8P43G@r z#C1{qQ_UeDI*}V$Hsb<l47XF3rgW6G?Nam2`PFkp;?Z$iVz#O*j}bY;f;A zdo=EBdUf&J8d!pv9C;Qag%V^C|Jf8Ckq$W{?zm>M6-fqclWiXnGgGfV-48kRfWQyt z&w52!>!Zc&4t}(})s{ena}{7xMt$X>9~jeY+$yUOYi5`bcL*$*Cx2=)eYtQrv#4xo z5Hmz_{FhRR_w3ty&;6PSDB3ZoX60m!gC-b?)t(xT5(W3_ZRm6MD^|LdBZ@Diz?2Z25xle=RT+%5 zW$xLhhi>Ofuf$7W=X0!|Y>W!-kIpKFUAsdL8Qgo1o{c-3mM&Q?bwur`Ae${?R1+8> zTG1t7sr%gOS)3?|Y}pCEluT(Mn64$!;8H()fy_2ruRcA79eQBk2XkhZJmuz=X$Lj~ zRVkN}=!JBT+8CR3b+LNmrL-&Q*(ImRri`{0bS9f^&+zWje8rj&*OqN4eNH^d8e?|e zB<4eg4&Gyro;!CoEm`~)O8|n1nS?~nXUITGLB1p}M>(LtqQD|x5lHd~IgperS>^@u z0t6BeOj6fR>iSlFriKAPlrk&0dS;uQcfYwSYZpN6uJXCEs!8c5aXRAU-fYUAXOd+P zMkh9}5CNp)&cmE@r%^K!XdKBxS2iS!vZXGIyiBlHm{ z8Q;Z+5D+RjsM~Ed@==n&F((}fVE*i7#UL=9R|O|FH`8Dx_FGIJa9+^7)5Q8ij4!|t zl*Y28Ll;LCZ`!!+q%oH`y;g1_X8OtOP8$hl>Q*?3!I0W68~TB-!ddu1phDG}{y11H zCLGgTfXs8l(b}OKrxD>7Po;~>YELPcRklIv)@|Bvk4c$txlRr#PGROFvSKj6xm>QQ zsw$VuX{8`;%;Ol8jF7X{i>!CQby;XnFJgA7`1*~bKuvxIsU;I9zeap=^QP@5jk_da zy(?oM$}FeMTWwm@C_W}xpr1jsdDGSt#$A;Bjbe*1Rdw=%{j7ujvKAtfPB;?4yqA_1 zeV^=Y-p*)50E-dVmSZCj3;*sK`2e^UkaXWU4$)l1?RM5mIWnCug=@>{92;Y+~UtVr4Gj5PAN1P5zZazuE^EW77ZTc$<3DIK$3OKcP- zb|q4tG-ayPd$I&|SC*m%6RiNqdAXeDRaaMc=+L1em(S<&s<2RB6sinmL0}ALeo!p> z8hnH@2xQ=Sp0-|^zydL1)xcU=oJHv2T>`d&p?A!0krfB^o?7&~ZXjfWP zeT6B8GP0Zv>=RAZkN^wed7h}L=~!D+qp271d+wZt<|0-LR!1KNS6l8YtEozmdkkC}L;RDq1>rWL^~EM>X7A1()vyGdB} z&;_+N91Q>ok6D=A?T|QxHhoDVR+uF4gCGdBkD?$?1&Rq}RgOC3ggShlqcBfWuQC~e zL$%Zxg5f2)w#(wGl$rWu}si9$KE z6iaVX${-8_-}i%{SS%Kbz6}Z}C6gdQ0;EH%MZ=>dD#gTVn(bO66Pr$bwJ`F3Yl=ub z1J|nmsMWy?Aw)i(&*$>FT+S$6`XnzyMU`W{=MXLMU2hJ6Ov%@tWN7M(BHCR_S)=#w zONP!fsxLAAocOOQ#(|X?qSRqYnF_-f?|h^%YwLppV#sMyrm@ZaT2|TI?RM^(-kNGj zJIc>whKLw>hC9&ir*^tyCbAj&;22G0E%oF8#OWtqW?QFR<0WM@GNEzBEBq=FAxoeV zq-4mDnWYR_Umwm=%0M!!3xH&pCr=7UDOJFbcmd^9=r1?rj5ljc<7_jznZAl4&g?T8 zV?}1|gg8sHWNA+T5HVOP90@QWt>`BJCaLb43PP+L{QFpwq|s0@QJRQ6H{NMcDU z0#_(m8UrwCi;6PhMbX(Twp39t)!oR_02X7Ev-naQgp_HJS>L6g4n7*!T^Lww+Ha*# zTsfo+2O(pVFzU2rFce>+PIhNn(y>69nUrIVFGVQ)z%LeyWX!pq@HE)kYsg%s_zymT3&}v7M^(5UFI>PI7eIm#PJ=cXy(YFI_>L7!~)F3L?Lt#CiQ~=31&%xiHaakLNYOv z1nCV+?YJnNp2ILc1wP7#!*PetO{J;2w59e7ofY^>l14m;=|*nK(!4C!i*0i=F)PPS zhlc$y2*Mx?L*Mrm{0PD@kf9y@NZNr}a2U!EGK7?n%p_FH*x(S3?lMpwCe~9*C{h4v zge_T`ZRiI$Kqi z8H~VSWXIx4L{w2xQCU$@QBhHe%E&oERcLRkkL=s7Y|=&ORx3YUKpj|vl1!Pb-tHL3 z2|48!VhS$NdzXG9R&A~9PKioa3e8D4Vc0>)9LUh#WNa@dOe!&^8slrLSx`&?(6z?G zkR{|xf`gg)Z8Lp2>%EkujV;-)oV93bfxGGu5v5ts(eqp`-=RYX;gQ+4wy_Qz2BCep zqe@b!J_EwprIVyX=Q*ceD?3E&mXLa*+;fVal%a`IbCmJCEy_wnekjw;*i6|cdVTAf zBeBj-cCv4qXjul2M$3eq|LYwfCP$JR5DWu!2`ch{V-e6LYJO>Xrh}Ai%k^_zzcs6* z$A`3fEEU5r?Sk$?GTtDeWJzT-p(uCOY5GhFQ6@P=o&v;ibW#eBq>FSJZ+l^Cl#en# z?JC+$c$`OwoE$lnRdS5+n)MY0&xa!*5^EvGzq7iKXraMAgoxhQwRooz#n-G7ph(wC z>^dp9*@ z)pm;K`Ck$Jp#7cEjjeW>gEjP zg+N470wj$kNGOd4WV8|@7i9ym*V!5%2#q{dm{x1W<;=YmCkGo4NF)pfj|R_qKq;Dv zN;BA)qs%4n2n{B z)Yk5LVk;t%$ceY3<%z>r$sImR5_*3>xl6-_Y^0Q7F)VUXg)C5k41!SmWJ}j9Z@eyS zKW)8kxfV4?zs4Oo5YJ#u;AICUp2`o?SCDpNCATld2*UBGbSk#m1mJl>T}I-0p3{4s zDMrpnQoG3sOE_=_GLbi?v8IK%yG+wv${MB&1l_)rsRO1mWgtt?Ncp8+|q`i|tRGCiU3jhkb*zxQLL6Es&i&$w7=Oo9O|I4Zmd?6mi@C@20Ps zc*<99M!r2>>ASE$t|?G`wsDBtPLv|{QUs9lT#so`yOi4DI%Q-WMbb}7sdO&8NM!mo zEs!}3Lq7;uhLXdI3d-ejEQ3IXq$1y!4wv_3rT-P6Hcez-=rBa0aEc_1Vrc?`ggL=( zOmsv#Sg3M&hEd41dQqZ1$`q&hrwJfHQc6V;Y;Lw85(-L_KJ2eRr;4P^mg5=^NZV#s zQ4vhMTL&dZNdqbKj|R1Z1dABWh^;bPjy9`5|(7g z#ZV8klrWdanNf_{YSm#sKkx%TDEdX;_tga)cDP)&62Yc8Y z3!5!Mv}|6AmmjlS8B7dI1J+5POw!I!rhBF6Ayusf;!aT-KqO2CWovH-MP-POFO5>Z zJZ?~Kbw{mjgU-LiWzbg7*i57Tl4!sCHLf?srKa^cQNNb0v3!FP(;SIMvUahypsj8Z znPbghkPxQfC0fO-yf*rHFeowS-0LEYeK__lJ~W_81vf?VqQF%JSD63*c#gQHAMWd377YJ~BPnIg#; z9AR$lQk20wIASRZ8=6`TV3aI2h_Hs z6tzW7dMp|5IwLlWk1QMsW00frA!gNV$t)bUC5<8!hGC!%h3bg1p*>5;U{^V1+bOs0 z?p}6eQa9>EH0I7&mqQ7$-^!Z-;^UIyAYXw6H+J%Qw@M~1gRcx}IuBTfMPeg&jCvqM zKA*3wtnxfh-BAu}Jku{xjQHY-o%>zkgiA1M$9_g)Ivm%%q$xQKR2^<+=OVj3nW=oX zU6mN6^J`|Z+aQUJIn_KM7#CB$)GenmrhtgK>hCcHSUZ^k0Hphat&t+;73~39XlN|H zq(CiLI#<|7ttS1JA<6hU%;;!JW!2IpG9pLe+e)eCrBgCWSlfWCy$diy478_$5_wac zrhQy0{VQiMEuFW7-&LkoCcKKdJm!6@KFg)M|iBWY7wc5Tux{q7=<=6@=0eHcXk!U=_zp zdy;A>Y|Q;CXg_OMDfJTmL2G_?%%z`P+?1|z9Sh3oce2vWEO77dx zX8KkV5QOlACsfRY%8IJW3VVI8vDcb58kozlW6SK^M-f}_t__u93tNjx*FMc;bci_O zVxuoIAelp!E*4e5RXNKR3WZ{^X!69=O;{5<+i};lr=M6KLERqPqliaF^44i1#p^JF zGBFq#ibv`6l`iWHOVMuEnJGTB&cL=@t)Q5Bk3gi_G05ffl~tAM!Z5=P41dsT4XoWd z9d*N&reub-=qvuBo!ZIeJ{d?u%|6ARr$J#tjz*#@F{@VRi5Ea6o+o}SnMzPiR4rvZ z%&IBYhEl+QW1XWoyi{{bI-kLUQbqpOe8@6R%f6f+A`ogO7sSq>n@XL);0z+R=N}}Q zK#=JfNpVZgn$6hD2F9}n?r=!!3+z?e;uDWEEyoF+sSG_t*`iG4$R~rg+)*nHy~`Gg z1lA#BD1y43CBBx>6ga+A(hy2>lGOT2u;Y@`mTab`8_l2)0wh=n_5^#ap(q68 zvB*IP$jX#z*dBEvHY{a-{eNSrO^|csqiG&}d3z!$iZR?PLOGoDo{vtGMESG#c5ESb z4_g(eW6By+fwd1wDM27@g49UFvDFxHsO4(J>P&v^>B0;ZGC}!hh8%fn3i6Cm*FZPR zAB}*Gk4tQTnB%Tx&hzZ?ESa2oIQ208jai1F5?dSwvRLpn;K=2S0apkD2^(XWEiR$> zO+{HPPJMHnnc+gzIAV-&JhPfRby1iU3XI2(lBd)F4RdXn{ zHp+@5n<>I%FtU?U&&&H%!1N@^Et9=VSDslG$~AmfxNn>^N)mh7w=9RW@5j~w$0mUd zPtk0Wj9a`#x^5rTDTd^Fi6e1qda#nf<-p2vrHZGtV{ge0a{6-yYh^@+TGnSOVpOr~ zDbA~7%x!l|jDK;~gPpBiExU|Szr8dRH7Bh(lt-7D4Qdy2`%Qg0LD}37i*i8b`dcl#)ydB#}je z?!2%`VHkpaaI5ya&F3pjf*{YR$*M?qI80O9#hTpCYHh^X5{#CmlTA0zpjZ_m!}s-P zIHX~=YLe}6NYAnrS3KBXlCe26%^jJ}_G!)#_tN_RMT%q4G;Y$*br9uzUMWt|yCx0| zYZIX@OTE~(n`Fsm#Y*~OOs=Gs^wp$YHKe#0eAf~iu*LGm+(s=7*%~o#kT& z0>{@2X&D@?L^haJ|7=`PVyo0_;_XhC%x9-sM8&iIyz9mPyHgA>x5aQX*pJiqcvl^+ zxJ&KXrQA_%aU+$xXNP2%g7RfJg=KYjcNs=jeTn~O#`sDmb~(+iw8U&v#Vk9};YbBT zsC{A>d8c`!)Rn3Q6a)bnDyS3yW=N09w7C>)O)hU2cPDa2pmrArez%!cx#GTX{*uMG zBaqe83>#4VC%t$X3Ufp^aKx>0Y9dLy?-EEDttn&)kAxr(Oaj8(nM;BcCu2Y|)V*28 z2%&>?5fMQUd4iO`i)6_xWhj;PQ0mL4NGVVxNO+`zhJjqBlQC-y$B5zF)MIjT?A6S% zZO6ijS6J>>U9-AZPaqH7{_x`d1N+XK{mL_s z&1B~+Cu!eVmTF%S%6Wl63dE3OHGyOqO13Cg9qJ5%K;1uK0~x?t_2Qf{aa<|ozmXmp zj`KjPR%xi)));01SSNCR3GHJSQzoNG(OB7*afx3_h)3lS+kPW)%u3^KK?5ehA^>KY z%X#WjT)jih+J~0GA%|{D8DPnRL_}s<6J^O#*!!=Y%V0HvcEYI|bOtgf4Yfk&5KaW; z%;?0%$v!0~6H3f{nE`4~zRdA<%{lSc+vcj}l3jOk8LYgp6q3~(m6%AXTj0!d;RI)7 zhl}ZR4rY0}cXY?JMu1ghO#^7nPMz+BVg=IpF(|W^ap+<*amI9^J)QJaxhk=`YTTs{ zY0maCK>|=0uf#{#MSg60M2Jy{+Y&ugC6X?|up>JTY{obnQ`;u9Q6p5lOiM~FX`~PO zv?c4^8H|&7iTAVFUh;uE<1t)q2d^ZLO0LS-^OBg|t=QIOUx;UGLoY}sSIf$7jNZGj z&z;ZdQBXfo`XjM9HcL=v+5xrnm_bT}I#Nlk-bl=m1WTq+vSec6Nl?h}0f)Eh+>Y@@ zA7!(8g=M5s)8b}FL@QA@wY`?wM@~8Bh(5i_=Na|T(_32$?NV`e{kLeNzs=IyQF+{- zCo#QT;<>I``D7DPTUvTSs>^KErBK?`$_xn!&VfKso+>&pAqf>Zi`9J&M*J}VZgENITP)?PidSh3EX@ikLJtnGpu3 zl!Q14j2EtCFf$Q^RX?Hh7$PDS{5hA)b?8tfJiShJQv@j$5!UIFpu_437Kl#NvpIew z!Gdh;QqwXkE=^;k21F1#>^ZwWwPa3z+Ho=c(H(M}OX5$o|89EF9eI-+AIhjGa}YCs zaz!a6%du*MTUM#$0!L=ZXd_f(OV)Nwb;>~~?|H=~)fJ9R`ciopiRyn%7(x=ly8Xcs zmah7!NQzlszHOSVh)n6gI=f^R%4)$$ie-SMJ*`0&V=8_k1grDo7E4KG$xv0Rl9^eg zT@I~o#44ym%Itq2bWD)Ol>x|71(37 z7KbEkm2L1AmjPzQ<;~)l?O<27Sc(gO`*MOalgS++t8A{AfdR^5a*91l6q&Ia?Gka? znGsXgX3Z1@Zi5`Q5L>1hFIWY`tR4Hl-9T1s&+eO0Ey8h`17-i&Dey!M0Ift_m0XV~fcTU%P&S=w%-xb^f)7P_TtEdg*# zK4j+~R&%dKn>tOV`Ig%oc9<$b12b0FNs$Jso}OctEcKOi+LM+g^ldacfPf%j!~RDS zQ4d-+89XTjXpd_PDO#>yEPkx7V|Rn#phW#9*X;48bV^@z~UvZ0jh3=6wv z&@VyR+J)o_3CH{MD=EMI`M)3(&KgPAZWqaBw^AfWJ|^R=+@@$%Dma_VYgbxDT-uRW4_7E?~Y0KZ@ZGdWa@55Y1-l*t>g@@y9-s6sxfP#O0}nr8cSx* zmiun~3U;`Uj6H?J{%SBNSsj8}~s;VlV&l5;^0wn5oG+ciE ze=6?)TdD(J*u|z~q9`a^Y_U)*7K;;f|#TGQrws9cZJHV!NaPma9$E- zE+c4SN{WnB?MZD(os6P(O9L@`>tAw;;4GNUVJz6FL*~!^puX9q7eOnys*yhOzy^r5 z6OYle;Lzh=!cC0nNsBv`dsqINU3us zk@U`0G)AR{C03ln_slg{<)H0XmR#Mbd~y#>w7>LrPjs_99ou(&?h^-A*py zlxsuQo_1WXQwX%&ph+o%K<09=7FDwtSYOg7RD6F6R*b(GYg8NYVkt#@TSHac4ofZn zU-sTT+_s~t6a9^vYwewrlbl2%L}Ebl00I#R0fYc5G%p3w#s_xWVjC6P#ui#z#jih_ zR<3s2-rKf%ZT-}XEsEC{FQrvL5k=&U2nw`75<-vw3FLK>oU_-OHSQndQKM?kxgPuM zlN{_@Y);mit7bh$jT+-OMvbcC1@rUX_!fWg(x-l(V{$aW;Uze)r$jZ(tQ>uZkMD7TkW?S5k|ueeAx8V5kAaymx%B@B3Ld>tdZ{6+fqN&#;>r6xA^H)-z_ql4#Z!Jp^Ucg z>XTkC!Yh9m$fd8%GU{ft`R-1dbu0i9!|9^0sx1mVIwxDaVuqSV5)DZ<71^K*%!K54 z-JeQkMFqKnDbWv6c}><5X#2F4*Qfcq=G~P)PwIQyNr0#)^T3&z2UYli+1@fTW{eJXCC@WZN!O{QS(~3C+d7;NjFQE^q+vO%uMz zj<&%BO0ue;kcPOdNxKI*06vR36voWLo2*eQEU`ESX(c*&)HoN?WJZ<)2$?}#4mhg} zyltT4==TlYH+4K%@!0UyF}q-puPDQflfe9~T&p-CbQ%vZ)WXKkOIuNXeU>ec{W5qZ zD91r*6O{nRd)&6iJDld!%_z+!G>AEYJ7NYn3qRXg3ocIqWX^I000>A#Nk)f5D+#=x z(+@5@`v`zVpFeTi9itik!(%SL^3n$a_~(E0XYaWF)AI2AGtYSQv!4mzwO3#Jf;YWY z9{#&WJoI}nyA;5aU-5^JxYs@Z<)!z(;H)$6T=uW~*e8DKo$tL>&M^(?ihJMdTQ0f( zBhS6(Ifr)dST6tW#+!cqgCG8rYyV-i8AN!|qc8u4`(JRwoyWfCPyh0&n{VAmXU9v{ zxkPabt<@P)Q1ikonL(U0dSZzh;iA=Gaau+C3aq7+Ozh@9=Vi{BbFa~2irl&`&AQa3 z)Fr(`e1w&Ucw-aj`M*B)rqfS9?XpY0`g5PV*&jat2d@0VANlTI{pH{N(HH$UtA;*) z!&`5<>6V9I@{I3&!M8p8Tb^<6^X~QOPu=*6-~OYY|CyKBi5?}*=d&xH`|M|Z<5MrZ z_`b~i(GOqy+rRnR-+b9?ILi^wAfliBh5z_ZzwxQ@tq))KCjWfn4L3dVOP_gsZx6?r z5*Wvnn&-XXInVy*PyeFx?)B+U-T2Di`Qu;s+22?! zmeI;-V$^UFf$8TZ;tgrvt>0Sax1I#jf$3(mo!wn1aEUfx<*cfmSc+W;dINfPXO$ky zPh_4j2S70R>uxanwUjU5SdNrV-jV|x;sdubwyCmqFSos5>R&2r{(j7@nl)7&9Q$ji zR@VEH`BO#x>y?zHo90@s+>um@widG4QJE;2E6jG?>04~xvHC(_pq$++Eo5B?v1UXt zEI69~z!%0iZn zW!ls{YZqnK`OfEEy3d(s0QlH#NBfDPxZo@ez`gpGf+IaD_v%}23ptMfSZ03emz@8@ zk9wFqJT#kq%Ow}x@5mY7`p19fITPr|9{0$9ammI0W6wMHvFDxpU*7e;Uw;3G zhRyhA54`BxFMR-jGk50Sc>fFj%e&sUx@#MzR>)5CF4sS*|0d^5Sz|{G(MBUzhSL)O z_a@5DFn1ynY-^aF{ z!yfpMhduC#PrBl{|MG=>FV_s?mRoPT@rKXID_?ledjRmS0B*eTCT2Ff4abk~-FU-I z^3%@l{K%0r`o2GU^k_;+j=L3lE|>jTXP^0Nzx9*n-}l}CKKI$151(=RqaOXxM?LzX zkNC2Oy!eGb4WGj%r+?_*fA`n?(k@-d1=|Ko6TmkZq|i75dqoaY?(yG#mcftCljZ{5j!zBb56NJ z!Ir_lH|)S6&R$%?iIcsyQYCUJK|ZX}pC`tKmGW~jwek3lSKca}HE)ulG>YG06d)eD z#kd5#bM;CrJp09x9Nw$ptpDoIHA_Z3vNpiID%9SwDO-%Dyi+`}^>7D%QzoKB9yTLw zAq!)uVjfyB2daqxb|(S{qvLVNFb(+D$DRJrk?vIy z>Dt3@zx4k9^*!&q>ZaQs`9=5q_Ddg-h#q_1xtE@Ej}LrSLCo_n|58D;SKWN;?|%5| z&mB8{`MKwO^8+qQME~v)4|&Chul}4x_j-Ety~}Y8pAIcK@I=FdOGKog2pW&>ay14D zVgo7wU~#avMJ!1MJC9aQ?~?K;$>y*m9@>t|2C>eHY3#78~mVefi-F)F^}yPti<<1hcrr$75| zzWc@Rc-!9qc>Gs9^8fzjmpu7tkNehdf7Y-6>Z>H%i+|*&U;HCKE$zAb`Zoi(;^AL^ z{PvS{n~%(`~LRZkIL&^Hxux`SS)|^KfmDo``-Hl zfBTUae9wkmKY%4hxQ>;LL6-}Fun^8d^;4?py>OTOwWzwM6O zk1_b7i@)T5zVW3`f94Y&_2`Ga>mBcls`iwUHzyrbI!A3Ol<&%zEbn>RQBvbE@&67=R5=;^Qi}EjJDoofn;R)}}#a^2h-} z8>ZE-(FS?`cTX!YrY_`8j?Gq1=Cvd2YYJ>%*mkf8sNLP&oy}&#Tsh}{xujX@B*cbU zun?dVVYs%;!32_DQ}g@UK8SA>z%@7DHkx54rSs1?4B%t8R2ho!ri*{mhNO^Y>S;?V7#J(Foliu?IiD5;If^!Qsq3iIr~^s~$=1T^M6JYs{=fdw``q)2 z``q)23-0}Rd2;djUnx)I@4Am)zis!W+S#o8`JZ{&9cDsY_0elz^}DYF@PvQzn3(lh z-}E#9FM09L38Dq?mN&oqML+z10{G@{`I;4VP@Q1T5&K!%5q$_?M$X*#{c^e3+uNJX zyQe+lD*$}|^Ime*N3I1p=l&JH{YSs?KVAjkYoGNb34wEh&1T)t|IDx7e*2wL%T*t} z_SL`pdH_#&(xat<;>XiUi_Zq59B`MUVH57shOC@H)9so5Wrc_y`7?KsAAkxV5jslq z*?e~wUAN4+2WLHhky$?L&UbGA+c5(fr{7sGZ1`JTQs`-EAXrj{JpMvfnyxRP__PGFT!w{a{)- zZqM^)j+x859LVKQa+58_HfX<^fheubfL?}7G#sqbejn&iseLB@DRX&ukS*3|ZRU_i z3s+L~%AcbD5k{w>74$Rfv60Hvnlm<-SqRH=cBJq#>`66t;NY@e=^OMX=h10OPU`;ca(8!pKsn<-kxzR&F)~_y3EHimYf#o7M$d7 z$!UphLEZ6gb|N=JnxLdhh{SXZ@>OCe|O_ep7Z0k9+eNrmU;oS; z)|cqa>yB#9<(LM2)km*++b2JLWOx42n{Ue}!JlNnYQ;jKNY}!0_={3loZZ(sY}$Q)M2p57Ire|x0C2rvtItM4_y@>U-i*z0o?Oml_&VZ zi|z~H?SJ*x@!=c(_%FZlna^7;mu$Z1Quctx&5p6s1oe1nl8<_aFc^&U?|bi^o%u~S z-TL9bzdD>_z;FAjzy9{;e$$s+@Wt#)(%z#Fe$<8%1o9q5AK-YL*1Gh086JC*LJMN4 zJn~cHr)*l${t6a9&3AX^9vcM!03ZNKL_t&-yyQ$sDIwX|LD8he5)$C} zHLS!8v`BH(>x}@$k;R`R8^+8zBANpt0R$&mjoIs<#uXl&&JAhWDZOrv)9A-xVykoX z$S`Zv@U`)>xoT|X2uB5~JXh-xbw8&ff>3hpx})$P*vU;7vABPf7VnHb*w9i z{iclqC>lLno}+m_Igf^APE&8g{%oxMCk`+OGjr-iTi*z}+dmTnl#v)oF!2HzoV%Vo zEDxvo;jX)r>5jgqJe#8vm7U7$=A1h2(jqUHIWKx%^ttQ0jzF1+(Ghjj&1w6MVi%t6 zpmu!U)de9#L>m%Q`>8wbywjknN7=sjGdIK%&OLlcK3r!2zd$~`_=<;5uytcEPf-sxQbZ?7c7cakMK&V zgdD8yK()xUZYFIgeugV_x8GiEA3T0+4}*Ay-Q67kx872X+G4SM*E=?id#-GOaO$U@ zGUH$6Ki=BY4($TC^_JV@t1Hf1ZoUn`?(Qx^*p8$-ZojkODuTp6NRJ#sts^~RGs5Hc zwUZ5VSB!mS8=QKnkb2AfqMp01>*n)tBd*2{ay;wPCMN-~!Un{&uU#zVi!=TM7 zzmYg#tf@{{CeW&Om?W+CX2HuJmO1j()qpLp!tDnS31DU-k7}tYSpH{HFZ@rBk1S!o zC8WX9=u{dy6ryx(7+taBTk@tKv>ReHGH0?C zL#rEwCm0&JvbVRF`o-SfUhZ|*P~Z2V<@K?@g7IDIcRSbXiR`uw7^&yo*^=ksBW zi#~t+whA5{FfyPJrK;suvcYq?VegNk4E4F~o4s6?JMuE;uX+$O6x6yzPDH*jtg{2G z)Y2c5HzPP|yo(3Q`E<}jV5yO+9vNwpSN#>WooLjJBja#qpy`VQFM5i+ka11mdh~=` z00*B=vF6<6$>tG*yVULM>~vk{3l@TF8#jviztqk&9H4<+W^wwTRbr9z19V34$~?E$ z#s$GZeS~Dd!`g;ZWDHMY3tE^uCN~;*A9L2AvIT8AAnU=4qqc}>IocKjEg<=u0;ip6 z)i0y;R0b%QBo$mJ|KZrjfM7k$H(=Tpea01pAQTHasp80aq=fiuaU$3>8D`iJ{*EVy zJfELw-|8={I2GYxKiTu}b?Vpg!t3J;$J6RjvuajE{I5@}S3By>Va$Es@AWyO_oFre z^toT`EpnG;T}tzmQp){uv0U!$E%x^IdbxU3s?H$RT}ZT>w)WIY_`xm5_ijGkZp@M- zXCp`+e|Y)1=SWP#RbhMCg=dezUjP@MeHMUE-+t#E=F`3S>@xv;{MMsS_`TOQ)on&f zuKrWrm8TPOaL zoqI4Ny4UHa12{T3wsv(ovO7Qb^g~zQa$A2eO9%~GA=1mptFYQBab9h2q9jpLDuy+{ z&Vm#O;LPl&C6N4>QtHx7?3R?eMAT72*`>?lRu~UIZ3jn|izO^zz|(1`?E=`_8yS&J ze7?tz@9pmHoO$H%@f(WeGoQ~cyZqASa{1o(d?03Km#b2KUA&Og)qu~H@_P6$5#4$0 zIDj*coWbt1U;=RDtTO-{J9d1qd?_y%|44(*$^TcXY3si0)6@{G7@Gb17DOT3eO;YM z=3&)y@4DH1wlfFNvxcP$L*&NI6lNnxbWpu&Ya4fbX~b?S7Z_BcUl^20x7Q%>iLq#L zhuI1-;2^@|y0sR?dSf=v7E6KJu#HE0)jH#5;-s1ib!@HyBi1IxX%{onWJ@?aS5>Kz zq5&gLv~TExkfBIKiIRHD(S#4iHnd>Ze~1{mJdcY4c73kg%8MGglD`$7dqf&pe6E;v z5po6DluLUG=h%EuP|K#$luEMTP*cm$s>Z{x(uv6T5r#hlyMpYs;h8alYk^4qN@l`4 zIGLtnItOVbb2bJbR}KU`Vc#IBVpQmCmch>MXHlfTwBVBGCG8jHLYs`bgZVdh|A z>Nu_x7~+DGj^Gd^?ZDpb4EszeMEZeCjh&2 zmvRGYr!uLi1n}yQe(ah-EX1=ezTZzg z{>yf|^!DpN{V)FLP2>IAF!@4ZNn--jKuV0k`HmcgSl%eyLcv{vDnkGF9u)`+QjNHCe8uW9JD%TX3Y@62>@>jBnIsRUwThY$3AKSjS%RneR0UvuZKu6@iL}XtfzGfDOpp#HV>u(daG8Fl2!Z5Z@4Wl@3 zLL7yK@50Wet=eLtF>Kc{y8qa+sOP02N^Aw!9oj@J*%}OU!w3fz(zdn{`xc&~;1lgQ zPZiH)jttQ8@Etd(H)vM#Z4ELXyj@`H`non~jZG;J81x@9fRrd_UMvjFvFMIJ% zO2{Sj+L{vj1pu7;79y-p<>-Uy+qqu(;cJff89+z$tcx%B?uR^Rp3+}^@>BAwyLdgy z_PV3D|HR`S^|McW>`NZ|$k%_v)1P>s^8oz)O*g;#qaTx;OXk1%%#8rfn9u&-XZ(|I zebB|A^v7iv0=em+~XIMnFA+!(G^wCDGZasPM#75oy(>J^Yz>mD> zd0%|~x$@*$-|)02J@s)p=Rfg{3m|u2Lb%{ z%LfrAM9eIwj6M0OkN4+Xr}~}nZ=H@EJN~*q{0jg-`wK6=@Z$RdphVyJ&z}CAE59DV zAH3>MhS5Sm8S4>58&sA!c*?j^_?t>&8Nv_^oF|*4G03~R6(^bwI4Jvslh};_GpCex zcIJNjhDQMw4ILcqwUs&`Bb5_LOSXb)YrJcBiH$hG5V8g&r=^@yZttnK)O@>tUbWzl zxEM01ioCkWWrn)~B~>C%g@ldwtCU~y!r1E(tArIAYX-OLN>kOYjd}AGgMdwkQ_L}| zyjw(JT}~AG75%WHu^e!6{D3I(VwLv9q3{VXa@~n0HJo;$(sE_;QP8j3sLrvpk|I+~ zv3c>EXq*F0BV;FP|3cFMweuYT2_gbur$Qy>yjU#yaL(0oxjcUS_;T3;8a(R@We%sL zg3Ng~G&@(MvP~cmB=)^OP?KaL01_ zsiU`x346aIXGl+8cg@GY_QLx;^TIFj5^g!Z_xwM5>+#T~|KlC+{mrj_;^F!H(sSX{Dgn35#+q{m$G zxXWMh+Fz725M=fL^?&r{-+K8UjK1=+m%j2pyyW}-`>(v@$A9Vv`{feApS=DpFZ}+W zvf#gM%o)|3Qh6C%`ynQV{ZpP!44`GAn zn-x02Rh~v07gR4IA*n5}OqId*K5;x12S<5D#2H6|>|@Egey)qu4DLDWOdrKqx`>Pr3_LK5)T76v zL+TV;lS=L5jNuLTul`ocz*NprV7L)zmf-;A2PIgIOl53B=pV+;Mys4j7CoCr(ZEH8 zjsRu&b_P+tHErGV%f=22@nc30y9Nt5&@+T8Is6<)w&51aMBSmo7KzT4(d4bD@GI$c zV^XQwU}1i+#cexDEk-t!TDn-sYg56IiCBhUW^?@pN|BMy79LEqku6Ww*xlMp?$@nD zI3~D{3K8n(;qwsSL^;PA4?unbS!p*sSSV6wGr>L@x)7g_ywT)tG*I}VTH$T_w^8$C z>?X2O_*bi-O}f5Pk`SDra2^aN5|^1skR4#oLa6&LEz#qNq_x|lC>eCF~f5T_L?)TsDZ!Wv^iu3Mu&S|IJc;~SX-*n6Gefa9vf9$$`jMAUF z{f<|B`08g|c;9Pox$T92`A$r5*hZ-c!ImcOx+6-&xonjU)-dazzD;J@+acM|DdkGN zXkC?rf@tOJF4-SeiuQ&yN@384ee~PYt+(FxbzlA57yQ7LPyOmIKkvMAkMAws{m%FQ z`met7HLrTZHU(Ec&c$N+oM(UkmCt?l*MHN~F1YAE0RHxUfB)Mr|AXKB_1~YGY%l$# z-&rn~-*)BKf5`>s&t@Hfv(G*f%RJ|tvzvR-<~wtLa`^BemuWZN@VT#f%6B~P`OkUU z)4%fk^UpngeD81G^TC(D?A5P*%^Qn4n!uDRyQt-FI}W41;f*S55%viU^nTKoE{jd2 zE{58`HBO;0o9{^va8`}$79o%*r8Jw(<~#GA&>Mvrki*OqkZsx3@uSXGSEFQDR%a}c zZ>12xL|$ntehZ|v9xrK$o0yHy}%7&lGC`T3L?ek#m(%uc| z#9)nKu4Ymc2Wt>{?ERwBJ0G2ZMI1*IYe6A$@Kd5zz!jxRyb*yzv%^0kq$Pj}zS2U3 zoNFkj@D7X~(Zp~1ONgWGxHb}4y;FuG$w)y2BF@Y?*B(;>2`83D*DTS-^14p(KHI`! zV$PY_;X|PwD?PdHwNbAOd;!YdMzT#{(Q33K=|oGF*pkAr$_W}e%<5F*Fad07F>?;0 z*ZoJnsv-n!*mcZ^Z08i$WHtjxQy=lS~6V8)T6;*E=Fk zGM(C$vI&yJT&HAHbR=yox~(y5^O*vis7|Fvu0SpOTV&G-naifbh`VZaX9tSco~BGQ zI`F_Si=P_?7p6=s&$nZ;*Q4!yf!Yk9-(_?|8#s{P}gCJi#hf z!-B2QiO*|ei}0?^G`(OYGczyxy+yyU(_}NF5?In2^|p3h*XfbM%Vpp9z0KFKtX=dS ziJQGkvyNsKchDu$gEl2f|A0oREoDr4O#ZqiZN4o9wWvSw6nyLLkgR!cgrnAQQC0pV zdL3!Q_C22B_D%SF2rGw;nj+N+jm-w0+7-39BZrWp$BNWDCCXJ)CflB3p6~9?c6LrX zbm+9xPV2$FFNqS^O;Tp^d&9Y)L<&fd6%x4B0(bGWpmV|`t1Zx)Fb#s?Qmlx82=6Lo z55O*Gfs2p`2<#Hny6M)f8n{gIrU3UEGmdm@JsXub9c&Fl4xFk@0Rh$WC>_kqXeF1> zkR8+}bqa9KBRBFm@ErwAO&bE~s-aiUrS*#qACUrL&gR|J05gYr9E#JTskl5=1!*Wd zC*sVR^T7HT=}c1shuKsRs&$A498Puubew}u7N?192cc35JX%49i>SU#w`q3eLtW9E z!Ru2%&LJe})KJm+_sj;*Xe%*IkUwYIj0l-a%cQ|Km5K}(#-X>{8KbE?h0jp$! zZ=F?8Ygx!Gk{piZY(Q-gB4JshLc4i(pddoi_g!{rmlA-E=mB4Fl)1)B-8L2&ZWRq=%JXR6_W-fw&4AFLa5pKb~LEMPld9XO}A6Yt8 zh_j*@ynnPm1q&#|$3r#HePhfk;tlRG!s% zV8G}E8f@iSMVH{Q=RaD zdbX>!<*sZKBMczHLKBk20(J^#VS!S_@}jt;2uPx;S|EPHd*25VD|&Tr@9M3};XnEnHyt9t8!> zjGj4xh_nmtMAqWUvTmd(w~M)GbCJ4FDu2-EDgpVZ)J26H8o^-ASFB=}tn!G09ki;3 zzNJxxL}i3jlG;d(;F%F7r!wSzTIY&ZA=*}4A6yWQd#eLuQ8ingg|$n|z6(<%Q7sl+ zXoq|b?ErlqVpywEN89hUD8(c|0<3{RRhXig+?n>tXy!^BHaWKgdxkP@-?X(EHn*e21zw7IoyH6EA>PXrMt4*b? z-icnW;V)H_Hk~PVpBZ84B#bPFdFiUE43kxuflMGulqk(+vz?u6E6uFO`xi30^ELsQ zD8cHW5d{eN#qmH9qlSY;!+~xbQC}mlFWLa@8{|v3rH|5q63q#~Zx8aAMdGN0noTc_{?q3iYmAmj zc(>dv5FMQ;>Q;m#h0>(CXc9Y~k6^UXz}4ut^NkD0oFBocWPL@BeO4ZuVosRro^dz z9D_#HPlK^KS@1;TLk%&|dvY}@V3itg5)E^JCop+4Sk4DbL|+tQYWJDe4((Xv+(Uj;yj=34@B6;*Gxs_7ZKRh?ehDXF&Oq+<^4nw{BC;EB zH3TV<>SeH6wz>g8gTyG&tfQHQB}7K4O{NooH>2x#*kHgX)0UuiG-l{7hQd@nY+mmm z=aj`Uk$tqrsp#I-U^nQ@N#U@fX)E$KZ#6?(XPRK3jU|JJ2vm{obrhpCCKGz1`Fu8? z&kvn``k~Vg%K_azILA=Q3M9yMO9@C0XItKj+NH!c7RXVrRE|W36!2hER&=>8!x#o+ z0GuevMQCKpFuK*o7Nflp%YNA}dpjW|rIh4{HSB8iiaA#-R*t;x?+&v!F&H7{(gOgT zy4k`%s3`K#!U&fmtBo^AQqfVK*#l0v%vaq{A|=cJL|01Tvd_fY>HM#) z(SnEloaVh@XWP-;@=k^Iu7neJ1&)}^3OdZ|60@P|D)r{UGl!B*-v7(Pbo>#Me zb!FD3VKEcGZ}c0}itvMdr=g-cg&lJHP9}nNwrZ07*dSO zy0Sc?@WsFf>+~%JNFlcHIb7xqIY+|CT12Zpp#dO^m62iC(H@&r(Xt&zS7%^xlSaHG zjcVjlK8G(W&G;?FO2Fum#8c+bL?IQf1?ue}V?c+(|3*N7RcYVNL@XLP7D_P>*0ZXy zmyPLI13g~_rQwmj9zPAl&`86bg~JV&t@ApBmP}EbD3Yi6g*8^PRxVb%*I)Qk2|o;y zwg7`t2$vOquGrD+x2DDc_bU7qH!j9#jgiL%%Z?)7#!PLxd%`Q&`%EhUee-K^YQ=Gcgsk4PTMrPL26>{!b&Q)LrCqfJZudTB3Ve=WdihKt%u-tqx zurSfaQy=fH^O&xSRow7bnxxUeimH<$tyk-S(KV+P*)6A^4i)?@O*ZC~&~-GQrTLt@ zw3J&EDXjkr589HbXsk>CkQ|5>k5P$gb5D;&o{@qW`Mtre%~#Jx{+T)WMZ6OEngM_b zln6O<&e>;11`GPm%sI2|C1zPY(qJZvlb1X!t@!^;Ojrn11Q+o3#S(^3?3xi8^c#&| z)?EOwN)d%Xfg9RwZ)Pdlap2HAV0)|Z6_tN=paljIY`>hHHszUXOsg%dTQ+K&gf9~& zLV4Q;p_n}uWgL!dtIujBZ$^-Bsrttm|s;(8n1P;GkL>;x_ajLk7q z3IM=-GCZ|)ni2>8>)m7lO(zdUi(xJmmqj=WLQ0gGh>0?*wqzIhnoMHVLFs~M?Rtf- zOEXF-5ebGh|7@SL9{!ceWK($^jN90@Q#jEUO+9dcJ8+$!!ii6z!CcXhyR40ZAgO&; z{g(kG3Cx+LojE`~qGc8ZtvVB!v#fZq7^W19v*_0F8lo_D26Yu1Jg*HDu!6z?xC%rO zl#NCxCLkNg?wR|XlO6JDfLx<#GnfSg3yd+*V17+m`d2q+Y?9+zc>V%XrFW&_iZqMH z_cHa@Y5^L^3=x50>D)2TfHDz#p^7hbC>-cq&tHGS&DOV2Z<4MWr1of0B^I$;Dn52? ztfv23tKKR{yFsb_Xkc1gok99k001BWNklX>~+-xEx zBof~a>IKn?rS$!=6%w^3?3d6LCP>=|5WjNW#~~@|R6XC1eu=OwRy@R@Jm~ARe`tL* zsNrMDwLueO3#rg^%*h_)G!tc)nv4{KVV&72?B=a2qp{~)_u{03+EVwrz|2(!#wngi zg%nxz7=R!r3qCPW%f9+4h&FW+F;5ac+vh&#KC_*DtC!_cqOK#miXl!u6Ne`w4ME`W z$pKc)+h1zG`70-gXxGPA4YHk(S9RT#*swi=*VfF$yC0?LId9tSD??C9PORI>A)bK^g7TF*O;m2M0PdWS zEc(dk&*A@fRhkHd7{#~~?P}2ciq`XrZ>v(NTI9es2hyL^bkadBFb0DD5v3}oc4bbR z_*_g11JUmF=f~+`>j_ z%7yazo~GjeHb@+KCkkkH(wPn*qOR+@ot>`h+`Qyq-y5oT@tzu8xRrpvs$C=fJB-%i%@_U_F z3RYC(duo>ST7HPJs;j{Xpb*~NpjBTcn66qc=>miFm}X0d^pSs+#L-)$u({}($pU5b&}FF z+87dKopWkGX-ZD*6BKe2&qoADwTf&#+Q5E?O?*{CA#93_ZF2_qy@ecbZ<#^p+@nj> z$vFvx6by5%Y~&=O4f^99*_sqyMC|B>sW!*!(k8~Mghh^IU~YB|jP+~#E^-kUrwYv6 zswJyJq1ti_To}{{Oyli?Hzuf5;)Y;6=+##yIJ}@|hshEJvG3K!Bpk%(D3FuDLO{92Zcot4}PTHQPnLA+yFN$^w(11rdtHbnq_Q z(2&Ntx}&vWDE4eMsktsE9F-L zHCQhZqiiBc2+Jthc9t+BgFwdCnR1F@DHFBE`k~DazMz;(yv@wsN2C8#!DDH2S-Ymy z(?x}|@cfNpqjAH46h2I~Z1B@|T?kc-EVfniMGQ3V%-pRYKx0t{6QpD$yNhhtiXeaQ z5>PwAdix*#gV&<_P2?Jk5>ZY`7BVJ`TVuhZiY4Yi!*Da_ocliaocqkZc_K9E*1{BK z_J--EpjD@_<%yDPYPofTH%FgUPd9KuY+c*9^fnj4R%u(*zfWVSRWsuyZ-;0b)O0GR z0A&5U{Ud z)B`A@Zeq@i0;%=^jeT?6;bmAK1x{8akBJ;2H!+57@qsh@Aqv%4$b>K}WtsC*I1XjA zUkNf$?<#?jJ)AqFXl}t)HrSjr$`(>cB1%bMYc_bCj6njXWd>);nRDh$IiFq?OhAe4Xr#HejO$o#Asryk=SHbLa?u_2nxBHie!rGZ?>>g!l2vN zR%ktngSAyEtTd>vYIyaOxBwuotB(6J%NBreqEsg2F{qH@bfuM`c3WLOnnbj_yeI)T zBfiYf)1)hl~~fTQxpT^sPOY9Z9=z$sc0~46SMM!>fUb*(op8Q?=a>8^c-jjIo0P4 zgeg!K<}cG=gs@V+>EdP)YF>QR#iB=9qf2A4(NkMJcEPC4Oi9*lVQ?$wj37az8a)as ztoMsp;ba#|*pfdJW!?X;fFafPceDC0ewsxKZ4(eKC7%^H4P{>4Ag)$Hp_{sK$=qdK=6uPLUO*cakc-*oO2dt)}4=J z5$J(RTxOD)W7d-KfP^vZ!nStdOQ*&IhHIfQ8->xvNHt2p!pZwmF%=8gY+V(KZj=SnHi#KjdPD=7Ma!9psSKOJiza$AN81MUgb6fg8a_WJ1Ag zRf_YQt9w$}G>fTX*8_3Iqc$G6mi|&3rPK?oB%+iU$o5&GfPiBz3&(8z6Rbui9bhZW zFr8O`ZH6%5l z+TzJHykz4OY=DuH%O>yA2EuTcOk7T-_&gm~p0^S_iZuY$QHFs~gp_Q&mru6PKr{ zeqM40h*F0fP(!w%vwX}A&?a8DQEVt?Msp2Cj*9zP${ppd>ry8!N0o<*9?PufFETpz zMZap*$Jp6Spi;@225p+gO)j=Gy&?&lQDlUB*=&x>QVNnVNCr1+0ijaX;CPZb&0vck zvJ#1sXl0f^2Kr2lY*ufVIzs2;ZmWzFN710rwg_cwUbajW=uaq106gir2y24~gH-Lx zs9H0SvijetWw9WA2BeI|vdgv5$C1{u=quIi;rLRCJX|eF3OfP-`<$$az7c31sb|e= z+j0H4*JQFJq1s($wbZk`eoiXvIQ(vagF$v)B8Qf8m$*y)tXs}HxwAT1AZOOqOrivm z`#E#=gRe3(1-DRw8;}VCgIS)N7G-2-AFzT{Z)eSX1}Og6K(m@RrBd> z!<8P1UKKlPihz_eQZibDxm6Jys%erzc9$nUg2i>_QYaTZqF#>8HTDG#8M%xcnqQPT*ZQCXR`Haua#*t%h43nR^3bAblN zpb}wzt5z*niG=ChOqGdkb0N!d^^uk}!K{TguakxVk-6hgH3p85OCwtqu!)l>zF5%k zpd7~xRULs0rtD=-kE(R8TQsGR;>5`%KhIX^(*0sbTb>}A5$|+)KF4g<%@Vo}xzByZ zu_cZ#X~_)ajE>P+jYUC}uS`tEl&Ia5J2eI z^%$vS<5AZ|IkQYOYOR$<@>jSteB#)TfOYF3nkqAVw&)^zA*i;}FgdtV#c*Y<%0k)X zoM56{wO{j9S7Ou)eB(~#l6S@Y3wi9FQ7_B(X_Sy*@CLZH*1MBMoIvexiD)AjRF#h% zkw$|Oav5dHUCQ%rIq%XunWCVMIyuGF*FK5BeKwC1$&8A8o8)S0qC}}jc6^uA>=s05 zySb}Y7vbgOB}d2#;$#8Pb`38p-Y^NrC~jU?qo7>XPZ1~F$1Sg?8> zTO$$s1S4do4CIWS^L!_D65R;MO0XKz72?R{&)Q!z`_;&U z6;|NBW7>%0WGsqqg6;WZor&d?-=KFKG^&kguT-`K*(?x$ZBcemtJCI=8ALXnN^^~1 z?D)GvwF-P4Rj|IN<70&39LK2)mNr5OSLko1MTm6rPK%tX9Lh!*Gkd^5&$*+nC|>1o z?t3}6FSYPLw8sSu2QDv5424ZXN1!v8smNG_+0?i{8c%lJ1RG&1t$98&VTx`cCYv+X zE~hF&d);(vN*h-mRi!)|1wi{xX0VC3V>YMV`D}N0XLonEOPD2+d!K19W0B3cBvl_e z!-h1eI(?!ITwhR4^z{V>?MfjMp+;LnG{VfXHKj3M1Il6m*|v?c*_|S8M7Q}>L5?H0 zq0<)KtUFU)|NKhIog&}E{WLA~+yrah9jW&0Y?!}F6T*w4R9S00_}7!c0qSiT&X)qs z3ZN0T?^2>}mJ*q25G|QW>)!+t0K^p2W4C$36z4*e(JMV}PM9qbN&%16j1e+3qS6I!Jfb#a`%;5$#jk(j@F)V1j7>i|Z$;E|zhCCBmx>_P>lJo`WtSO-Cu7@mmWzI3EOSck2` zKFkpJXv6tqJ*H6LCW)ENyUfN@rc90H>S}2ak<7l9?ODlrwLCN28fX>#I7I@QJFe2f zTrdp`(Yjw>RemYACi*Dsi!(<~R3YO+pH@EatQajpd9t3&)<%kD*Kx+q)rPSuXxom= z=m1m8e@(Uxkkwe8Mk>{ccz;UxB%OXBp7k`JrQO|h=+L12^1y0~wmnLmOm-?yj6n0jmN`NoCD! zCQ+sZrs$%*!K!MOyFVjV7<2%K%bR4farDMHq$tL!E}*MwmLLco2$tY-6pY$rAR-Ss zq$0+O-b5u+v?XC=BSwH~Rce$VDq4^ni`~t7jocMyB86g#E@m|DOE$$Fh!rpuMf%Hu z2zIT6oiWCBYyuhmi#?!*JcB{HW+fzIA8r6Z3g{x65H^#c00?c5#!mz(|qce@X( zHhm4ahhdP%g|8|etF(3C85KoT4X#y2hN7f7sFGu-LVD$Mt4a~P^Wm&IwQm22hN9E7A&TEdf&h za8-3cQ|*9`frYYkc0d}WP;&M2IFYs~d=^VNpf+bvPifZ8Xg2S5cJ;4I=n_$f)YBf* zoN2L4lt7u8dTmf6c>Po|gBqdb+oXx^P1`GLfj}j$ER3IsT!iJito0WZ@!rJq73~`}AO$G4iopJ3l9n0N8&2(sdNCnWqOMC_=SK_> zXE3>?$L6&)uqZ%5z9)o=v&|j_8Aj)vc`00zC^XHMhz$+sgb@^F=&wxRq9C1lR4`Q{ zpgcg&JfeR&`EAipg8q{&j(?o7e~hq|o^cMiyCG z-nEbk4>&eNWWHo+Zi;d<44H#37nMQUE3?I^r9cYa#h~1ZV=?eUBZQkpB~ma~bXi1w zPJ9_4vWlE3PCGj@`AZ2YA@!6p?PTm_bbBdvK+Y2< z>T=cf(&0_Jx;aS(j(Qtpu2{0xE>U=>tVv)Ha!y3$ievRFRD!;SkCmHNS<=0{s>Bne zL|r+sHjzdA~b(qDxNkf^CA`NROU;G?<_i%Q5RS*sF-?uuy|fo4#`NMg|*{-i>*Ww2DZ>+53>K`kh<)+*pDjOW3vJUDrsf`S++ z6OK0hxl_jVqQk*J9MgT3qAd{A_dt=n8U55{1`>hQu4OY*IShzX#~ig&a4>TwQ1*Vh=$`A9EK_J;(SNzb%H^qgdTQkLjoMd#|JmrPYkKjtnO; z6&_tx*|rp0nV$_}K<0wBB1zD}Y&M%AbGS3gC#B_v9+wTMfN zBKmT6YE-I6PWJWfdhXM$$?uR+iwh9JU~`a5!?9zBX$Ch}CbH;Z9#i4gtEd!&91-!> zep#bi#cUBVVr<${Kq@xX##$>?3|crW&B~mtG1l8SOoOL%80tQpPBzhWYoCmDHB!a1 z6E%9!>cK@CyJp5s@Txj|QGXI_ea1bk%neo8P1HD`p-chBgSp1x{w9}Z6he@z*7^{~ z6EH?)4vk8JLjN&FT(>Z|C88a$O|g1bHf@VEtI9m6q_dA|TnjVSLdI2seX{Van|iX9 zy{(9mA;^?c)+^Qr2Q5y#U6d~n`6!VdDet&eULlav!Y3yH2emn80kugs!6sc*tbsc2 zVzjnZ;*;Ju9XI=GCj^^fDCWY+Y{Mxu05oBX-_425J0rWf^+24Iy4h?tpYP<9`muK^ zTzt1aAnNuS!7CKo#^v1r zGAz=B93yjPbf84+XT~5xiVWDod6071wvkyjfLTtus2ouZ9<*j_PuWLiUqY#}K?V_) z0S$#!;qae=@k{(@(+;IaYEZ2d>ZW^`EZn{;BfB8se^^MXX+Crgl zJ1Ky|7S6iT7SRTe4wyNKp~H68N0~AMm|o3{fvc^g_`G;ky$CWNc`(I>B@E$mgL?hw z9~+9&uZUtD*Op$#VrmfFpj#N_Nh#d8+|>e!6!vms2|x^vDmkZAWWxa?W_49nQ;f6f z*0XIEYioV64Fv>YIIl>6CQ;`YCd1mQ`~dzITM!=Arl=0((U2w(S+6p zYYYe9Mf`(bf+~h1GXywW6U{GHsp2eNECOdhPQYabXJpb-6W|xslo@V8qDCS{&Y6?m z%%-=gk!^K{onq@dWrRl!fL)trmZB4f%niPjpEe;u_& z6-gRNoI6g&&NKi&H6y8M5sWyZ044o-D6cwwF}6QE8DN|kLC&Exp2kBF-UeXkG!IQ6 zg{2;`U8;e?PZkDr3dp!S!?_fs(l?1<$t^Yte)G~F)_*J`$CjI(*72%N;&TGEqvY_^ zQ})FZS4<@{yvK1hp>S+zHN_T|Q(bgCxQvdJKn2}srz_iQD2~F9qr72|gX$;kN8^s@ z>DxGs#?($S+NOy?Idh-$V%Z;Gq|`0DSwHK*NXrE;mw9i|?=6@8npS3ydYMA4cFWeTR|=uuSQmNPZb)^&t@u_-AULvU;_pw_el zInAhGIYYFyQZkudzW8&h;!UScOb(9+$1aY2E}~*Oe|%VJhC27i{DI0l036Qq^;40F zXo?q&n&U#u@(yiFcio|5-WryL$o%X*#k_ioLoyX zE&_+7oIG%tNld4CX<2WyF@PJ46ahh0-ZEOrE5sR`G+@DkPlJ$Ufb^U&vXLl7fux+G zvz;i=m`BoH8?cUUM(LdkQ$-Hc$lI#rRR_rUbbrJHGM{@h-1k^4a2(<{%w5;bx~^X?mwkWd@x}4u%f(`m`@Y&9 zSyxgyzgw$deM`1TCyq!AvO?t*Qc4+e2m%EORl4Fv6xo*HQdr?R$cc;0oKiUHT=E2F zclOUP(JzuPY4pKZRG(XFu_KiTJQ=B(26qjbisDHcAQ5<7*A=~HW5Z>B-wmmm#%qJ~ z;+x|s@C*%R5czL7DT8r>bBkrO4pB;JXJ@uEpYQC{0+xih4JIT=kQ)M9roGQbB+miRF9fSM*-QLpcB3^h1T{y-zTQsl%Aq z1uh?0JwRy+a1bS;oU-h*V2OKN@OBN{X~m&7vb=9U=+D+H{ahyw z`9}{)4j4pWnsYOXdvPTGz#4A=u3{45JiCBa8_flmO!E#+ecc4#P9MeUAk) zW#pWf%VpPfvy{ZMa%_>0FM8DkNaHj*aiF=+G!k|)$WmI&gJ1M0#7rqAJ833UE!z#t z0^{rmS0EXz7gR#!v9fq(c$9(t18^@#RzW9va$IZ48e#3d`v`qECV?QSOAU%|SB3%~>Y0k7 znuwBx9uSB!=iF!6X{3O!>lz)*%zZDuAYMV&O3gCV>ls}VMiWwmhuRNPmO?6#9Khe0 zheX^@f@;mFIbRdM73l{p>&}}6jc$X(1YRb_}(wY zWyiHdklQ!dcgP!}6*-*!L|TJ5N-{QgRcJ$8NVT<8Z!$645nmKetF0(N&F2w);c7sC zDA1CuOBHL%-gzJBah*9}g6QO|=xbiL0N5f|2Td`F=Z0W(G)-lz-PuJU$+S$iv?wPA z6jVFth)!b*A#*_NnavaF#tKsnsbk-V@Os2l9S~{?96Owi(0=bpG#va*TZUB zdxyeTuA0haSE4U8i1|lEdZ2aWRg<0M&T|WL4Xqxj+P^fU)J{yO)G}Ib569;lCK?St zVE+eW-sQCwBp`|ZweNYs+-F`a`!3}~Nx;OS&&wWJLezrC!m1xrb#ZNS(1bYf`$?gn zO7IaMX8az9C4S)e%q>XbL}TZcO?mI*tYOYfY`1G>_TAqOWNSN)h&o$j>HNS1N*$71 zgH5)v+PhdcVT6iQW?8!)K!GIjFrQdV%%2A}s4TA|d4?}mcKTR*86Xc8Fd?Q+SH&#B$UzHci@256%7T6_)5=%&3e1Z*N)Qslc2Z{UYn(lx4dMu7 zlzX{61kffR8E7E~@G?cp`K&JRppmu9+$Xv3+W?R27A{%A;TM-77E9naKS>;h^9@-! zR0`FJTjSg?sU6Siu}eCnQ0Q;6iFN#>8FmN+35ytYiDFf(e+4S}6JrI9e}EfEL=5ii z^`ZRcwV#9PXjHyct!`+M(ME7#dX~$2thE6;u?CegbI&;;rC`U63IHR7jZn063||Pe z4k*j93#y zrOnbaKdrXcjym)*NpA=wpFJj* zj%Z)R4oo=UCL^LLSdevwxGEdqbS+84M^mQy)#X$!^F#w)2r2d4<(yLLy7YzJY3I$) z5Rc9$7Py@kQb>;GNZtOb<_gholLmafrCV&DX|fLE?j}_9?o?fYS@slyl1MP_GxxomZb}(gGCC!N zDj1eSURf7CdvLE)6E>1zHMuOR+NqN=SKJS!I}{y}O_JHWl`{m<%4^mBIvK_wgsfo7 zjNT4D@B&G8mgJl>WtOvG$^FBXLL~*Z7V`=ylr$iyq%Mvk@*BS*Dxo-Y(C~h=x=mrL zqrh^A?kyVD|261qb(6I@3Fg)}xJU!f9o)ji{<>DeRRm9js-+CIRoH!C?nT$ZaBWtG z$W0oP?hK-EM;e4__1q74ok<}E!IklH&eV~kRiC*rZrk8ZQ3hNoUaF~WGN!ivwm1}+Q06===5-+Hi*60xu7YTxd{dNe@iH`en*cesPNpf$1|{?7 z7#q6r2IDdJr;=l6wh+mB{lV6zsI5IVZtzRM5!LU_oU%yyk%HGG#tao!kZM-q*$qp! z85)@^TUGf)i{GXt_1Cpj;t0vc=IBVvi@^-%6WiuEMChBW*fdEsL=HDv$#dsVGTx$8 zK&|*_)z>vvsZRV=+H>Tkx`f!qkfRoYcX=|=H}#|G6=vSu-97#E(+{UZhteUD0H-hc z@PZeMy}iA~NpEPaNlc(tbeoDjI=L-7ku;?I2AnW%2-$sLAj-?d0=kHvXI-Anx~?m( zJHt|d9Qc(A5ToG554<6p%&1G2MIuTQ5#`)3bDwiBzA^Dv$q5H>ZP6lW^?$ZH%nnvc zjT2LhtIsMp!a}_^zj-Bq1U;0xEit$sS%j}7f^4Mrw8pQ!J9q6u}S#IogJ zmzc#f6(E|OZj-1i9+!{=#ZJSOG6z&c+sXl{=|`%cNZ3}nvnuBv(N1u8RFX}EB>r12 zHcuGIy6&=(RNFZe?r}*ejuV^t5(mYAuhW6TVNCAAln)-*?a^eV(lDCLrRh~Ug9UPg z9vXH*#iZ()Mj^D@EpY&B-2C5`DqQTkwW^O{W{O!BsY1~Qi9SgkuVty+pd3E1^zdM|D2Oh^ZcgWjVWf~vOzs5U879rnheIZ&be&UNyp zJ2Pp{rf-IAwpKzK@Lv$@iO#XGNQ zdla}`ioN2hx``$4D%BvbWfI;;>l?Ex3hi83{F;&-O0S+P6?!QlJa1bX5$!?1qk#m! zo6{84J&FkGB--8GJ#ys8Vct0nyP{wYFY@6f-+nt5iwRImn|3fRuKoXMMVcHg6SYLt zFSzfQB3ZCIhaW9Mu=Cf|xsxcRE`iM{M?mIsPZ0sOQ!u%`M{*yRp8u9}UM~B-*G)-s z$9vA%Lo*d>c%-I@y8zf|IQroUH4YgMKVVryP3G9aKq3Tk@etIGWk$n+$a;a#iC)J>~r874hc7}FH$eDFH zfgJcoE+yBqwU7>qE)cUakm6#wt}P5TS^;tL->5-D9vj!DT~xt4Cu#)g1L_#tQt62F zHzm)*rX%Ak;s8k(RS{-fG5mwU(!)kDA~05VU%+)UY~ zC`%eD7o)JuOTn^9cY?_`WfHUFiISYXK+tm_L;3NPE^7gaH%tCUR88*KmTaak$<5VH zHJ?Rf_=1_?p5RH&iGrmakX{eIJ~M;l&@nyv)uy9Nq-H3JmgVUDiFSTMX6Bw}U5ZNDOVUs0 zf%yK54s)fIEttWV>oM4}B7Kpt0FXd$zYT{zD7daHN3x$hP@yjIN#+3GNtIccd1MtC ztjyk6!#$<_#qV2GM=RNUSs+LrLg{G`4(6w~`C`8oIKZxV(PGk4mNv?9wiae{jk9|6 zLenb=h*o^k;6wRh>}?O-7-6(;xnaUSggJY#5U5(WLFIFV;sCci138855^*Yq2-Hy& z%_S3b%4v2lAjqjeAh0mAl$jDyVrQ%f7}vo(5>UJ4I_5fc8-$E}GPzl%OYL;8!X_yQ zwVLlwT+MHk8ndSPE$C)%rwK0B^MA^;2LL2WY`!1Xjk^tdAlODuEpJT8Ww2Gk3oN=o zqG%1vl4wO`NJ?C0suz?Mn3mcJ8n#PrN_h-ik?8=y1Wqal63GGS)Y$jpVH!2=O3dG8 z#-SA!YTLl%BR;J)Xa zv0P?a(9Rq?^E8{y=G4of{h1-51=Mln@j+xgSGry)0e$XsX5Cy!cI~Zg4e6N|eLqW- zi29rt{SqKb37k12GkWGuB7NOHbgN6TU9#Z4hAtrUUFF>Oxlbu|luBdmA5cmuEqUpF zV>U#a!E%u-Y_56d1!`LyLKP~T&G1x%jq|e4lv39fUyQXb<=poYiB957mYW+`Uk^t# z=FH2!@6dH!iO_`!G3~LDX^J0BqZOD4E=a-gOG(CwMBxln{tec8*4g- z77LZm=tqQzVJ#F6PQmB=evVA*ojx;!>;pN3s>c9qeXd>nw`J*DX+-rmL}w@FMAIjl4K{DuBNb zzK`Z}mk671Cq=2nbb}km`2Waz^LWdS>OAyYwf8ya-rJLURCl9!LLgy;m@Ld-48}|e z7y}++C(lEigyi?^IC1RQ#&(it$HoqxVt8?$hhRI;m?Rz<44Bwp;01#OLIVhaBqa6R zl6tz+*|k>wSVPs`=iKfVlAQN`uhhEt+?IjsxOPFl6X;<)QjtJ8@l=3 z7}Q`YX>9JPZzYQx-U4rXPei&dudlD?W{d{Y>2x}suE@#?uS};?#R8Vo`Sbv@7Ry^S zX=6lt&Tlt-3w@e@#Yu)A&!?=%!*YDy$%UPzz7|m$L?QxaAri@i4tk)U+C*)mwucmG zyQHB;p*c-a1W1G3))vfxVMZh~Q%3+Y_d=SeJYwcVWQQ_BxY$Nb{67#;o<}>?+v*8> z%792BwSA?sO9e;p0sul%Zw8PEXLq7daDpPv9l)sDlAz07lM+$6bVkhbSa~S>!I_%C zr3dcjK}1bswyxlffoQb{8p*-gCIE_Why8boMZ-2qWENu6E<)B~-b$3Xcabm@rhYU@ zD!Qd@bM>zwtp5sgcz*rQ^Djz-Alaiq#~K*|gg$Fri|&r(n^ z%9!?9ezkcJlau;+#CI2a6f|?fz@}9X9+f9S%+PNO{;ggv1jn4`_ML;=8g2z8YwFEv z;Pz1S7Yp&6R9Y}7p$K=gI#d6vn3BDo&71J&Of>s0S-^$4kZ{O|49o_L(uq@ercXtu zff)a^LY3i)RF-dJW3I(jy9xpPO$`W!hdO`KeNY_>mStO|kN$Hx*L^dmx4WG);GFUg9s5hf44l;P7 zn&Sdkpb-PuDW$}jqmM+6UCWjMqQQz22PctH@;$C81Wf;gKyXigu1i8~W(k}{SRFH9 zdZ9@V5y`omPS-PKYH2#1E-x=H%kqk>nj9&)ws5&BiAxJptOt zSDH*5%ot~M=!Lt?b_oKvG-}(%hJR=i4zyGi<5$BFQ8FWHnV`%yVniWS9gCp&=R)|`yI3jB9mK5#ZWDa+hE;R zr`t%HIW+`<;wq3;jYzdsOCXI-UXCv1oYh!MRQ8lYs;LMRck8urAxeQA zowx(6;xJu?0*_D&Kee_hT@sQ)xjBPiNuUfZRr4(xVz{pla0dhHJgSFBXK?Mn6FMY{ zRMT|eU7)3ia~mz!6?KD0CVKpekRevq9vBdjfaOuOxEc`nO<%1dl~VOwfZEnuV{9*} zH$8@6bFdgH+}R&Y6bcuxJ0N&Hfat$Flzp`?yB11=&vm2gw@V&h0mG8#Jqg4-h-z%W zzu%s!BmFrO+2%_By4bm>x|SpJfcu<#KzePdr?Du^v?m?`AW3r18kDu^%hPgJU_%r<^W<#ut`4R~!3iRE;Jlapd1XP@c6-)pORIkT_@q8^92&9hUz0Kk4@y9xs$`^h32 zlGY0RM+Tg@IM z6hj+R9j>T!Ohc79gGU4iOrS;?O6EmrmS{8?PbQN|mYl(>tE+3Pt6IWH(uA7a(1{VB zp!E~eGbd?%N?AxG1$`V-c~e!N4Knsf`?$`}0e+~oijp3U?RNO?aAg(%Ss>sflrsd((za+@jK|b8Fv(s|dH8k}>F!vPq?oQ^+vNl7 zf*1jyp1W1EoWrW{QsaaHPg|WmP8P#QzS-Otd;(&(nsRtUR{NW=mB}osPse;?KqFZv zM>sV_^%Xtq26Kyon^CMoNsY8AwT;1)l#;vUn_DVFSS;dK1PO|Xsar@aGR--*X^BWc z8oY&_T~vG`HkVnQ{U}+afJjb67biZ9zGJ10LBt*?dtYQ`Qx^5Hwy*mNPwc9dmq28Z z(gHp^3)gbQf&L6ObDB&13s@RF6XHGc$idpk8h8k^ZJY@Uz+rV0Z=)T8pt9{N#_B1| zv{rJ>;StS&h-9fY)T_oD%&DfX3&ApDYo?@jwIagF+FOHaogjVuf|~MPmkStw9F(u) z*ZN_@e#_&B7d*q1D4eJ%h(g{7!Qc(EF9S);t)v2VJ4`NyvA)tJbcx1D6KcDLPLAX_){k{(PABdf zfeKd!iQA&RsT6H1_51 zbf`_Fced3~%|xHsR?LT1?G$1{s-S!UWtNV!8IslLXmAPyP#rm_TGRqq$SUcrBMM5^ zK?bVR<`R;)%(&kEhD0!|Wa~GiRDc=lzN0ZB%3$FhME2o=o33L7VFI}lDS>6fR2A=w z9~L&uZJ;o)pBbk_kC&xHVButDA7@CENDm+B3yvOrme`>j{TEK}2GH1JO)%Wwr3x-q zb*g?O5I-Ii7k&k^)()gVDY|Hq2ki0pi%qUrmt&GtiE7ML1XQ&-=4-zO#IqcxZ`g^o z7RqF8m#s{ueUqpoFw&*$Bv^Tq48NUS29KtABjh>Yhr>;+vjEu|(NdL?`Jeg18|;FC0E3Cz zej(GE{bXxMzOyw-!%Px^Jc1^XFtJ;7B$#sYWz*}Ca@83h2AgYzWjJ2vkehvs0v{ql z?JjsH$v9_`Eqw%VmQ(WqR98 zTbNlgAjq7@O@q%Ogxao|FfOmjl}v>iOXIP3c55T>ho(s%cS$FoT9% zn3+44%vmZft!OoOU22+eW-x-*U1vKuRfGMI1JU~d+I9lYWg?cr1T89lEq(4^z)h(? z#*C`IQ2EAa!6G`tsty(1#^+FZ2=wZ%=A*do)91`)wyLb&&aI=!-oAkqr3To3L;6XT zbB=fzgXJ`Ah&>b*X(YU~VSHM8Yncq_N*(sjyC`OK^$x+{PLC>egqxwjH&|77#eWXn zR^#14aHz01>$n;Bu0n26T}G99tC*tjena|+Vow9-=6G`xp{R4zAMPOy3?}!M$skWz z(Ssd}c_Tiv#LM$~*3Nxph%p>84W696u6RoXuGgI{{Z07P&hYc$_vd>O{&7un7wnu& z&Xt5~P+Mm90MWWHQ?2fxu8JrnG$10jP&{fv;Bq&`Fbz0x#Ta8zYQz?YwW+ixBEro9 zjS(l%h4HXfGtBr!^fgz9zvs9%$W@8z0TCW`I-fBT>j=~zviFrq2pNyZn>TN2+fm!L zb_1xOX&YHtp01v0nkJ!b%_)R2h?gikpomy9|MZ|rI6bVz$=CJqTxu4N#kR>+ZL%?g@U$&Qs`sTS>#%0n0*+WBtBHLl;*y;QJM9N(fr|zufM(p zOaK5N07*naRI;B9)RsPBp=+4P@$JyWWSnKFa+{E1Sgd3Fh|g-0kdRu-;>r zUs40vIG15&&T$_B%6KK`2(V(jzv zGOtJm^9O}uF5o!0HPI?}r>1KQ4N20gQyEQa$K!2@mL`+YXf$d^Q^;~&U*&EcoK0jn z2Nmxo0UmCK;&fUGP4d4O&ThCKpP+IdGeQ;jlM?i-C{oucj@AZksSXcN|E4{+tV@!z zLUm(A#nRD(k5tXpAQI2n#D?ku{xn~Y362>?cJhYn2 zMWYhO)U&xk7ArSA7Q`W1nbIywymmd#ECyfvIJuS=^MvBk4@kdK7dRR%v10q?k_Rcz zgHN)BnG;lDwycpZ9QzYY|8%Xe2f^JGE|_;xx+i2Qrek<5*w3I07h4U?vA`5NL)QU+ zMZoH?;VO#PVHE0DO+CEigcNh0F*4hfBeO_hj{CuYwN|h*+Fkd&N0CY@)(x2vtWuf> zSLuotRsmbpUMj63W=Qo36dI3K@0^V478QVNh@w&mq-wSADob=&oOEZGI!{PQuReB- z7E>=z|6zX?%$E5#3l}{64oiI!IW{6Gj__KLSeJC=r%sE~y8@Jn2xv@cN|Yoqn81(> zCUy>BW%Ok7pXWwVy^p znT1)B#jh0rlE{xHmI&}wr)_b>_I=q()aGt5>IEDQR3a%kd(R`{fe(h*SvnJ+Ym!e* zS7p+sB$SzisY#<|yfm4N^)xi(VP0Fw>#NeO6En19L_}P#SOmdJ>>na9#Ql9G3DVK=rf;S^z4EeU2p}7KpIhUtHKH;;h~P z1?}q0)FWakk(&ES2p-``DlTS|OPme3qy)&}ifMm(oo*2n-fCYtD%xRU-UWMzf1T+e zeY4mFAma8`i%o)}df%dK|sIc!VVKVdW!-Bz7G~rh3RV)5@Ln|pP1tAPQWqW zDr^lGCw4`Y$59TXN3kNJ#(vLSQm>Brc$yMC8f#d1b2aJd$Xd-uS>Y9b7NpDp!R%hEp?tp>kHC{ zUQ{(ypUM1=KH4-#S?PbZ(YM~R$Sl4R2XK}^NJU6SU>fvBw-iWq)sY+yl9gxpN0E`f zsX^S~mQl2$i%t>m0nS63-#a#P(1G!j}^SXfwG$X%Z1PJ~k; zw&m@@EEal8>@{}$zX&RZNIvVXMgIi=GZR6ob^4W#+eTdFQF9M#(T431I}2X+ zvPH}in^J0;)V8fFC%x!M11cF!EI${&JYC|AlM|vf%Eo>Fd3P0T{>9B<6yix5H zORuvohB-5Xn39Gq6FZ{TKfvUpsWnR?NG$k*n8X|7Xs1U9w}$z#s=n|RajPLn1kBPj zg`2?vOG=4yc0^HNm8t}+M(j-P!aA#l>#4N$g;O~ zD?0~OlQQ6se_euY_smIJg`-K4SWGr|g67d&v9Pv=LaX&*msLf<)N^Kau~g);=6RZt76hO`tAt(+Hvf}BlLh(EjiMIgEf$YA2(^x7cJ zfN3c^j<(m~dt81ml7?Ivu0JXkA5_y3Va?K5o^8`ugqWa>_%7k&9LegeX|A%MWMn~# zt0K*$&~?+5oL5&@Ros$CgKq^bWBc~)xhq>=;`|LtiC^BjTu%@|N|aJ+nx<{rpcu~uwLWzeQn7+R>U~wV z?c8$d9)SJPuq91!(a9nWA*_rV=bf=j=KrQ0gE>Vid$+kAAS>3jXLV>C1+Q;hskIw(#5*($?J>t$370>5@+Vip9o+DL( zRfc7kcJy%SyebF5UQmzaV{2Y-JVVveAIzC0ORP2%Qx%@|bs24pW>M8V=@Yysx-G~f z$RghnK_nR?BqX97r&aok^(;f%4k0%S+Gujb5Vp8FUM|d{r-`%FB!#6O)HGCKh4I z>f4%s7syNJGxCAQ74rwTo{; zitph@$N=;WgX)T!v!3%JN=Rs!x$OCRixd=)SyJ8FS_CjMOSVw8^@ePb7m6q{Go?h# z1}q(HaES2gYh=1_X9F&%X{t(yCE45APJaBXtKkGj?wC~P7qS@z00mLGRybkJ&2o)su zp_IW6VSwF%%44%Vo)t({DK7&oT-u^#QLPt*!ZWbT&LgcB5vn@suXXuppU4&95|xyw zYR=gbJu#NrjjETk{<(2}?I&VxrN;r+&eT+RA7_@%zj5PiB8zNbD*fC()|eK3lUhCC z{;o+On|>Y%jQv=I9>%wKH$XGuzpCjIn{iOvuP}&&6O!ot%aVYmw8SU9Kt26U9yA#v z1J<(0%~ozUrG?Ft&CA@aNVh7hYn`k}&caF&Mvo-thB|}H)dHe<&o{CI3rSYeC4wM% z)I}AbA^^!W$vO#XV8`kriH2xN2q~dS1Rx7B6H6;-L2XNIYC%aTP4jfxO;;PqU?TJD zuLGx0Ma?HXl_*r_uCB%_=U#JGekr~NfR9glloX==eDL#HD)OEAIvsR1C7a6@&!RrT zGni@iryCF$BAgZLnVX~K%K}Uj5tA@GXb2h+ z+3`(NwmFwhT8x#PExW{u4^*fwfCYlurUOgva*jP>^RyG|3?S;dL_&&*wK@p&2d5ZBAPcx_tjJwv^+;JFpTxlg$p*-hx$}gGwn8saBJX zh!AOLdW*%&!YrJ^h7w*=D2KUpE}9Z0%E3}GtpaKv2^feH*T0gZgwnUFNB)4wr>;pu zpj>sJ;}sU!`lSM6i!_1nS}?KKE-`ko3@hBJl^f76^mmF^@U-B%=ug0CgoZW%@z!`q zDZZC#kZSXG<7|T`RRbz|_W!J(^b{n^BmKuksqODSIDoA*RroaP!EqD{&$S2}%L~jx zD5l_QhS=h(=P`u?Q&@Zh(N+TiuHb2U|9LCYYSmU{txVSyudF86slNTu0BF zm&%UYoF4mZ3ag9=0UV}hq&XbWC}M>yEG%prElnnq$z%c=HF|p)^OV;q+ciwXsK}37 z8nB4jWL#2RDJi%>?<6Lfz*94Xt#l!nqp`Aywr$4a2@$nuM%0YQFNqiSZ>xUx({$>VeNIwn;L zu~zd8KtwWglaj@GC8(vg6c+PGl}wh5OfXNWf`9tnLzM}{ex{_(8){Ay-Ga6u5fOJw zP`1L%Ip>B*8Y7zR#B-k^k*OFd*pW9tgfo{b5)sf2BEougac@!C(k{qTiQG4K41q_5 zlwg(%ZcMxAJ7bZ0XIa~XnQd;=wjv^OUuP}Wj*B(P2SlsHkR6DquA_Y_1L3Z21mnjN z$hHiu;}D`6y1*)86p+zNZl(Zw4!7q{zHqo2t~q(;JhZNA46xpd_0)?$Ys2S8Es4w< zWthd9a}y7*PMc#<9I%c-rFEODWz?&Epaa#TI44p6oTGj`KX1OX1B01*dOx(5vQR5H z+v6uQ<%?+w^>Q;Zz*cThCcY}otav~yWC`r%E-Q0p@_DBJ6`+>Re_1^))t%Smknp38 z*GlMF-PuZNvFH~LR1uXiknH_w;a^o+m99p(5T@k3t$`?_WkAY#h*HC#^}ZD5eI0Wu zBPU5>_77HHG?Z8?!`6zQ5notX*tU6_dMGw6jay>o>2$g_W#VqQsAj1&lPI=}zv7u& zmsT?)gEQpd)v8NG5u2@S@(@&u5D`k$H0@+Uqft9f?Krgy3kwSii+a5iQOY^5bwW8K z5OF^Qi5h(VCa3n_P%>fq#8y(<0?v_h##?=EGIO9y9jPD5u$tIMXNQT?EiZ0 z6k+bVoO9>Pj)YDPUdv^gBm>+eps6;ySdXa|!=0TX zcL-T7wh(4D)QV36lZ*=gN~@g9R5Ce=)FWF3(p45CR0UfB;!%FlXFo1b%evOi*l~mb zjpIO`2nZ}Jop9^DHW@dwW>l$SCOF;;Ey?zmh}@l8NnH0Ox}foqtGQ|OgxoScP`blL zvq7_JBE;-1GzeVhGvQpkz*P=GrQY;4!}^2F!?gn|Qm-AJK|h%PcmLtAMG@M0V-Vhk)F1SjZ|mp% zq4mGYgbr*8X#jOIk|Y^jLUK{d=4C74!h~uw2;#@Xdh{z_2}6h}6C_FEl=O_a0x}{9 zH9kQ-8njMKRhaK33Xdc3U=qfeV4s|+4hUsc~!KTHgR zn35OD2~1I%$Gj0DN~vk|61X(K{ zLA9T0NFY%XYBCu*=s0HxnwZ;Fna-5iPe4M@3!AF|k#o}|q6X6`*48Lz$~jf0T2+Eg z61R=CjR9q1VT(e*g09PcgI$3RnI*H>b{*m>2NBp7gKwiq&RIlK)1)SuX|B*q4VZdP zGU>^2hD^BwHBGV@w;?}F_3NEK2{I@6{uELY5JTayKBQ$xBel9|iZ!30rX zSmx|^j3HPk#cTpV%z2u5L@7l(b&j#aP*|gN)^yD4>(i!f+qM;Rk0JPJz6|QvfNDxj zN{wGq0Rjo5%enQFyaCT8)+xtaN{v-2BGB@ zCmNDi+^FWp@Ce|%)(L_y=|C6DOvLUYq(rHNR`>gIg6BD92823y^7&Nf9U54m&L%__ z?MoyfWpt`&GIA|>sj@h_mx~f>-hv8^QXol)C8b16ts+?v2_;I6G+ungQdN$K5Rh0J zNRuUHhCmVp;YzJ0&4w1Wm=6N{@{ir{+#7bzCDigte#v+Ig%wk&MSWM&0p*O3ZeD0! z|B8!V_}o30?q8aWn}<)V-SXLo-|>g{ec|A;$rCYl0FVZK(jgu-&0;%NAkt=O^#TTF zq$EU(WBSJLxa1pNwntB+{Mawv_Q8)H@tBR~dZ9lTC+Q!2>lJT&#YLL)&A)j22S0jb zZZ}KA&o8~^TV6Gpi~(G8{WTwW_h0r4IUAZh|0;l5)3CSp?A!f=|Ht5_{r1~` zuP~S@{p2tI=%!7Jk34kZr+)C~&RKYW1r&y#mf^13d<&+rC)3lv<)BU5AwwWG3c@rE%F{Q=SqflJQ6;Z5oY6qftjG zlR#rqi{#9dn#Ndrva7xXx{odJQ$!MhGo5LO0F;@#oLfkfMiKzuJ<=c`kp|SH)PXx7 zLs)VnZl;xpl-ipV0n36x$C)k=geVIu?56tIp2Hdz=`uG>(=;t{NU6#T*7Gw9OQ%3m zF*_U;MYS>fIR~gkASp&>(PLzc&{P$jFgK0A?=n7U3%`9{fuw@klu}BSH%ze*5D{3U z>vC$^)=%qeV&R-KJEk>hB9b$&qZ?CdTI~@zYJdxVh$Lu_%ZR88v zC8o{_TTzMhBcb^5v6O0}Rx)dO$mq%xYTE`NqH<8oCkC5IJ;7u3#NE6xq&_Fr#%@Kk zNQ!;D=&2OY=9WVh7`AzvlHLdExJ=tehHO|PUX$xI2=Z0)Y+yB)8oN~)17VgYWfaP! z0FhLhxRN`rO0fB9SlGwT*c&CXNP-UEb#3=4gk@PG=L59t~tLv?sk1edf+~hDbxE+YSo@WbqNz+;q(iV%Nfq0vL4R#Quf{&w zbLo>dZ`9^{9yoKZZbi{GW5BgnYw;m#31MyRO4zOlfQ_5E9?E);l8DE@RU5LI^}_tTPsokO!L9qSRztPzfNA z6da7GNev|{iHKN)bM^~td(_h6Yide_^oq9l{lYZ_G0CPOW}%SN!&@=;2FUy3TS+1= z2C1@id$|zxkaau;x8DlDnLF;>f1nbO%w0DXX`2Qbgh1T<#@T|PL64^Shpy||wk=c* zDGMsLx_;7Dc53~txwsD*3wODrb;k~Ys4A#N0%o3eoep9JjLan&Kk16G1K?t zx&#~?v^?mXQX06Ho?Y)HI}GM#Ojx|Kp2Ah3n|^^hs~ve;fZJZs=y;1c;ys*Is7mRb zMkukOYH3~sU$1YvLSg%K?79WTK z?hSwuAK?16^{U1>kEi=VQ60Qmsi<66x`N zZQCv^EKH}}>U3>weQi3O=9Z*J>wk|Dx!`JP2#`Rk#|gL5K*LnYG50V#RaVRhWf25lON@50$<*k4jD{_#%q)nnh@u zQ!hl2fw@yaLCnIfWS@IXBgr=kN#H391TkoMf=Bkkh0IxgJmtO$llg zFjQBITl9^s6?z7vbI-ixsRlRFCPLsyDV4Z@|!_JA;SS5cvv*DLai$MAa|CBl|I8f>;ztf{=!>O^H%sBFZE}qTz^i>o`~g%>V!(07*naREDR5 zb;6W#Ze+E~r=>eXc{%Y~k}27(m$k?zi`(jxao(c;&wp}X&?mL@Lx2A%ifG^a;X`lz zjW781YW)rbVFk$-PY~`kFW$Fv`xwA)zVl0e_}(MiM~mA>&2Qgz=qW$HWnqD?x_I*i z(oDN)ChAN9MGI;vkwCh<4qj=DJnMvIk`dOojglhT+dqHu=YHk(xBk>K0UUd1ZDl1F z9t4oc=A~8S>>$*;VHkoObLlzdSZXoFwt8dkNw5|S&O;~sm7t#1QO~sBHE;W7z&bgrjUb)s+JN5 z3qXWox0P8<_e$Cq95zt!`iN@I^FnaPVWEpUWb4t$J7w85pMPB&qIx`UZkolQ@n>;6 zsGglIf7o$nS?kOo>Ko#{j(=5!vw%|Sr{%+Z!rF(KQ({toE4@uD{Z`|j0Ox6`CD6j| z?a%#%AD7HG|Ku-T^WAUQwEx26pT6VHU;XXN-}vf%FTQDd>hv9N`|VR-ysz{{uV z?SJX>w_S7DXv-E}Uq5xv{SUtXBgbyOE&8^wYx`GwnNR-iH!SVH@S#uNdFR`H`|>xu zYVV70nw~m+=i7eg)ZOubjzI`-F}ec(O+J+G`40zld=OP9X( z8+JeYtJ*D_Rt_Bg!aM$8anH^t|ATJ@aK|tG*0E21HrmlHE?n}Ouiy2Yr%$$TT|IjI z{y+WiM?QA*^MB)KKy>`(+i(Ac-|%$_2rhWamHS@uHQTPaY_w%FudkoF=Ya$7|EuFS z-&XV-*V`aMddmT`kR%OlY5wypkf-i@%3EIdGn01mu`hkxBuEhu$fS2G2!MuR>rcQW z9kGTY9|@Gc2OoT3>!xVqG<^Rsu=dEWT< zUi<79JQKjb`GL1Q{W(v2?u(webJvdLGb?}nS2us)k3Ph~)q>Tzc+7F|WQzlj1P@KbOd^J81p?87gCRS$9Z59eydE4`=bYQ| zq@5%UoMB*@h?<5)GV7j*#C~-WbUAnH)0R>iStAprrfJ+LRVmVmV6g=xp|q=!rUj{D z+Zi4w(T*$SsBiPDG){q;lRZ$i*(?#qai9pXASWUcmM(XhGYb>Ud9p}r1sLum7~ld? zr|oMC9Ak?h3xhK;r6wt@Sg%C02>u?8kf=@VcszEPq@jwT$WiSfZp#elP5?0@XV%Rr z6PE&kbi(Vo6J{YWB%6H;nRCv$%efpf^RkQ&rbJ5Hs&7>Y8z`=oa>|PebP$0sI18ag z3R*ew%IW6JOd6<7dc4#)Yn%ilm7TUDZE!ZAZGT->YPPS10yDjARQ@q#%}I!;f@|U1 zjrJ0G0dT`%AO1xLOz9F7`DMZ~fxLeKaCPaR%qEJ4=tnoy8ln}dBB8n!w}((Ga)wGY zfSBSxXMq<5f-9EJ0=eg#@M4T-zA5j4O8BigCC|1l^}}^}e)m48Dh>@~qsCQpz%+;+ z{&wp3N79YXrA4KIWxS+*NF*C{DZWKL7Gd2FDENw@VA{(!!PB{OV8t^sffdul~;0?|;eHL`kV#+BZMosi|3t|JU~%7`Yrf}=Xc`^fmCBSw zpsT*~oA!O(O{MmB@q+8FzTmp6@A$H> z^{$)WWrl}PYN>hMjjw&zXa0~St0q_R7;|r7wmTfh*9S&Z~c)QF4@0y%Z?~kDQnaaOwUf{qDX4XT)9fVq5UUsr7IEzK=b8VhZ4reT$LvEX_X4 zlVA_KcJCNuJ921_HFVG3od9y?r#^FxjISG|qlb${OE0&Y2A5D1uAchXTEBu{$&(M)|7f=Xef^CE~0ZAD6(2n^ga-JlqBtYnw| z+J_9JL@913AWBV=EW*9W8CI{CAlmDkL;tBP(O#*>`klJ}1NG_+CyE-pusaaf=ikF{ zL>}-sxvQp4k}$`knk?u^v}&*1T3hc4mkFUw%Pgq^VpR5UU1-NO%f!OPvTIXYoR|e# zRxO#ak`18-g+|%mrwmM6+6$R^dr(TLgG`lV0u`cD)35Lb%&ZBThQYM)Vp6A^-x?o$pap~(`u88)`fg^|h^8cBhI=$`c%l3ZlR}-bnU;oO3 zANj=e;~{P>%G{Mt8t$DZfiIMy;NL;gH-_%JQ*yAXh6 zUOjTWdT4HcD+dlc+mdU)^P3gXe))ZWar~CsW!f$7+Hv_CUb(P)=jKcHZ@>PUZz3nrf)6ZMBY`XSo*8n&+&#`s4D^V|a$xZM1gAW`%c=YnC zFMYvFZz4)pJ>`lgUAq6l`wn={T>#cr*G`@&j?23)9QqHeuB?9YW48d9EKHtu<5K}V z^3aK}>;ky`mOJCKBH;Da_2+-xO`pB_juQ`^xc2E!Rycmsi@*APfAGPsvxus%c-_}4 zqMc5scii&1GpCoYy!P@7_wNDls@K2lQy>5InNy|)sL#V_)PB{ouK$yFzW0%bPCnzg zPrLrcrviB1i=X>vfB5I!wDRj9hXlZAG#W21YFMRp&dfPEN)Tb+CiXe+RtjU*GE6m* z4PsVEqW`<&sAYVt#xrl!V|U zwH>dZeks2Ke~}+)De~9Mo1)}Pi5mljiHK4oEN<$ohNll@)OSI`#Z&xzw`(#A_#{h8 zls)E6tRx{{Hur|b6d1Q^1XxTFl>3%{uCfnIg64L zs#n#Q(k_u=i>-c9Al;t1cTTI$17i_UaVn%)8)_*_+cXfZ^H6`^E>M*?14cpZdamSAWkN0jwQ;SX{m??B22SM$382PyXWC!zTfJ`Hw#E z?4SFWnql?eQPo4*t(z}?)z<+yecywh`B%Tf)2RT5Kk`Ym&E6M2huUWA6&FAB={sBm z5a9cAWpXs(yDyM7jh#d^N+X*$=07O!z3qL^yYg$k;o6t3b}PT~mv1BA7IK;zH`>xn zcD9R)X|lkh%}v8;VV&02us#u*2rW=*vmj^PWE4mejM&N`&|UYOdiK+HTz=6e@|80h zrPsgWVgQevTK})_e*pE?Bd{=TF50^YU~!WE#dkmXpZ>jTe(m?a_*?(&-rj!Fyv4-; z*NP}0gpb{F{HK29w(oe|6CMI@|IG?inWSM_ifTA_dU2mww=W=Q&l}1>C*j?^E|^i43jR->H75l z{=eR(Lw>`vuUAleWFDy9<$DOf{>$%p;JyO@ZvE8ln>KHH=1n&M*t2(+g4(uicI>(U zz|lj!Fa;OxbMvhie*0%Wcl&2P2jI$UE>lqZxzFD9U*7SDnBj&^)9l!_1HgD;@*BVW zj?dlt1pt5c#~=E!xBTu()7cnrX8x7_jOpZ^z|w{99uMq9UU zIez5fXhVtHu4b}Po75W0l5Kbm8AKu(66Yfm$`qvm zV-`CD)W9Q;u1!UR+i7lF8jadfn^dhLSeROUm61SAN?^`w>uEG#20P(;IGC&)|x0XPGWzHwLFBjWA*nyEP(PWZ|+bgdvG++EA&M-I;}u>J?NZ zwBGcS+NRO%@l>00#2b>`<;-v7FM2OA~YOCSUJ^eEe9s;oFcAe#e zM*u8cxH~=r*mc8oY19IE@B<&t>+3XKCi+lHYnMVQAGFJ{pfKS=; zHP709-IMEd-$Y2oj!7E<>+)e)Hq+D5PP5hppb)O!ka6jnZf= zZPPYw+pc1Dl~*B5!V5^F%#^uvSG6QG5|471=nMCqe)iLLOvY*dg$oA`uZqa4Uc7Jn z))9dJ{O&KWtY@m0KY=dZx71~ja63u>MlJp0Z@cQDN7n!NLkCc@%}GqfS0F(n`l3m+ zY0GG3E!R1ZpP1ft;PkPT6%wcgWz;mAQj5_9zzC_4#A|D7-L%tt761`xL5&~OP*5u( zm+m*Gf(H&NsMT1KHc^sWgM{c}&w2l2v((mUcNkM=K-M{k96YMC zfHR*wacc9{O#s%`rnO32i$_YS8MTxMDM^RS+_*f@IOAq=^kc`Nv`_@G6~CfN5td^U z7J+aUw$Mg|M$m*OnuMq%gs-h=cwCQrw?5_dX>J-c&1h+{O=(2UD7CA^YdWb3#DGX5 zYE#qY%((+KO$%XR(zvRLggKK5*T5a5x2;3P7XzJMomzRmHmM;fd=@Di+~yfz=**3D zQVt}kQc&2f1oWTva5yQ1`iEKkNSj{9vBn)@DAQ$=qv6!F&fly*0lX>g*^~4V@xo!d<5c{yRB?OxxgDA_5!RFURtFEQ-v@K8)~Uzpobz*ZGkug zf>uwcEK4U+L1o1p8v{s#e$U|NS#dOLr?g3+ZO0BZH*_4T#mC*WQLD+i8h&drx!tnXd@9k09U?|fqv(~PXHmBUAM!CRRJ zk4E{tzP@(+ktlQdz)|mk?D^^&ciwQ_+y*{;`(55yT6AB)l>z<(Nc-!Wv zC~Dby&E@*xk%(#JuiE5H4$v^$hYrgKQ_W<~|S6@;a`!9$>8?+G z_Te3yCV%I(mp=0u+yBvbT{3R-yWjIbN=?(G2B~p*v1PKRyCi z5(_QNd^2hGS${*-1$Tc_Hz0_LZDGmCytcLu8I4EdJf1e_nveiR8Zh&8+KoopOpXRA z?C?#s^IO|os!G{zaOiD|bGF#~1KUsC1vjh-Ys3{xnK{BCMJ?Lolt^)&?vAT&P;>L?C`~v1V5BojKK1P9|yT|&gyibbwy=1kVNnsCVD0y zby@92p*4FyIdLpVuoEhBvIz7(WV_ppf*@R?5f9;wTdd79Kr_{&LUBu06)HojSi-|( z8}OFL4;R{V)RT526WvCsnrTkfUXmD(s%vxd4e_H2F%7C;m2=iqHuT(GVepb~RnMwZ zu~G;0n;Dr{R>s`}sLtjbw#`Ld`7w09@N6;YKBYxsm%|^s&nVfLvF{$3QFu-=JA9>I z%|X{Q3W^BoEtTMtTFrnk)gtiXRLkzgLzq=Riol#rMFR?UU2M$0dglyxaHR8dKS-m| zWXA;nmJc2VpulnY;1NLD#f9;{hvBS`c`dlGuPa(oVJxy*A&)d_$2+zSb9$L` zsU%&udbBc(%`l^~zfxuS?7`cA<&N79 zzwXu(bzcnHTL_0&w8SN`(5X z<#3D#5tW>IgN6I()9$@H0h~FrvV3L;ly}cK4`_<;u}6KAWY69?=H9k#F4(aRz~OmE z(00#zrB}6tR0=WZcE2g-u&F4a)2#5h3cj zu3KFlPsVDoLxm~H4vd8>Tm5n%LzgRFBv7nO{?99nm%|?Fh@^L9+yxIv7o2eBye^!( zaUOH#JWf1n?0}KaLHGp$c3!QgVpUD|%&z{Ima}luL-dqV<5ost7p3s7)xWg@Ti>?2 z&D}H!gmaav*95(s){c}>&SgtdLUtG48&oS0*?yP}HKmlAWVs*!Qck(a)114UW4Pk7 zA||4g4AgdAr-$&I<_RUper*wIQfk|l9Rvg{mcF?52)HE`1*5P3NM#vKl*)y=T&$|7 z0a^T4cqyC*nHrSbE0-(vyV8_;)?%fioyn{3))L3MupF3|22Ke5ui|(4s?37G$r1Ir z99HwJwTW;L9FVl97B@O*JE(sH10i{2Qi*Nq(dLEMZ<vt?uuXfVrsFkDFs{GH}^W>P-kSCScGqnp-beu{afT30<05`d8d+ zZ9SHtCIc!B5N&N?t?3{$-}Z=EQja_nQ@|F1Gf^xZ+lH^6q;-{{26> z{o1QGUv|;r?j1{e_iVrZ8fx2Z*Is_{D_?xyfBQ2fwwjICPn_yjR)h9SdwV_@nkKt; z0N^g?wQ1zscI}nA=evCHXv_T_FbJyigX}*NCh-NaG zEHsl0WZ?|yAg$0uJRrQtgAbhPrreIw75g_si{-XT=?)>7(Pu>0qs1XPnIh}Frq4jNB$6L3I zWNEy*&H$PQjX-1XOdI5cDao4TT*8s|*%OHXPr7hn)DnRE9y}A99yR;VW{06VCmz4F z=fd3pjvYEGGe^rSsM`0G-Mb6GiHA>4*QWYpr^ixQSuXdSU3TTAwNFBSa#>`9ocZ|C z;=_tc<^?1@T&aA!su&A{oTpEnIdi&q%bJ4k6AzyZM}wtQw7^r2=lqf43Bq?#NsJtsSq6P)POwL3_V1Fn(pQ*Q+o>uG7Xyki`U=u(fAu!ga zUB|qhxJ{$cs2z={X^;{UsG$V3A}KR<9k+>717YM&Oyy!>;fC}wS&#Y`#xX*8=_EoT zCfIG)T6j54qt_3w= zl#3g%m_f>LX(kr0hZ=~-z!unj@t!>qr6j3I!VXlW#?B(rRH%m%HBHmBZ5>p*Wl797 zME;hDv{STWcS4v>+vzmA7Mx5w(_~4Fv<){|IA>x;$0=(-VRsR!QLSSY0h-JyvtGsO z6$e+HsZ#B}DZT0=t8c0IdQjv2g0gLX$?UnbFw=Y1J|OqE zW-g6}RLy8lYE4W-fZFPoSY#x9U_N1 zV$K3jo$1t}j`|ri(3lXzjd9Z37^U+Rc|e>GVAh07#?JrQh@o`t6FFvVuz8%IZ0Z z?>wX|k@C5k9L1;ruxmPvi6~sX=c*rl+9=lI(R#2yn`lan$f~y1~No(?L=sascD*qnl~b}f9%D=r4``Fl^j_rsNwB(6KeP8{Uxxlf~xZCoKUu{>a)%X}BQ~Zh;X= zlaLzfT3q+^rR_TwKKV)h_?^e8lDw4$Dnhs@0va4zW)fJmPU9L3sJ}1~F81?ek1_N? zowjV-vamG42JyUh`KG~2IarCk`}ZtuUII{i*^U?NG~p$eUHtjm?go%jdf96&2-lH= zMox8UKc=-6kndjTu)!A2sj~+fA^Ks99$JvLE>BE$0>jhf?M0^8#egAHC zRCuszr@~(mKCZ5}q&epqr2DoQ0g#zgcni=bv?TbS?0t8fWkr?$_f*~YUUyG|VInx> zI3#Bng5)4ckRS>ximoUwAg*ipx$6FQU4Ld**SO{ctO^D|lpu&mP(Ty`$vMox49pCZ zy8FF%Z`JwzQFW^7-gjS5&oG0#pN~b;^ZLHJ6;4&1^F60donm7RSR+-I;GvE!v2ZWx zP4IwZANA6@$swmSPpfZMXQD7BA5xf-;$`CtWN-gon2_!DMAOdTGQcfOP_?rmHn|y=Aak%je zWLa4zW682MMzistky%?Vj4?&Q#M^? zKh#FvWTX@m*(~GC!Wcuwkg?h_DJUXCNDS{J{e@vzur^i~hO~B@3IL1~pvG`fu(b>; zy|BjJwanJte&Z~D#2zMc5`fID2Iowoph9dlp?_*vOP2ywANnuq^Or1fqAgj0vK&H; zknmN>>3bw0W>ut4Exw9}*W9d8F`Jx~3mF~2B59{L*HiBvH&8JpBB`88s5yD7*G)Ry zSR5dG=m^EPT@Fd&Y+wbydVMU!m*Yx8;8Y1J6;03e+t1QPCo#+o28qL4Qyirj;Pq_H)a)Fwkmn`etyZ zP=-6;HTwKg7w80li$OCqYg#rqXogq2qNdN=ZPT5%2e9bITSk{W4NgHekX~UUfBtdE3=2TnC0A3vq?j<4}ApyTNKOgzRztW4Q#gQ z<_GTwqS1wmm%F%K3l03;4q%}u8SVK#A_EvM|XH2~A;<||i+HViLZJbAk< z0qps~bDsPCpRG01=I<6JM{@4XQ)zJKv}|x7K-*3C*m=s1+W=T{^B+e=a@S}*Zl?4o zS;@e;l^hR4G#f2r?Pss~+&zo#?a9xHhQ-#}A}_45M$EK+MkO;B!tMuJtx4H{)>)Qi zZCfT=3LpKM|&FzIhe=@CY!eI7>6Se}dWNG`x+m{ZH8UW3P`oP({;OmL~-=5-1>xJ$9VZY*43b9ou>5o3?8<6oBh) zaRyER3T)U~(mKnsH~rn5V~&^x;Di%q{QW=Px@z$ncxub8ji`uQZ6QHw7mfNMV7Ad0 zkVH-AEhXpE&y?(uFD3=c<&woq(W736*ah3|xXse%mIKh4KJInLx`+4O8Dnn+YwJ-b z9x;8^W~*1MnfvmchbH)AZO`>=>rb3CQE3gJE4JRcwoM1HV)@EEk9lVF#0X=CDGHrs z(`HQFY{pb~P%O*z38(sY{^brIJ`aS=W=sXJeCY}ww~K-Fs9bt)S!E5dlXz4VhPi8y zvCf3uN*Ju<#i~D#Gf-N#)}YM7Q}GoH9<_)qwSIZv$g+0I)*h6lO`hk>%%*_J$h&Y7 z5&3wl)?Xy+FSB5>))-@0XGF@edn%t!ckT4&gdP91K31<6HnPAO9+LVcZ!H;H7-Ni4 zmbEN;2WtHVr#5=oQNkALVQi8_OBc>Y64oV9l_YGgP$-~K|Gw*{bCM31ASAXmVpPI- za?h%9_`y*nkSpB-bu<#G#yPk!gk7~j7@T+Nn`>guBy`7un0oy zds~!(FXjZo0z^pvlrjaXatV?~7QzV-6kJK7u}TT93!KE|Rmw6eZzon|(`boQ@P;u? zKyyM0_O4Yd5;i4iAVH*dv}czqOx$PI#z9>6SXTm70a{D+14$0lx_$P+8JjtK9Yfhd7V9~WV zbyu!-D_m*4{p(KzVA`F>F8<~4!e@zSXx8*CPdv)iwdD7Ia&x)6YE7|vIGZ$~Ic3tW z?|JLeKiu7%I(g;+d)cB;jfQSDw>bKsWq-b}{rqwOi>|t1@_AU%5Yk;f0IW zJofa=gZGBmwjGsLKk~%n9kiVMxE`=$8o@X!_Jv0JR`I_{8cpBgMp_Y_m<9-}(50UtIqT zGabI)wE4Sk3gCrR`S*VMgj;e-5ezIdDK%wM>&Qc=g)*m2ZDH}6Xh;LjIeiDM$dP9L zTz^ByzI#q}j>3zUj9hxnLML0#J$?INE?BUu-z(T>C?bk4OSmtGsqkmF3RdBdv* zhde%>I^Ea4+n&43-h38-(UFl$e((z<9+SD(iw|wf z{L>3AbD?J^PxdC{CFOT#%&s15W9G*mesYIhw$oYmu75rE-aGHN*6z5=_M2=r1;8^; zFTUf}J6+CAr%q`!8Ynx|GB~&&^d6P#O%4OF1~+xEA;kOc1;M7VJjF!s(E@^fhsa%V z%F&*YXm=4dRYh<#IZ!A(@_1C3F_7nZp66@|*hZ__)U8&~B#WYe)dX*ybppkKU9wti z#|dsgNgHMl8q))j(E=JkEgKJ#P#8}^Yn5ds=O!Jfg$PU~S5{E45SJZ=D8V;DWJPcq zq+ep4h2YwRkWrK>f8{~2;DT8W#2})QKx`r*e*zTTyVe5=gex{mR;a{6?0R91v2amh z(rXVqsCDwbBJ(4KQ;H}BtwP6y9PY+)IPmH~t+bP^$GX%?{b7F@F+(t( zS+>qz>aFPkuf%Bzu@<2(xb=h8qa!5!PDc}o=X5}{C_}!0)X0PXss=Kat&dAZm0s!9 z9n#nQh$oqV%GP z!bq07#>C=pu!OKZwk z2;)b8`13tJaE=~mP2BorJN*4?!}C=SK6dXH&##(h;{dH)jaEokGaJ$2M~Y4mvJ5Uy zVE>B&BP%8d97IzD0W=|N%^aBIC_bst8d4cSDT558w0`XAQ2-MsG$u}H6a`;!+2csy zwY#ePQ{TA%)9>Fi)3n9R!8e_>RcOXN53PLnC+}j5c*DKKqa7U7S>`)6JW|~M@anYv zBW?4!?>+Rd=j@^s?YPav_inRe_-e`0&U-&~_p%jTkE@v#pg|fmVKCED)5u8i=mV<; z3Qq@ZvH7&t-@j(-Uh*FC3P1m^x^eMk*DeBR#+|0~?sdm(K4*4kwEf_HkNon-SD*QhX8`DS@|7!Ad2c^K6`gkHoj$`n$RCBChc<_U$c z^Y1616eHVbETgah<|6V-T4+92Q>KJS@(9?tCq{>0Cr@~AqHl&xk#ImQv77o)N;S%mqcnt--QVQ5|2F6e001lS z(e1eVIg`M?UP=aqOiE;b6^rEb3W*JoE2OaSUQn?Gm?m@+OeBEG2A|jP+*-J^;Qg?M z*H}Fq7Rc|kju-_Z6wB7K)*OOc%C{+oucp-2>&oo4y!H%7xs`GFV#?~3ill20e}Iu^ zo@1~JSleB>x)>b=k^6Javx~#9t$O6i+yC{mTc3E;rn~Ogm^3k8wR-hai=Mjf#znW> zZi-yU>Q9@kS+v-)8BEF~QbXcjTWNm4wf--H_zsD-M#xvK`P09Be(O_?p1S+a&B>EY zr?ckCMbF-F>!RP@VvP+K7$~Lg`}&11-1qS2hwnc$V_G(8g6VWS%T}yo`H z<87`4JbCFg0A?MsZ*$6|k;Tt1yz=@bH~q2wyu00ZI*3xgf+aWIzT~FcUVYO-_JxmrRcfRx(=#`p4q(Z%5(2M`Yk&0ZpN;(8=x+1pI?q=C&pnge zuRFUM8^OKhtg0)PuMCiyh@N@+*)M+dYp*>1(Cv5LcEY3yc_)ANnI(7Ke)p|6++HMc zB4Y5e1P~L^v>DSXW!5IeP+kdUF09E7K`F9Sy6st{Wa_)Alr3yt6qYSKXak%nCh?PV zh&K4O*IR?whgT;KjLSVPap(XEluh2vEpi4GOr(H}psZB|tSR6EMGvDDzl1IJVxN2K!nPXx#ZoH4!t=9B@=4I zmG4WbqVPok9ntby#YQ6Lqe3Ecl2Yy|r@upbr&>=^|4gNu|{(nE(hp67(;LUK!-uo^Di{pM&X zwZxVKC3A0yS{}Tzyb`xY1Ak6ziozbBo`>#`2UJ<*2D!sARl8%Yn8d~ zDK`^*D=ou{eY`N%xbT6BGV$-%o+unZZ6snCF>9<3*5?l~K$gEESyP@Q?1WZ27-bSx zm{A|iE=^k;b>MbqoDATZYj1w!f=kCqx0HeR&ylvI{9V|{qq;eO5EY?X5DO#sTSYR( zXHaXp8W>uFFgQ3kB^%fz8yFpJ zx7(wIqQb|RN5i0L(QGuD&1R-_rnE8ETJub2%`@FKZXQ}vtionhV5lWZQA4K4YEKOnhOZ2qQAY7IF>2P>Y9}u3y|KY$wljmSq_aH8Irm z(x)&GgLkI1R>~BnFa=pA%f^_ZFwNXFa^b5W-}34MMecL$jE_7 z5ozV4{}PEyn0I^dwoiFZ4(XC$PRStkdRrwY0qAVvTO9I}TuCEl#&GtDOQ05|`Og&L zRG=_YDHn{TM0rsZrl=hFbHrDI`A9YiA%>n5!d5Jx{fSMkY^8|EdFMwkNwG{%Z$M)7 zNk2-=z=eKuDy3_KQZD#`%P*#-h*qWE=oasQjLTBVDXv!DQmd3!N_kbbYLh0db(V$w zQG&ZZI?>-89tbDaND|;LD{)3;t^MtdDI_Iv-7lL|rPuKosDCbfPscyLQW_Qty^g|) zYva_8vGT)L;}m#qJ%ou*6ch{JL~AWb5!hXM?GylqEY}H2_vVkpasZc0UlEllynd;U z2(u5_*SSooESt3bR@3*}6Mz|MKmE(=$6qjyLtd<{X`-w7ze`gh9#1HpuSgn@mXeGe zfTGAdowf@_p)E3|R;$%&wc2@mO)=_D3ppm`A`Y%AHsYQ=%}US0uil;|Q=Hu`@iJrm zQVB13#RkNTfq_=5)iN4Jdyv|+)Uuw@INeHXon=|WcC>Lmn%0k!fP$0{ty6zrWSY?@ zNNvA#wUvsxVgv z@k|JAk18G&v6p^B)Wc{uNRkF1a7rIPpJ7}Z^W5gS11OfrMs{jUp8Hm3tg=R7iagIv zH#glvjunAy^j?+T)#zJM{oDwBe32=LlJw8Yw}0J~K)}+o_2KNjs!>S6>_$G)zOgVt zz(+GXn1BKv3V7ho@J0avpaN0@@b#SEeReOqz#Q(ga?v%FQpCx{bsk&#H4~aywGjE; z3`ofU`M?|ke1oW}U1>zlFc_}J2;e9psXz$y7L)RTn&Ilzi~`b*;G)bKdPbMS4J1-Z zsbmrjDyiE)BkGwxu_=9@#~yQ7#4K=}1&EjWNW>x^rTq?s1=JK_Te{$a|F+|qUUze6 zFk~zs03s9<)Jyc?og{q^7e|Ersg=Ny$XSj{V@rfAfqPu3rl-!NA!BRS30p}Ktp^z) zw1+#Wp$u6tlu{fSXeuwl*+cQ~ayugdr^JgYtJ(mZtg?R3BrH;|WJD{1HhEiwQPuuGsZAkSZfWlwQPrNzRa}U^j6HooE3S7&WO#2ZDC-nVoT|jXGu@e zEv?i&xXvxk&#<~FX^BECTg_+~xO?FzW~~XT;ikrj&4;;gQIEXE*DV)gm1WJ8k+Q^X zm~OY*?RITLai*O%+_dPrYju$+1x;Ra?Z6bUhS-S>B`eK`ed2oF8(Uukma5-+dW>80 zxdUOw*yTN*2EA$WCX6Mj-)|iXFbIG#jmnXIVl`#P$tivjw>Dw}{SuvWaX#s1g z=%Ud;v#GNz)7p}Y?ikHO?tHnm#-_HEAdkHA;_2dIVmZxQrK1*QsBaMUK*HMgb8=n> z0DRmMKfTB@!=j@=P|Rd4a>Le=u`njf6)9B|g)xS@x#|`oNV*KAtjUbctc5^!-4jNa zeC-L)uXo+&zJDeQIS|hOSvS`!r+j4@#gf7dtmn9it}#}&n$%xlahjucefBFU6035= zKJu`2GttymUFu@G9-`h3a>0}}NAw)zb&RSFLNecc1T$|(C9z$~-5Fxn5VVt^tsq4~ zHi4y1;zO*wA)A0T5Rn3rCU5I97x4f9AOJ~3K~#HGDxCl>m`!v*NqP}%gf2gW4YOhE zK&|#CB%;NJW%`BrM&gU?as@zB8hjy%ge58?GpsxX;7{Hp6og2j3g_4}sB z;26iX{M3CFA#4J0Ymx(_aR{9jZDSh=ihbk+|91kEg*Q?aeU;1S1l_tL>49CAKvyDt zqIn@G0~It(F)&4Zn8j&d#uXL$Tw!u!tWno&Z=#dY@jz0M0BaUpORxa3f+A>EfwX=N z#V+`;;!z5*XcRuD&zfpf%s!g24a7>Uw5cjY6z*859AZE%5~*j7L*ilxz~)8!`Q^+1 zeBZ*Wf7@NLx;FpVL|ni8#2lS5B{Va@5(O}j%MVn>G-yaG(pq)FU6LzshznRpW6RdU z-ArRgIA3PkQV7FZ%886}v06cZ21%@|-p$A8vlV{z^o7GxDytNcSx`IxmlbGQ)}%Gm z)W*P!=8)S}eLf#9^4zdB*06?AGWG_<(4dU81x8_pyQ9Oy!)RvI%pB`c1B zOiOaU$c=Htd<3|2Xat+Yg$3YDRW4bHGFNd{tz6@jb}MYT68Q+LR{VF}6=3M*4vG`t z7pS#ltuAbXEIM7&=}_0`+{aHPW7)C-6rhO0=A%(CiMKX|bKOyuKv-*(uvpiYeq;}j zsUl?8$;?}Z$)YaSQS8O1enk<|URFRvi5tnk_1kKZzfq|iVp8euSPdeoLSqDjr_T{( zb5N@TbW!Y`@xyt2!8oBqBGG!=JC5Y$Xo{`^IEyHlqWK6)kwkm2n%LbBR!V8|t_{(Xv4*M=KRV8v(kKKD(I4Xm3vs!ekckj3l})g77#vQ_ z$-R|v3OfA*YXd|Q--7^rlWCP$WD{uXsOC-1Nt3+gKXJ?^2zQl7C0CR#uMMNt$*(Ka1xO;S|g6p1jG6D5@vBEGZs{*2#h`+wi{ zv9%W`>EZhxeb1R6Lc+azRR8$!uWqjmDZ#00pG`rJcG{6K?ix8&7*mXnx`XH3$fyxx zY%s$Z)9rTsb?T1h-v10JYbpM?s<3HU1U)=&UFLnsosYr(Xf(q~aKAxlO#xwG48U63 z?RE=ey4|iZMNt^ChD!51jzV`m4>?k{qc% z?Ui_Aw=^Q8zB!o3kdBq=`vaNvOHK=-WFI}@h6uNFxz9vot!259&RVicJ{O9+;^Uhs zXz%dLnut`0?x^qWBR4#xfN|XsIzsuH{6fKb=5iR9;vhFgLCEg?;^De=)r4Dj06dzyuA0znJClLtL zYBeVhPI3UQ4cmbM(Cs>Y!xG$^+_AjyB8%<74Js%5DUP3ce<>gLZzK1DkY$a5fq@2R z3Z84WvepnO0LB;vfa8T&tXO<|4oRxVvwZLB+d(9~H|XD)_lTeHpL za!m~`K@r`UUHw}ccXDFMvSojKp=(TcbQFM6N^8>85Vf5F2WoRCSREU6ek*`jZ4($# zL9{(p6Z%;1#+MwbjjFigPS*Plx+5TPaKT#3c^(#+vhf;NN(~JRw*EF%OX>4ou^9>Y zx3sRQ$Fu^xG)jFh-zme*Xgll4TdUUguf`+V)S{8(n(%w=Pdt9cpgskIC8%9c$7DipkX=oKrf5f|{x|X>dxeI9F_qvDQwcMnh>$#MVIWm*&!pgo51h<|dznPv}R7$|UIBvvJFs zlD9&rGh$>md}a$+SPM1^viV94=*f(M=1@+Jt~FhDZifX~s|>d+S{4O!&bA=73dWrp z1^^gE+C^Ceceqf-T3DkvSAgH#V{l*)uwLaS4}faAT{muh5k%>Ed7lbG;aa8^pOdFk z{rs$X9`$+ow`{MiiiN*Ms>2LDiDY^*gOCBlOvWgtjKQ65*KmWGKw7&K!Nyplfx%`| zXIeMBRh|P=j!fGbX@QOs+e6IUISMb|t?aWpe*h*}Fk7Qp zSpkbwvQtq65J~qcW?INu-^kf}C_>3bT(APS+qFE{+F5@4t3QL&acvnNF>3b?5BYOn8-@b3Qgsbbx&&rRs_w}Ntoya zW356?!iHFe^@>!Otdur22y8*Manm80zBRQZpHtb^r(I(-dEHZ3JoP1W!dy}wt`QHl zh$2b^G(m&VU{HYugFut?0EPw%;zId*g*3BrXUkmZJYQ`I){Q@JsKXFOW*QTg6$Xcjp z=jCeFJ*dToO0`X+Qu}4%F%(GqbGTMPWgv9Ad8exgnbxY&Xf&I-F}CPxr5eqqZZ>qY z(Qc0xML~r03NasON2(h`y7U4C?)^66i=MtDv1U_zqFjg~c7ogkR%dSVrwu5Cw_^es zu=PG|MAm0;2b2>?gz~2p47m?n&etc=+NR8lo-Lm1$%L-OTjj~zZ>Fq0**?!JLati- z+TQ5)<9K09AnJfh{LZN zF~O&hJDBoQJ7tsHj)?)Hi25DUPA2 z5N;|sZ$h`#?#_ex10@FZ~JInVQv zkrAy5t#daMUCdgglv3JF#YVHCwKj#Z#BABcoO7x% zg^LmI$C`rpMZYnsz`q{*dL{E(bO#b(mI@h>2xUMcLNdq+AetM4D?&=Cx&|R4+Wsjr zq%m?vJX3yi?Fv?1N%f5wUpXZJumMuvBPHuPv3onV77p(QaqYGE*+P`^i`2MSX+eL3 zLkYdbXA}@}Y<8GW)cR;30(aDo+?^KO?-k!6|I+Gff$ly>n}wPLNTO|E?w zu;zRh)9|pIdPWA&QSJf&@2bQaavJ~(BBG>AvLd~yxR#7%60C>kdf0-mn8*_= zW)$t=tN1p>Lh8r0U&A9>O$riT%B7+!Vw_G@IFCn&$@7_=KIxg}wY>E_)A8g47r8soNKZKgO=aTL6z zQYli3lp*6oBgnvsdK~2FOWMmk&x@kas?fUOwRg+Pa--2`HXAC_I@8T&Q)|tJIoyX1 zSvsk)-p|#*6#-&J%6WS`h+pbyFnY@p{3{tTH*nhE81$vK?+Swvw|;p{ZnosEJ!-Jk zYz}y^YfVU$+-&DxL#=MLu^R9BWChi_Sw~2D8p*b-3k~)XFTKB|npA81+#usJ9!%1U zXyq+IY2iEh*1uS4Vr?fXZXTjVF(ceMmZIKr)F4X!hZpmJKf&aS5wyfWZcPF9F=(3^ zH+7@YXf~Q44Mh?mReIzMy#i`er4&TUUD(@mJx27*0PR2$zYtkK-Z;1xkeVuuEPy8X z2$Vc@)6`EF>g9}1l86mbEU)WkHc5bNYEO-Q=*Q-To*qQX>Cy;l1+uvxKP&vct}~Ev zc(*jK7znqViFV*8Km@n}(IQMSmb@kNgu63Q8sP1?nT>cm#kI+R^&+=aZ%G(#m7fao zli^jep{Ei^5L+EyVz9LaM8r0DW+OqHeKmN$4H0z!68msDV@XKFrz8PCoY+XB{nb@h zLy)o#IKEVG(n*xBns3UfXElV4O=sKjnV4;LNfUsTwlHQyLu;$qT6Q;3vo$%J!b8=G z(32=5V|12T%dl242$UIUW)}yml{E&krh|QJOm~g#`e8`i2FAeir5K-yWg%<@a?*9D zQTYWzWc=A48YWxVB4{22*4FC0P*y49qlCAZS{BV_v)ODKaBhrYc6UVvX5{a?A@Vca z%@`L8jNz`n^C8TnTQ5#xy;M+XtQM50y8#NUEHq9G1{!a9PK4gXSg4u{aoUP&Sl*ouG$sz&2dJCiw|FnzaZoKQYC zPb7c2R!-lm`8-xyYro1*xil*XeJR;DarLiWh$BX(8dO_H&(PfRTeYj4OCQ6#b)87r zbFlD~k3OU$l7PcHImU>x*eAsx%V9tpAa}1Yv*Dbzwn`VQH8Q0wE9OiQi+3Tkg@S@o zWIaFkR!SdOT2K*}>IMK#Lj)r5-sK>)t!Ndf^&l~=QP$jTA9iQPYRJVnWf49UYqYuOk>L`v!OEt$Gv-VUlj zXprDGhvWr>g~Wj{<;HmPrMO#oy(Hsk4d7(hO0`!BFS$BzK%X)BK5HkOwGDdTNNLiaPGh4D= zd2Cp26&TRjKsGS3IWVa;XpFJOJl7rWcH9j{Y!qx_@=9D^`ih&#O+>4#Jze3*VhH|# z7s0R{WgFfFF)YY}jB=r2K$yaM6DVY=p_&FZx5k25iQkXk)qrJIP*9@hSSOT8Gbu%i zR2N(b&sHEEPN)7=0qR=d;`rv#OKMNuKq(asK_EN1MMR_&SysZ&4i`4|GJC?Oe$E*S(+`eiQ#BOUu8o3T@6S@$WR2KUCl(o-2@CXrbw;;n5+ zZDqCD`fjxJMYO%&^=z%X_OTRSThy3+<_WC`K^&ha zB~a;w1U-4^Qyp@Siw8c3$0h(IgpRzzxna0yB*cnX4$7dBQ8RPP)mS##YO55mJpS zOeVw_@JvKmmXVIm0OrBmyG}kOPnrjafC;EynN>wGp7Fb`acx8NnaZ$I!%dPCH+Q78_8bl z3lDgayb8tMM?Z0DA_+=ID2l?gN8R&WA=hvhvNN+u$r516I#Q>AN!fO2m+%qB#Y%3G3IAy4s{u!MrCJxzeDL66hwb%t%i5+GT-;c^efvW`uxWOl;XW zd1NzfGv%ZMH8aw|yV6s^ncYw_jzznnO%1T}LQg+EG)W;A3m~o#M1W5yF5u;;fyfw? zD+(rMQD6}lXabo%Q*wwlYP;1o3tbaUwxVD}3|ba00uv}45%=R0xP`PKr5*>9A_VUA zKy`UP;9AeMD4it%wv^izcF`jGO*vCvP@9%9Mhc@YD8k<&QFqZ|#d1o4-VQ_t-_~H4 z4)_#-kZVf<-kBLnp;A{(evfG5xv~Iiy;a7qy(+E^jG({jym8W6Y0$4h6ctp8bCzUN zGM4S-z9Ox)kIx}cmx#31StHX*YpsWnO`t5xvPPqk8HR--BCVU$Y-x8#eO|Z5YTEqb zQ`{#e@2ZumiY#0xiKpNdr)I19PygpFXPkLbv)TCWw=ZF4BBiy~na*@Zh71{Fj3bv) z{yov+OHe!27hYT%qYy@wOJL_+w*AC^y!*)~p842^zk2<3e|Rw!uSW-J*H?uPg@@ze zDlaM}puz3kId{zI0@UprFW8}#Oz-mV1m*ZR%^ z$FD4GI>Lz-8k^!*E2ZxV2aMt{S`Dcz*kXZUKGosc_3Xw*P3iPcT38X(f8Depp?wAL zl>0YMNSfMZOYs(a-X2eZ{rs(}E{K(H%L5a~E9D?WwcT2Py`DD9)KJ~W7#*%+34dTaadVP_gwscCVC+O5SKi-XyRPT(-p%E;lS32NP zm|V*MFW#ehLW+)TnHjp#m%8OMr8ZR>^Ehm}$wzUnASb;tOT1rLvp}V%4U4y403fuNosq>r%z4$Q|1J!ysSXv~;dkTGlw8>5WP z3@e0*#7yq$4hE3rChHn+k4l6PC8UvA*W0jhc&CuW^@hxKjx?)^EumDY7SaDxm8*9w zW9Bg%Q~fhBF7zArfSzjm+FK!&vdX%OPsS!$D)rYRrE=O)Y#c>Z!CCDqeVR?l|J8h{ zabXOmP|~HVZUDW&1nG!zIRPJ5iDu6KPz?y1kP!VKAh^$GnvXtrx zp_ny8GrNd4y09uQs3_1asGF;9p$em|Z5VDkt09SCchy?AZ*HtHT4}8nK#GE>NiA?- zISv&s)b?!6xzs8GoMQyy{(Fe9@9i!EwFA5I(#l#}7!yse@GDN533sc3yWG<^Fcl&J zro`d)m?B{vHDjFE{yd2Dyp785vFn;j*pP3k?0K@~aBeElEl8dcKk{YA*~%sDCZSCQ zx)G6zS0w{-QY(PmjOC`Ku!<}c;SVW zLZ_5dT6Px+Ff5E^7a_y~ikK8>V#U5!fy*XaA&FkoXNAY=-ukxJ{@X|1aq*9?eE<9Y zBREfRD&a)h3l2#O1ccLdT>xci%2IlI&D+Z(Q`7U;n-?=jLah_r^5mx5_zPFCTsA z$#=f}BYW+=+kbug!|#0087o$<{_giLb1PnRj4{rob52#s93MxP)!QP;QjgBo4hYIK zyT1%w-xT*Fq^pT~mhQ>Bkwa#onYhTg)8$Mdb2fUNXR7dVf!tn_=V=g@6!-e2xRm>a z4Cvtx>E>f?j|C1BAZM#24~LdlnSVgl_2XNs3)Q4C6|8Zm`iT=|$ykNQE}}X|{e$(N z9KA3qK~w#pNQ&6?~>TPIqB)0TQfr!r#FGhGkNu zl(N>s2D_m1k#KfZHpYsBZtT8g7-N-I4q*A+O*y{l1&}WTL@Kx;kU%$UZIS0LgqfoN z``!@~thL7429aC2Ppjj&H=K4l6zG5aHX=aY>(Ofi z96$BV`o+($uN8iSlns*hSLt>;!=oeZcDvmkZMQp}PP^UiK;hWe9?=O~_XqrTqyF81Mrb&ow65@AGv92Id?R!qYqmt%s?ChCS`9Irp` zbq61Jz`cLE|KHD$NR`3>03ZNKL_t*kG#A`#G#iaZqtR$(4NZ!OcH4KikNxlyyUyQv z(&ULREL$;g(u8fc+w$bs9@B1jZolpBM6IN$n{9H%HQzq^*n_7|ow9Pp>Y)jP+iW}M z)hE4jaIkgL4Y#LF*>C@OKl{Zu_TG1oDN`mbU$$bBFZ1Y5yL0;=?yls#q%LQ>)4Bb& zQcg#a#fzT1^>=rkeCkmL95nwImtVhf#cBYGW3*?cwI73_zN6ANQU592r=qn<&vfTu zd`7skU`}37w7Y)N7_uzf4KVUoy`@%#@%pr61GKd~rWJZs zP=#N63Gs!~L2DIXO}b1H^(FpIrD>N^ zi>iN;7^;Xt4(K}ol(t-m0k#bHEdU}@6s9Qr`8gsmYpvXw96^S$1u00Bc0`n#!dbzV ziPMxcK0FcYB83bp5Y)5O#8sg;<+-`|^M4B89`lyDQ>G90W=p|el4Rm}^R&ChT$M#) zX?rVikWHGH3^W9H30Zig)o{mdu64&eR&a?Uo}&Z*>_;BxMK%=}$r z&VT+;DQBAQz5C(+{@%}9t>)S1oVNay4Md}jun77LT4hr;W`8j=Xne1V+ZnMxz-x-4 zup;Lw`(IVRtT9ZR{>7ILFP3Vrqi2t@_dh*R-A_5ki<_fFl@ea+GZKIG^uNEm6mW(! zJP8W5)|#T|=6So*85tcN9v)t^X3faRNT<{3=3P@5W_EVRq9~Zz?P@b1b}nx&3p~h~ zzF5Mb`Yjw$(_Q?8fF*p}dRHL@h*xT@gCZpi!rn6K_FiR&-N&HBghS^E25KIT5R2D6jT+q1uIr*|-=8y?syrL^m-O54U_ zs82Diw|9r1*f{ny@R7U_7#*dpU~w=o-i5{*=S6F*FntCI94yq4;n-ohU~gh(r#0~Ky zEflpgYB#8zsdh%A8I5K%qA{ZEFw6+-h{TpPL`IRN&|peC-!s_p$I-g-llpnrlDzWJ zyR#&ZJ%Nd!lmX8_Y<_E?^`~3!zU!U`myN7mI=bfh_L`-g;iaA77ffdrid_zyx5@NP z7C!OJN8bOrXO}JSz;=q_i=Y4g%{ShzwL1R9BLdKGwi?Hua5#YT&i%+k4?PaR82jHB zT=w7RUkc!qQ;!Y(Jp9Q0XUyE}u}7bJ*SQ~AwrmA}qA*|j&+p%S;~%wF$DMFQXzk%g z9uRUaU$z2(G3Lvk_c@P0;fU(`A~=KM1>d`jnU8<(G2+OKhq1*-~Y0`H8^{vi>4EGL{Ofx<=(j&aB?PouRes->d~6?V(jpBnpNnH^RaOj>xU#@@1f>Z?+y+Oe9Sai^ZDUtFqf%v#&r zzilr;T0h)eJGkQ+^zjs3KO}v|sSm}|2COy1IyWt?IsgN}fAptg{6YuZ4wY<*leJ_l zjAdg~J8!IN>lGt-VU2xZb@zo;G~8}>ZDv?G#%QdQ%}TawSuhJT7pAam2~Y%0N<(ak z?gg!&$R<+O0@kvz))-p|#z+ATh@i*u23wfIS{s=T;)is2*-hk915)_w*K3NE zD(#Ux-fEhSF~hk21|YuTyZ6l9clM?;h5+om_sl&H+2XDno+;Nsb)PxdHQfET&a*em zT5mh+jjwy{tG3@^Yi54%!N)JW@RIL-?d+btfv|Iv$oboI}E{Hw~;eSG1sUs%3suians<}*)v z(BQcc<_Rk&6yRRSYt20?AL#|k z+TeR(VFWYtQ_J6tiL8f?tg(_pCWUE6A_;u`{mk0Dk1yR)lxR-T| zJEi5UqotGUYG#x=UVljpGXWaDd$urOC=0DgDaw=!O3d0s<$q)BLzKEc{>1A-r#kwq zEz951`li2;a$Qr|_*RoDU$AFj4*Wn!9{g@CbMVJiMXu!>k!dK~(3#fFEGwGYC{mV* zEQx0$5xMYw4oopyV+v+=2qth5>;6`Xv<}EEa3L!p1wsBanSj8!bIlYDygur!)>^J1 z@LsBi>bl)ET z_T3-8W9jJX9CfMO)1-P3fM&Dt!ykR_fCCo*ShZ>mGv>{kJ8$0HBab}r^wZyEtd$aY zzy0?7@x@=BFkx`@>fy&9e|pA@&Gy-6&wcjU^WcN`KKGmthduMM3gR0e)@*U1Wy{Q# z?VLHYuDRy?S+iyUc>ek26DAD0G7mXq-}BD>NM+j*!2AFCZ6};~#LYMTacF4h$fNgv z&->o8)6UzT^Y(vF`!#p&c0ar9OA{sxT5A_Ad~W_;yI%B@&wuOd7gs1kL<<(|cEJxm zJz>J&>eVApJici9j7|66XZOAL+5NzS7W~tBAL|7UlP6F3+0VbU_}OJQ-T0^Nw%>Bs z-FEomSN>(wsZ+l9ol8nX<>zE1ILBK;8M630-F)fN7hI-hqcM5P#OlEL(s1x03(mjb z(>l|pFfTm6f;8>4^ENww@NKU=YX8$ud+$iQBO{uaUy(dZbiF{$E#}Pn>E&OXF>@M# zWy@9!4GqlSYwrBL=I(#Mym!Cz6TWf)z=FMZJO2ltN~kn-!9Ke$*k|_x58msa&ii<| z;{fose|YVO{_X5V3!fWaGdg?o8E3!a@8<5h{afDnfuv0!BDOqpi)jEJdFTmaj0d$= z8eLf1Ev~ra+N*zlUBR5Q&GXzC!-}A2$|jQm46hjp>uq451z_dM)uqM|xhI2z1A#DC zUh&&2ulQ}R)oscqlaew)gsZN&zV?uruYGv5_p6W|d*rEYw|m*k=FI%dT@RM%UQR&? zj8FVnrMnYj)H7C|b&6Lymhq-yZr|wJ=W!Z)QN+wzg)zt> zJV-aw$66xZ;uBlJmaQ>4voXdZvy?f8sMsoK2Oa!XWY)s(steDo-Y^BFRHn6a#gE{@ zp<$^Ii4oEz2W6dCuScFP>aEt~FUn@;*uWkRCDcoaAcPc$hHBr5$--J|Ny)WY)RQxY zx=!}Uo$;3g4s?#T#Fm{aM#WLVm20ha_C9wk+d))0>CXux51%7zcf@06<3ojWg2hU+ zh2jCSKvYVvH;>I4+XBJN58bik_G_MSe@>jzJpQa*$H?EC9NH$Lv)+E%0S7KvvSjHA zC!Dp-)(369)d44-c-FGzFC2U9p=Z7|It3Ep%U}BNgb9P6`t&z;-0_tM9&p+&J0E@4 z+dh=%#mTQZ@{mLJ7Q1|;2$d!;djqYp#v1Q2WBD_m`QWTsGk*X3J9gXcnC-SZWcKWR z-}I*Uj*hlp`?_OZb=;v9N>7?RVUL&Z^vc8E{Lk^tA_|BgTAA4W&p#~pvjKKtyR zcI{vO?d%B?2JgD_!2|Yv{ekE`^Hx^34{On+3(Na?_YYXy4QK+Wq9S-}>QhH$V8$1xFuyP;3y06oD}`aR|Vw6>Gd#wK2|_GVgXf z?at`v$nfy+>eZ`Qju7+r+7-ZG?tUOPGwJ2D=~I9CtM7j3-`-Kz@4jiC zFZ021y!`zt3&3OuLYD5gT>t_n@b}w9` z!omNRUUb?RFpSGHu;1surT<+?9QC5OA-}sOfA)DVJ)RY~wPkCp&GWp|>2&kFC<-SE z+`)AYex=MV*p}N&N5B|m8>Ujqou$@VE9D$YRTPTCHc4R%8*ixfR!`Zc77SR4 zq09A?IN@HteW8Kgf0q$_7*dbkGHs)8N8J5RWSnD?T4@Ss!P-%Q{k3jw_Pgd>u5LIAQ%f8~om7#V51f**b4sY`x(Er3H0+b48y!i0hS510?& zJ^%E{MT?$u$5|`SH~N4m@bD zWL*5{JpI(O-~7gpLn&YX>cxu|J~wgV;LGRDMR^p(YVA)_vkOF=xSbG#EE6+X?|bB$ zr7dg2nMG!yEo+8i-g3*?051C4PuHv-wrl}@>hWjJIQ9J}9((q0uDz8&p>7{_O~zbV zXj|U)1sIqxaqy7C_W|&a@A&xB3m3cQ{qm|CzxK6@0lez?Lqq=7K<^eKc$>f`!&D1S@xo$n_BRZ^;|%C1HBt!RbJ%` z?}O_YQtGL_p;GGqwZY1)!;~ev0;0PxdgflTMv^~WOcfIMJ8Q{WZP9Q6zl_znQQbm! zi>zzNu78ilb|?%3UU5%c$Da+8$|a7w@LsszJBin&_VH(4pK@x~Sn0jKKWp_X?LUGq zB8{gE#`xQ|4t}odGTqjxlXbOM>5Tp)Ev@}1hCm5VQ-A^#lVVZ~Wmz+8M#FNmur0$a zi$=H5qg^%J#&DauIa#ZiHGGh7uw`R3sG)U(w1&S*J&IK8&nkolI_ToLkU#R{11|Z- zCUKWocKzI|&NN#Tg)`s!aAUH`;EISe>vJ}`nw;&^K_KTWOVtcMk1;IvPaCcoA|j>S z76`lN&iKj#_XBkHqvEr;1R-P`DPU6Zvay5yQ z3)Bd~K#kFn{F1NS`IZmw=dzuA-tJ#G_qTb+GW`B`o!u_d7WZ8rzNEx*4@DGd-T znE1*oetY!MZ!U@=Y?+Uawtw}j8>5+8aO=YlKLKEqO(qGU9O+B;cgx;IJ6v|^24nNh zXKAe#FMjUXXO|#RaqhU|UI1HeHQNPJj$SLk1NT2B*O3rFk3RAgfaxQ62O#ACidcsd+&J|ap1ws z4?g(#7B8DIZTi&mo(c#dwj2<`&mrikB+P+`ID%S+4s$QeF2D;|`TKM=P zH^mjy^GlX3e&#vr-RA+w9Sh6><0%WxFo{nmB~)6nWa+cdKJT6~fr;<<^L+s3Y&kRZ zrQPma_v>53iy=Mw$kRe4Pmw^ZKiu}0&~gU;_{V$C0_JQvJ2b#4_JJW=MMe=AhF}Qf z;-^>`(Pf>f+o7Jp*1$(U`Cb5D{o(~{Rt?L1j142^Oe+9crZGlJw#izp=EpwuUI1VH z(uHeQ50CLutJVDIr``+TzrK9o>NUd^qLd)1;~xYTZXO@Yon9;(Xk31GEn9f&nAn*f zUW|Y3i%99jD6Nq+kC-CJU2`K}D!`qi1z_2-kEyQ2No9Nu=-rNAd#dCgH|df=9#6jU zXW`y&dN=O>m!u6d5z|uEN`a~zG!RD0zna3hhJH4vIK`p31SRn zmaTf%R__EU)<^-Zo_QNvgIM%!Nva(sYIAEc_M)S&)#>(+g4QfuQjvxKKI_& z=<=|D^eUi&A`)W(#onV4u#3j77|qWTjeZg}vBVm?iBTh>5)=gl3o5~`fJ9M56zSzX zUb*+|y=Sf8A8YC^r`+-c;`qFrv(N0AHEqpzzO!acmgSJbkzID#;c-tmc8|O7CQSwa zd+)P51Pq;IwRzK4h{`TP7J~wk+o=79gZqD&quJB*GJw6}K*V>w|MdqQyzh^GaM1_f z_bF?t;g_y1$gSW+ZdYSuP>An--y0;&54`VFopB@)rSP2+^M@CI@O_^ilkT#GMbAx9 z64o5G>#d2B?|657%}yU0v#Fy_8czs#3WUy4m~`jHg3N*~H&J-Y zc!;$KdQ8Jih87kU=vFR@yeJA*ij~q@Ar=ZyfwDXJAfy-iT$$MzQVKEL$L-~}vySkx z-p4*DP^c}FlHwCfz#)py*v4~@+8w41y^HOfX0=LuV+A|s{5AzwWue{}yuI4Bt zGqs(#79v>um=_!>h!y~TaQ5&2aM^~~as^~Qi#uG3$|JjA5JW3bgNT$;fCt>CGeKNl&dMh&5+a^-(xYGZhLim% zqE;9+j3r!h$>o<^a(Oe7)Iu~~AzIA18nB?YD2my9FgrU707|R8$W2K^L_pq!!k11v zXO+rNe)$P|?0dI8_PyI*06Y_5etzNo@BZ`$-uu}oD-OybWSx*@ahRDI9DVQJ(^3Jct_RG@HP_iu^qvw7Ea$ z>94Nqro)ZSuoB4cju;w%rK88jn(vNJvTftQ!PCoB0n-nC>!TGP0}c+YbUpz87Z~2D zLt@+7(+KSLiZHC`0&H_unJhddF%1_MhGsZ7H;1S&(`fBw6%YUe8o4~x+I_k{CJtN; zq81hjnWLplz_lFUSFkMg8^}&zW(L`{2LSfolh6S;g$h)#lnqW0LKU=mTz1Hs6e)Kn z4|?84P?MNL0Qdto5cfNWXaRu98Z$_VJgBw6MWNQ(7s;h#+lrVB8Eax2$uBV+4{2Qj z6GrA1DAQ~MXEKvqGK7GTja=aSjYG%0$`eEY*#F2o-Rr@3lXx3%TKMY6E@75kOa*qs zS#W_Qfaq6EElp!h+GO3L5P^sY0NpjVe2+s8c*no|zq&RreBs}J^~`T>-ZU?j_`H+< z>dkL?g-?#bIz@}|E3qM_WQNDk_E%hS)uD$yT%kgx#JXFnEW_OQFit8bNW3To!yaiI zbkN>!`Nx--+Pv~*Z$100?`*nt3jiVVv!3&$H@xX3(r#ecMCCElD3}s4G3@{2V0k)k zvu4N`XOy1JidoEN2mv4iwSyWAGnD>RGu0seBKT{kp7ZU`pSQ=}yYF}CzT4e(=fjRV z16Udkm zRfBHadR@6@&FYVT>g`9}@1B?c=E|o${zW(3aI-w8kf+Oq;i}(XbJzjLH(RI0Lakl9 z`V*h}=lkC8@XLSm`@eE&cJ`{Z>sEi<#eB-+Uv%RQH-{aGxVFPO4rgZv05HF0!BvPG zATkR5+fn7DMBeBbdi-*${Q}0#!r^%w`cs@D$3%8))KE|AuCF*<=anVNXE$;B<@_Xq zG&3FjQb(n9z0llxYd`5N5SSp zNd9yy)+Tal{oMcJ_+U90iQlY>&R&PTiJj=4I2B?|Ep)9yl_BL~5v4vG(nhuwp0+GG%nyiO#BwKX^)*Gy7N!idxlrv^Z z9Pr0w6S~*!@pDu}PCvvIgv?BiOC)Brgsos#i*uZLCdY}e%MpEA)_6c%N00#c#_27P zYZok6>#tovf%@)cB1c_@24-NeXZk&b&|tWsHCma$kkOz)0{}Xv)=vcuOaj1N!*?*3 zJ?W+4?D^>*_}To{(q%->L!7T2S&7Gdx6NiaEC+*P&FWRdg;K0x8M(-dLk~Nks;VFU z=;uTPz>j#u0}=7mQ_uX&XU>qT$ebZaNRr)J2*d_1fLhlr;%WetgGbwKx7Ick%ArJs zsQR}8yMOT$^{^}fV0LcMh%grujm!XW+(VB>#4mmE>!+RiHJb=BA}i%4QR@~HMyP@~ zoS2vZ03ZNKL_t(kmSn&)bC&7K)a>nH!aaVV0ds~KrB~&}EUAGJP>b8^K@D2`b(F}lm?N!%pylLZ2!-e<1?=!D@-SbX*&f^~X@MF$C=X-#F3W1SauXK_yGm}Dp z#i(pGRAmJK>(;GRQKw7Cgp58o_F+;>=YHYTvqzLX4r|uV4R08N>vrqbtp`A#xOt=K0diYd z0I)E>ASG&O6mirwKfllra{c;U{_}J1+W&yPe)f|~PkidjZ@$@Cr?mD4+A(7V-Ndvm zk=^cmCjhwd##>}qCwo&JueRX-3Iwm_M^RdxS;wWFZ0FzG1341Vj-q}X;y3B+ZWsVU zxXHyTWEqf)#uA+?mfKlqGh%)4@OBdXYJABF-7eb}8_T}iK$vitM2ak$BfSbth`i{T zy_(Cqh>|H$5CVcysAMyyFo1@+EP;o-Y6gjw;e4R%EjCO9tN<0F9Q?QU7Rk0bD+f=7 z#IXmaEHBHz#-0MPAW!!C{lTrs6@Yl@A!3xgLW!MGKn!Wac1K)pPdEjhkKOh)F{=oV zGP5_11wHz;zV?HRJ$>b!Q_V`zxi^tXTyB*Is*rmq@1JefQm? zqj>IW1u;SuAEK^VL(HrGc&#zC{q}1QK6qb@!kX1{d))obJMX-Mo$0w+(R|5vCs=(2#khLZoyivcX8OzSCRaCKvaZ z-0)c`v8M_Qyl6Pm@$OWO$%||JsYK-Ne~q6SQnVtsXTQ;_67KmoM#8aTH>DaCqbblL zLSHdjg;_eHouI&r%Azf5V~U%&`#C7biCS>q{V9GQB`_KQfM{y7u&^*cKfh(mmf>({ zg8e9jMX$Ff5Kh#4CrC35Gp{pkW#=r60pvPdCo_Am2wvr2TqI7CW>?OXlMWr8Iov!8 z?()^(Cd^ia9QmR+9ro`+13B2kWJ)RRUFt%#x?^C9XjosvQJ3N9GG264t@U>hy=x0g z?mUAtbcmSRz%X}#T1@{XokQf|y${{xzQ^w=59c>mU;4mLLj*{AU+6+T9q@}^I0pd! z{!K4B^2mEgeH?xCz25e=Qvl%8pZ;&_><#gfOMVRi#~=TIJkR|gdE}!Wc+4?JqyoC0 zO3Xx;U3NJDJo{Ns#;%EI^X9GRp8Guj_|S*mvhTik7mobUL-#xVj1QiF!KaUZLOJ4d6KLl*{p=+}9?h$13ptdLm zb91w^voo*#mzTZqgMat*m!B}VYEIt0+a9|;>*OZ_z-7PuU3@+dtOM%oip&2108e}R zqr6|bIBecLfBrXr2mtSR&ujMD`>yiv;6wI4?ezD2>wBL%{t?Fj*v?{W>DZ(4B6sx+ z4}Zj89CiQ0p(|8nb@B_Ivfuu9m#@b^{FsxT`B(rr_w4UU;S?gc`{llU)&&4?-0^?0 zcHL^fu=m;m01i2Hztg|^;a%77{K=1>_RJGrwP3HAa45$qKLi*K%QMe74*=f%fj926 z?;Zf4w0i0Zk3Qk)j{|_yKKE5G;US0afBIKGyzBa%|NY~qJ@bT9+9a+I_c(O_)4%ee zUDxmY?;rodGf#Nch?sF;fX6=J*u2Pp^utT+We~}vJ4qTV9Xf=#O@Ku=Px)yAt(S4H zf#Ehtwps?r3)ZE&L*#8Q{)A1txE{~|ls&)p6ZFBX@y|hm?@kTHewzxT7pm?QNi+-` zBnfYFqUs~apf=N5Ii5IdG=mci zeOit(aFxtpZ?*7}GqVvfyd+Lw0pOl|^d&_nypNwH6LUuoAz)a9f4a#jKo-twk@`{Ehzebi$fbdN*#|M8D5*?x!Z z?t9cd-uJKn`Ks4EC)6mySI+q6$uD^F{s-)N&Nn~#jdL&5S{-)y0ekLs*LVH%$KUvt zmu6be3C%V`~H7@=BvIaUpeDj&wKup_dj6Iv(NkJd0)Q}5f3|j zzrFU}{mpOsz&qakYClH(AXZwR^|kZQI`<=2|M7-Zt7f;`ehmP8_d7p6>&){NgR)nl zKn+|W|LRv)eDB*oI{E?k{@d3+@3pUfXRBuUu)_~rvvze=Ru6v2(GNNH{*BIX>7~Cu z>4aA@h{Xc`!|UID&wC$y;KBQR^McRabkl~_tLFxT0s!9o?tlN`_kZr+@@YQkAxA&B zmFE9m`kQAw?UnNR(8CUJG4J=_V~=jfeEQQ)QMOqb0Jc{%JLtg6_0R)h_d@=k2836(!5!TEwWJ6kOt+ml;G6m5%LdO(>MnGgS zQFF+Yy+3z<*h_mv1Pso%t}714@&&PM|CA$X0=W>iMtvyOSUO zhzC6Hc~80V#+%PS{|A5b!Z+-;+nu5!GllgJ1MpdAefud-eeo%;eBS>1@3r&J)|>3= z)vKgqAi$Ns`{OakJmr*Ao_pMJ_g}w$m(82E{P2etpZdA4eg1Q28)GKZ_t9en0Qki( ze*O4IzxdVv@3}`DdB|}OJLZy$es$tg|5gxN+_+^~J?U{Td)2F-`OxF<|BPon?&g~| z{NVc+zx6HuwtoFC03f^n%v9GkNA5gQi8>Ii^r$VHx4!vJ?|H>3&$;f}8{Yknk12=# zEENfC5VqfOyB$*-i9FA?-*G$nY-ZH;!_8u%@{x~!{ue*{-)BDWN&6qV&ra)i9L|@& z{q^s^b?*Os^nIV*c+yz{<)97>t1*ExvZI+RSaTZ zd*vUlIsVv_U-XivJ?J6#S-TO$@eeOK?Z3`G?bNesWBd>;%j&Nl|MFM9`k4=X z*!`dJtjFGT(}wST_ouIX`P+A0zq6|jM1O7*Kx_4}kA9)9>!+Rg=$&`j{@QD9IQ>iK z{p&kE$wbJg05m8@s0G&o|HEtFd-~Tu^wbj`dF{0~zUQ6)5gon>fAb>uZf@gn^UWJL zn(%JC@s@`_yjZk}&C$?G@0Tr`iU}gj$4XmvRznboVe^c>J z_DUl(r+JS4%R%k?HFi6JbUo5lfDwWwG-o111bPs?lqvbVuyW&?o!o?I8%04S}sQXWzpW7v5plOuFk%-k*R3e75kWWw0V369asfnUYQ(n1#brvgpNV2 zOyBOvvIEtjNb<>>>?-H^Kp`TsLg+Fzo_w+&sY(zc>I@ly@}em6d~R-LZf+*e^E}Uo z!*W=bTeohVpWj;7R8@&@fP`)7n02scE#7^~CUaechzZCz8zYpbL@RT z^wEFFi~J`)`o+gT@`bN{`P;tMT%SbWP2<2(Gb#pUH(x|^`3Y&VJ`-l4k#U?g1t&fJ@y~wb+}gRTe|6RCpY>0_yyg1&`T6tf}0t(O97 z`_l|MxiN;?yUZ!eI||m?RGN*slCXafUe!i-v!QS}U#VnY^CO zwN^@LYa$@Vdzn_5-2gXLZR*<2Bb@XY1k{<%bS5{n2P!V^e%Rety>P-AE3K81BW~bf zsEcZ6imEKDs`Bnnvk;v6*-l17|sb-l76A%XF4yGS|m#T~>8fRbmDk87zoP z1jw^2%X6(zp`~Bys+OD5$Z@VkQ4~cXf?1$kmSt51rj}Xh5TphK>XCqPV+>KIwa&6U z%OdlGX!R3Uy+;yxk^S{4_wmPr&-}#2H(k3qg65v7^><%HJ;Q=q1|<+PMJw%Q!!U6m zg1E3C$du0Qeb-rDb8g2kdjK$Kf|WC^8uXe(^zLzD(sx_nL@xJ zA)#eUqlM-OU;*BWlpXmhiGxyd=uB>jU{3=?*oYlK41B7)49w#Yt+l=IAO<+rfI-Ox z3K(DL;6N-oJL9+yBLETAbq!jpOo3x^$=TY1or@q$(%ux=A5CMngs5X5z3T>cCKK%H zL>~8FzTgxcIzj8o{L2f^@xPY~l?SqJs*G#jCllye2BS!kVoRFa_URhQfhPC)g91gs zLR5o0&*9Vd&Bq;-j!nyQXo7A~`G1Jc@VJZbPg3X#Q!GJ~lw6|{kug&W?YW5wVUT=X~@;1*Gef97P>niQwW$TgA&1V9Fjprt1h z8#&DmzyLr0*)JdRfM-1B@eg^zlaBM=$849zkYdBP9j3xGmT;p(vkJ!2v{4)%AH_cm z00Z5!@z%3WJ@4mVyzsi;T$|_lf+@Ey%$KHebh3R{0ctVf7mXvbFteznu&n~V@I7P! zG_7DK4dY8Xx-$BCpYYx?&6eCAv*A%xt9=yJV#A6fn+`HB?D=$s(G}XcsvnWr@`ceP zV5DTH7++Cx%~TiHuSQfrulys1oPD7;Rqm%{e1&itd8&}k_1zF`S=u~4mIH~IYcr4T z=gkd?9`Pcuz{wbQe*|U7VQvPGK6Ggemsv(xW+2Zv&lDmm1!VmUc=9zIp+W>}^sW>D zBUWStGeX>5gP07F6GYEBaP-w0*BZmlcz_*iYm;zSPg%g_6Nx4iYfiun0EP{ax6=(r z(AeGDB^0bcbAMTDRG)#gv#83|EwV-P;W8`$1Tect&hHvr0LxUhwu3;+Zymsv0(0E(Oa2=&K;#5U6cKS%+P zGu!nb7Ce?snkq0^X?0uhsx0BC6e%~vp;{@Ij;96 z@VlW*e7fOaL6q0DVG;9+5)H*n$OJ&ZXP)`(i@*Mp-Sf4xv$L~Bwoq4FhV!+l$(!8D zi-=0uYaYeS!>d9C%4*lJe}9`M@REA-I;W+UmR5kynVO?+)sD90JiF{H8eyed<+j}J zqe7Pn!L;LRG*DiiFp0U*5<)ZSaZAr7h!XYHarL#7PK9YZwhGw&PTR0J(h~sbw8@F; z2q?m@_Yg5-x9VpwL!(Qhwb8of*@DHn6`+Z4Fa-`QnX-H>I1p)!F~%Uo7$~kycc?4n zK4XMyp&p4nDg(2(LkLtTi#OS@G3S|KU!@8$)0#Z{>(h5+j=)=Tcf zm(~urmCIcdW(8pH{{cWwqInZiUs(1Zm<72SU&E27TltkoUz0n{Zlq7yerdcbtddAa zK#EbWHS1#t>>4e!3%gbWPaircJH?PhCk#5W*0Hon&XXiLrgB=tDLf2cnUR6n5J6p+ z2+UN<$;!H}jj5{2t%BGk(35F`Ya2r|Albg!PE0TQ3gm*Ut7`cVLhWmd7}zqkfQYEX zTBx>^Xh#O&$o6u~AbYNV5c`WB1PDhX$1OO~JILrOrxz|3v>|(E^LD2feO{JnGOV_} zFl0<;RvY^MbPac^5J zqueXR^dM={PCkY%U0RqV@v(6hGhi2on8qdFo$9hRwq((r$+QjBvEmu4e7XvVJu!PN zh9{_p?iiioO;fAfUibCa=R^tG87>8(qasI>Wz;KV%^s&Qx>RwFVakXm4<<4Ibyb-K z7Bf6XV67acjrJftdn&A_ai_9`KanlusOkC^R{_JQa7mEAN09z343`e}--trVW)uxsXl-P?*dAwyQ!H=$nn2>_n zs;Y*=;jkt?AQ6yaC72!o?V(%@^Q`@x_U2%UvNGivIe4b%Iabd2(PT1r=(0bD+kd!i zvduA&>XUG#`=Xt)?vN(DoD@16d0r zLb9NBRtNIWnj9clQ`%{}`lwa)h=GHRrJ}X91|p#s**G(Ep{hArbB-#U?}}-62{HUN zxgK=-XmL-E&`koq-9JVot&BoJw6%3h!nVxTcM1ERK%u-1z|`3M=`Q2=R%zD0m$hAd zYcp-ajoOh(27)(lO6+A_LTLYtC96j8>Ft(5Xvo?9V*G^(y~<=16{Zw3S70jST5%4z zmNn{JA^vZ>4sK)CT>XoUT7SV)a_D_!ER=NHkLFX!f*uS9Zb5 zN$FCM(8#z4H8#fkQl*`M_l-qbYIY40$Dy%C9Gkhr9^+E%olN`8)tVvj(>+l~vfzz} zjo#;v1pxpv36xNBCV?4%bE7n{HkB%gY67ypY@LN00)VmcL8cloE723s=rC>``5(Q~wW-bJ^S5lQ7Nn&(40$AWcRwaJa;YTCF#RrX=!SoZjFHTffW^Mh00P@^ z?_^A9tA?eDwmeBlSgva7>2}y1XUTwiqL&l=KJClPE6P-%we{JRYd<67lktni=$B-P zh2ht6D@yMBvKW;!mB%+6A05F1PP;iSzCQ^-0T3`V=Y};gQN>)!M!p^lW@a+uj{pH6 zf{|S{V&T(d$CwP+m85vVYU(d3lR$+4MghPZ`?36Uv>y=3ZSd@_=8~73x_5vW01)L2 zOnlf2qdGx9r2~lP0k2JoiLILi@LS#1u)x{$I!6X>0W6=1I|mOFo7%IMF-8&G&dk7M z+X2)5=503+fXN*c>)OFzff03^3FwLIt^wT7{S#fsY%*;*C0G)~ZKNHIvo6p6y*4=g(sArDWuW?$8AyM`? zCZ;78F&;Ym(a3Zr*$0m{m_(_vF~sN|0u)8Ddi83t@hbEH6)IA!B2%BJ5BqJkPD!S= zAe@MsN%L8JX!OWMW$3xd=@Yx{8ZC?{%UF?Hy}hrPzK3*1=wzll6CBgWCamK=bh)Ca zb95L>8IR;mCy})Mdi$;BG~$Qo1mblj)j4JQvULC2NMSMs!41gS_tIjid3K7v)dM4| zQ}K!q0OEij834p8kR9d&26EVu$dqLXqNVdp<#`Z3I>rEzNyC^BpLj^$o=JSf001BW zNkl5jPpLaku!2Bt&GKO)#_ z*xf3n#Oav5V=O^lGHr>$hCe~X;LMC;K-%cDjkyLL4DLNB7Nv6s4E{9JGAEm?A0~(o z(RzgeqBe{1)$$5CR-)vao9+X6wdfW5s?U?qY_}ekzn-TJjzP8qfSlpZZ55J?4`}@u z02w2?fE9Zm(#4=qnRQiNkXEc%vDHDb#*x473U6!BbNi^3m4~P zvB?sM+0UB>u51yA&8N97PYz7N0pAV-GXRrCeh3J1=$6>efe2vOYf&PSTMmpdIn3ml zTo!=fH-ynbNk>Y$Ho`{da8MSIqs<{sNgRv`8fWh-2-}(;fJ1SvFC`0JhiL7cUeQ$T zNv1%2C?&Abh&65NKomwKti#4!8>7XR*I&cysa*iD_QBfLD!V#&(z#DbqeR0Z9w?G< zm!Db>z}*XXz@D18q;0HWdg(Pse=bc^u%~6wE=b(t*x0t0Fzrq>GA96l#A?8=V^Vd@ z=>Upq0iCfnI&&Bx;2J>w5d#x4BeFudd(FiUP{|h#KmmqL3n!Z;Se>BA9Ge4L-Of3U38zus0Y!ELakU@4&?EXh1Eo5KKh#0X5*oZiB2N{hZJG;PIRjkv6 z+&s5XF3gt;byZh&HIt*#0L)~}hWRZwEo_!!r?Z&PVJ_wex6}*vV3`*attw1xjFYyA z`L?EXlbG{0If9-tHj?t|`0fn)LxcO8j1g){)k`{cy_Alm(fnm6BuZo2$)GRa(M!b9 z^_8rmCk*4c#PP|k$Vw@xvys2HpD$rf8^J&?D!G(y3b_D)b6h!9dJy)h$LBkm$nMFU z`=EBj*DgM(5fUnOUJXhfxgLjXT05OE0OvnzbSGgdvXJIRX&T-H;6o zY{1?nVP$q5K+FzoZ3wQlaMj^ov@XLM40=+}6KZwsQ^j4g)w46RGcz+Aaq~t} z^VR%(RnKTtvivt@!@`!|Z@NiN$j<6wHXDc&wi1{WianI87~u@usZ_K@2nCC^dsN0h zT^LiLBl@`y-19kp*hr*FVB9vtxRP@+r!QM>9Ru*sp(jjL_sde5%Qc0ENoWMpj)9BY zE}uRt?D*JY{mR@mINR%Quf&_bbj_zxUIf7Q@*f~i`C)VoyKuJ39w*BfGXq=`0Fhx+ zn|v_HXA~mZyVRKtBXd}>_{}p+W$*~sJ#zJlUT=He3A}B9dM=uAZJUADd#CehFkgLK!Y9BgHT#C3=KW(g-8 z?WgvR90a!nihW4~KU(1Q(jeGwgmLLfJEb76F&%rVg#DqeMS#L6JqGS(nBsMwQaZNX zZYR?;!0pVdL(X0n#kqfLOV!e_5lhi=wA|YIC$N8%n9feYj(JNLU_6Q)K3~4sob8{^ zKBAP$vP`;DUgWFPs-h_7=2m6eS{#TYYq`9Uh-)?_mG)XeV0J71!~_~3=zKRW(sf5u z!0v61&eF8Fpk%a+tF~xwEta-ZD3@d_%F+#Bk|Ew3DMT1;hq{bmT27ajZ%xu51ShJZ z$rJCdsD|%|){aVd3W<_$@D@o#Ztc8u3o%;Ak?*!hr{1dUPoY29ZrIZ^dZ(yy2{zO3 zjh&9zi7hC&Q3+Fpks>y2bEgj$7RSglsmJCS4T;H2rsg4lA%d9#R1w(IR_jRGVIIeJ zsYHgflX#@d!T*;+R9aie%^kBbL!#%!wE+_wW5BzJbt!vh*N|hS5Vh78SUVTFRx;1l zyZ?LeZOt>dQFPfE725|T_2O!%y9PpSbxgdBi2p}H?Vpx`Zd#%wln48^6t}+J#*iT@%Tg=O3azzvdz%1_+7OdA$DyMA6Y4f%Y`uw~6A10q1J=w=DXq0Y zN$UV1CWQgOxpF`^b1S8QfefJn&>GY1q@<411*MeITJj=q{NQFrCo#KfliP7QQ%YwU z7&68my|ZY62rxRXh6spgorbl#k3W$pDK`vW1k`qo9m}_4Q(xRsLNKMVtQENWYPu+$ zI^mwTk~8KFVj%exFDjYctI-ZcjK}N=K~%x@7yHwiE%lxV=Wn(P8K<&4#OfG4AYj7; z015zsfXQ2M005zt!Cx5StCGOoyNr#(V)|}_ISfRepz9!8?D_88dIF7p@#a zPI*pQO=OrvE3Lw8PGz#qLx#ynODRUEKz6Jwv5nD$>Q_;1kRF+g#mYJ^D!BR^hYb5I z?c&KesOe}?6kUGa%p>Z|J+<#5^$Ir``r#O*w0}llSy4o6Fw$M=_JDittF2^w^dz3B zpRRNg`}=;eCXT{s#3_`fdtsTE72Hg)!R$7lw=f&lPMZ6b8jmAb{LFHLMJ5#Vpf#uJR0v%&JvHb|;>y zimhvTL5F00mD`NB7K{?r$)+p=ko_y2w4;Z-kw^NzEtrb=gV!J{~Dv5Icdf{bBq zU3A(2z3RPzXp?L@hMpsCZJ&&~n8g!__8JL!*|6ZR7<&bg*Z~y3&~BpFWH__;5y5iT zGqVCf1SN(>5UVZpn-c&K4u>JP%?6sK#mL+?>hMuaFQGJ@EtGJLO)D-3kK8rbpcQJd zE@EOL?_ZAvK!lYy_@Ttj(dpuZgME!3%xCr+^9vp?eMr`k|&;SunLdf`?Y zW+ux`W@qCEmVpI=^@w#4W3{wDYaV?AtnAUA9|0HYjNn-Saa&aYsy^q&^#|EK<{U6t-Q@;YjX^gw_J1@w8Pmj-|oA zcwqu+A7UIY)JklTA&x?Z5oejMs(3niu-R0O2==pJnw`zDW3?Ae!`6(G8xvg;>}=wa z>?!F;GX|>y5fLof(}1}2>7DZ6gZ=1(0DPLlOtE^$6guYq!tc{cJw$ zG`G4x=kA~pcUiT@f4zRorfE}HN|2kE0UT-PYZ&E%GrPorsG~1SXpff3b74*=YXEfX zn@l^$$jp`D+F#uP(C!p$uPhdb*gMKQ1($VMkF;GzuM>u@j@vcaarckTj)$#rvBlf* zn~t4yqtmXlS8A@CE<^$aj>jAEVsKc1R&z0tsVZP1HpIxpWR&qY?g4Y8&TP*P*}07( zj#_`Z4Vi|n8PC7Ooi}DvM!y4c3(r!9V0wsn>X*AiRD92>hP{+Xd)PQV^)s!8nS{|C zTVBx;6Xv-5VFhv?T`lo>gO$h|VDX?lN~XIAeW-m@e{PtxE;-mD_8c7XFmPlN6SsOq z#ze1LH5D%c<2Lo%=$$4Pp~H`pVp^ND(WwXx>(i96Zj33*A!}d-MV{wHp%k(MRDPr1 z8yA4r;R;(h00a2D6=M7r3fSut!#$eK>(CJhc)VjPW`<*tah6`DJ=Nj-NzWZ;;o?Lf5hDSrOtC!M_Cj=S{A zJ8{@)ZgouVZugGA9h!RS$xayDb#3gSgl#_rR=1rCg8-t*GJRtItCY&L&ay1eGmB^{ zL$v|R3Mjj*x)~-&+B`KoE@XMpQLb9#TOHMx4 zf_8=Nbd&o6#t;!PIX0b;6jA1kD*%*IVv}T<{I=wNIhRTv_qVu*V6zuC#GRsaBYK|8 z1;M#-oN`q;dTGC$p|Qi$X{R;4{C^HB819g!bW0DDRLZtr2DJ$Gcq$6up5yrOT|fzB z@l4QE({N-3S?MUf8%g@71>vN9Cyq}UYF?Et`FecGFK7&@{j1STTE{_bD$eryXB z@l=ie7ipowW%28MHFK6E3Iso#Rhk@LCCae zb%(y?cl(Dv71)zB_a2UKWHb@)(4oafCfL^IeJk7v=f8G2QZ~hAi{ZzhOcJG?X#7;{ z?v3Z=4(zL z%CZyo&UBkQ$o*Xq;46T*&a}USGNdY_h832jSn{$))(X&0vkK%83Q4^QJ1f|eTUH_+ z_0V(54Zv!|XnWG(QLnY4|GCZdj`SN(ydhoYJdH-vY5LCMdckjQx#3@b_^oeU`J1aY z-BPIR;9b@~{gC^dc<>QR;Vmw@{_20e@Z29?`-iJ;-B4(~*Y-O-`G9+#eE89;i$Npi z^;oXM6R8t(r@^g}BoZ?av+^q~*G0lXDG$`5 zD(uT(%$RWKt*H|otW64lp<2V=_*5=NV0a8u>(g%TAoq9Ov`v#k2Jzzt$n$X`?9P@{ zwJe1{euMyiT`K^?8TYbZ@gOKf158Ajp*dsopF_P0^40mORjXFb11})oVm55pJWm-` zT97tIOL_%B);I5j;~;M9cnOgn8i@C(;=VynYeh7))p+v6Enz}Z_Cwl?+je`!Po92O zZA%zUp<{h$p-*+i1Hwc==g;9b9(Wn2si`ww*_<(6`Fefr=dqyv?F7Zi13N`}M9)4| zcLVH-3NN`U07Ml3?qWZn05S&aF|#79NR>poRBH&elG`6^0HXkemzC*O7BF^oZ{PQO z$*h2tyYeeKm!g=F8A$-BGaLW_2JI?Q)vSg_4Qm`$oFQk(3PCFe{!yW`xJ5*<&sEA8 z!`>?az^E?hZEc&6Jrffift&5DiLRXt5Kzu4Ow`wXc3G!|cbGZczU@@uf~&50%xNFq zTn^V3Gka~f({)=nUvSkG7hHA4H?F+wlaD-M+SDYR`@3H~?zE58M7h%ISFf$eTzvi2 z7hQk#mw$c9SO4nyb9v!oUb*q+2Y&iJ*KEEO0Ct{Ry`?I@fA#OafA#Oab>(k9@yMsS z!m>9Kb;Z2hgs=_I*2cvcW9nKAXvi3LA*^EU+G-+BC?Ug==aMEnPAy3?Cak6-JiLu% z*Dsw3`NG5&3C;CfgNy?JXOc0V>FH(PVtY`bi~EQHpY6D+h)HHo!MO7PA)#o8+u2W9 z^I=9$)MA!pT5BwH!LypOg5ND2mn!C){T#jK*ficamfCVk5QfZx}0VBIZ`Wu~)e z7$d>R;-0#$cwwP72AGx7m}#wa*zI?tT`3ihd2xII0N(x;dvxBII&vQrD4CH1kOfev zP}wUU7-Jv&tr68V#Ii^^_vAb6KxRJqYyY*m9KQbk4}0Z(9yHJy0Gxi=MJJu{sn1>d zlM@a;;vswNH(iPV0PvRYo?R0?<-mLW>v2z5Tg(8!Z*IBa319fw_pkolCocN_3-5J| zkNJvozj)2&TaUiWo*#R}U+=zd2WI~7Utj#JuYCHyF8%T2_PxiW_dNtGsO7jy(1k_F zwk?CF45in}U^ZlGw}c{UU5DUaUFvXVKe55Kn%x43jNqI+ihT8r3+OCI!%oa?COGCy zj4e1=YK9mV!n!p!de_17&=IwOh`G*{QiBXR6YZ~Z!uOS!28+5QV`-U}34}yf?!cTJe-~_HJ>^Su?qaW6 zA(PwGnmMQNA^!PMpZ`$X`@wsUd(wmU*jGL;nEGuGdQ7g=v3K9!M|kYM_c-y8BR>A~ z3%~KZ%N7S}uh@7K0KDQp4-`ZT0DEu0^I1=M!8Mz2-F{}yN83~m&;IQ%0pQ;sb;6z3 zYzF{{_}G2#aq*E?|KkPceBoC=x1iST8yQ29t<54n|r-)Rn6~8!IEwWY@9= zxsL9!WoCOiLLp^pSXK3~9wIFui2~9D8H3Jrrn3^bV%}0MEGVwQ)(x>;#WOGip|eeD z%x=AKGOdWXKXLTX6A(E;POP=oN|!(-5HMhESUep#+kO_y1gBy<#h@tTM1~$wmoc~- z;2pQ%hJv3n5*~SkXx#oXQv4q7b(+9Vjl}%r_)OeSp|5s_#1C#~s*7!(aQg<{z$K zy>9*Lb#b(-Hf=CW>sPN8MC-$myX_7DS8lx7Jzx*I?1Cu#+s0(=SY01lgo8bkwU;HL zikXP&x|Zz>F~t$mD@ipz2^DZ{e~5o`2+^+2z*!)SdcPZpjLj{YX&o1f%zz45oKyh= zSX?be?QW9p)4gbEOlv%mGW3&#z>fP>#fXB(NUN0(H!vDlWbTPrIS_&F!eR;9@Sq0S zbX!nVE3fZuSr7mel2!`~_15{Vw^Dg4mFO0~3Q)GU>e?7%s;a7xjXiw8?pT()%rKOo zS;(>ehP@eX>&jD0vxou!g&DCjgw;a5bwRC}lbtlJp+Y2$@f>c8 zh1O6+ZY)y7#t_#vVy-eR2B@O*rR*g3wTKEqGiHEQW$O8bY*=SC37cC18jY-g+}%7< zx5SA)Lloy?3eYfcY$VWA6aJGc06=7Y<|(N_lDUf=ltQ%U(J<}K2xFR%xp_@)8`3qN zT=Ed2^f2`^(`B@?`^yq{@ZDv5aC+q2iJOy4(1>siC*y6N$NQ0W78BPB92`W z%*@QJ%LcM3vzaR3%G9PdwTK&z4I(nLF^1S~GufLB8LF}*vc_jdtga&g*jHWLSvWRT zoo*^&Oz-G&LhyI>8fplYIC-J?$P>5P< zon=ZXt&|}m!*yL7Q`-UP25ql6Vr~Veau#ZnEdchzxQ|F`tsJQT*fp{ zIQR$#_@@ib`NfUb{^G`K<>6djyymE5Uv=LHHzLp1)i}fqSLK?Lu5R;gxjRi9eZ<*w{9BH8dz!*b7 zV$&e78yL!}!m6_CVhJj`o>6SJr2D4}>E$Ih5TF`Ogsm1Mee9~RRer|ZUcj!`Phvb-oVt#y{wb!}=RYJYNT?>~n>hucqBLF_s@ zc%xClv|1~z<LD9r3TB2( zIoN2I&|x(g9T(GD5m8lDN~6-4=ebr2i4nlCu}5u)5K(Kku3*X3wJ8|TU;3ah({g@T zvD{-zOiZ;gbzLK3mRa^wF0qX%o>8?BbaK~H(cYJ2Z#aW6^UE8aoSU-l5wk{{cTg-- z_KBZg|Hqeo{R^4WAAa~#AHB~Z>ju^Y_Pswk|8Ku>`jiqT;lzWFIPu^kuH1O@#W!4Y z*-h7-`@3I#^U7bp;rufX*lE{C?tM@kbI|x&!hOO06Qv1gCy?w)QGVp z9-?ba;@Y4^ctjB=F%@-(i`ryFNLhvv`cy+81Ohge)U&Irq_X0no8;S9z|r%*hv-%k zg_t?LP&3zktf#DeqXJoE4?tpk)EXx3%RKo!* z;24H8qd4|+a5g?^=(xss)5s>7rLD9R{yFE<&8^whnDY*cq#5Af;9&ix9uZAl)9bGKQ+UF3U>m zp)A6O!?LO>=W5C?$D7QMpG{UeAOwE}3}ApgK?7iS_PkWW3$asLns8v09@bD38pew9 zJkRsos6dTcYFGZt?kggewJJ?M!!xr=)RUGv}J(U`sHR>UH*6i^B;4c#noRd8wX6GM8q>SPA z+4q=sNxw?S8Y*b%jsE3dU%~)SJ?LI19(+Xl%km7+-Pi4~`??)q?}J`(p9j6_ywl(J z2MbhzO{F7ezq2$$uq+KVKBBe8RjPJE<9A5#Ziu z$AbD^mv&5a^ESkT&q6rjW=HPGq2qh+5}@-vrw*Mt5(w(T3>DfntEs7vy^E8>@EAq@ zZu5hYLQW7SoAEk#HU$Vu6A}P>M-2e%>|6m+D53`l5Qr7(u`vl=l&6mx3}##+MK9YVl@j?!Osc{7W{8xbV$O&&!x=#a zpfzTIIiO){F^h-p^Vb@l2dZa8%+1EkD zvMlSWHnpL2YHCpz?!xdD4hm2K%59#6_KbpaT449n(P> z-u!?_J8sz(osaybnU01DbJpbiQ*Nu2*kwy7Lmzh%?vVsNKbYy3l3 zn~UJ1|0KZ;b$77>ciY;c06~jZ;$@8osuS43M7i2t$m0<0QbM%10^m?sES*xQl@=$^ zl@ZH(@TeiM(2!ULU}V9=Zf)7FH(%25u~SHx;Bw(913PNbZcKUGTyJcoR9Tj{ZrUW< z+^RNctnW4>*DWGuS?0O~5fLl$h6xdKi2y(mgP2%6*#59=5GGmHN6)Leo;UNdpS3U? zZY<{)=I1HKu42n;S8?bTSpd)`zuj7{Yq`+iYkN$k6Gmww9v9uECPc=Vs;;F+l~q+$ zwK2xuPCSj#tSg9T>9awvizHm9@0JuSJNm?IwfHN^aQW_88)i5^=;%MI0fd zhEx37yCON0mf$lwSU zH#Xab*Fs69aMR7v5vXO~i7>PrhF=?)gPW=Oui*(pHhKUrVr6rWo$m|)U%mVnuRZ#q zh1T-$^vf>#)<`4Q{de5uf~&6h$WJeL<1xp#`w${N`^?YG*VXIq|FBma`JkCB19xc| z035jUdLMI5F*t6|{l9kkrO!F@Gyn0ZllI$j7XbL#byq$2tDn8(hHKvSkjFp&p7&1^ zc9yixXgU-fU>i;^V*`7r7UNn7U?_^4$lg6+PnWl7n6!_r(5hDsJ=uK~_Dfn&N{RWD zR!T8}nG}FopzQ3Bw#97SQ!#y06aYAjQc>Mu-VjArmgS~}IxmVM&$+6hs-@F%rXkme zm}i+aha&gK`7FesQSBtrC7`t&0c;pj#F8)1WM9|yf}z>jSwvh|SlF;>V_nxw#0um( zHM{n3U40UKwG{R%wvC=3AOZ`kE!He`UCUCUs%inXDF|D!Rp6h)ky}rR%Cb~Arw5swnMkiiV*pS}Wm!g85p!9VRb9tbHDiJ z@1FI~7oNN8sV_?w7-0SCwJ*K*1LCCK@!-e(- zm>&RY0J#y1m=Q2OSLM6EXcuW?;c!V#Ai08KyZG+2N0qHU!0tsWX4k!3n532b5cP{l zVzTKt+$hGnwnmwmO6Dz0x@OI_AtDqDD^#XdgaY)T$aADxajlqvk;yL9n9*NCOOF0_ z9d+IwQ8LSt81&cAGXB_7J5-6YcNg3OJ%g#kbzDoqM2G9{ZK)dq~Xl2Osit`7(+ z&|a}MZ}E++uA<2CC~bGbpov@huXlJy3l3sao03bVRHc+LLWPju4UqKwV!)37KpAyt z=(gUNXddpUp2;Fl5?Y;j>%1CPS!Fb$&M>P97fMytitHSYpin8U>*3byX-*(fjZPYnA!|^+Q|y`bgn`b^dFl)Q;X7xY@#~8} z_~Y;HJh%FRyYKUnhd=d?n>LJi>*0GH`1!{_`)&X8^?8&%fvW54+P{ z-t~iT{`9)5{&4Gt**rgBr(KWV>%f;E`M@1#SH(%)eY+jM|BO@K{y*n_?YEcyanpu1 z#mrH6zWa%X9C6~oM`q#L2t-f;)P|WiqP_zRZQ+&>uxs2x{}b+s*ONNNADV|x(4FXS zWX2AOb|#fdl1}N3o*M9}#r(v~Ow5FcN-H#mDS89Z0W!o+{n3CAoz-Ajx^TgQs51?i zDY>D=p6nwaWKM20X&rk+K!pks1kuW9P7g6iU0DzuOPB6@c#DN->|u;<y z{3eJFqYjndv~h|Lm@6Ox08@j3T48N{wqRDXTx5`CSw@3dMYSTMfRT_%dUeK-8(V8c zp-={~b}K9y1tcdeBIu0}EsWB#g+pL$@ulz*91LEpPu@U~Sp2L|Wu%~DD%lLVCLmTU z9%-c3l~aHSiErAtMrAT^W$Ck54kNb%)3#S12z`;G*8rS&b#081JI|~MiQ5a{NYP{K z?N&ee6NX7u(NrNV+$33aH(%qa?O7{AxV3Sbe2YMBvPsnwe_GL|Ez3mlmsUMvHZCIF z*_yAlyWSu&t1%e*#umgS(J zCa6mkP|M8B8c}P_#+3C|Dr+w53?M_WmmEpnwE^m6sTY|_H!l;`R zI`GMe5XZso)*TEGb>yx#zvkp;O_1#EDQx$i_bALzSvM96(ci3wfkk0A<%1o{383`R zryeDd_23BYKfWn@fp)w!>;{g>=no$o03w>}tutrDHThsoQ5a*$&=yl|p(?gMvdpZr zkdftbXD5zj^CRDVkFLOVLafOLYx05Y>TIcpTk2AFq8Q!z_{g+JHi&@*@afqspUv`x zg@uKMg$l7kmkY3Kgv2tzKWbL2RXF~Azr&B-c(+lM7}WNcJ>u~lCnU;IK4*-XTRc<> z9H^Dsxj_5~ZohiX_N!KJ*tlWihK)nTLq#$f4?q>Hiosw|6mku%)Pq4ZZjHwfZhj|Z za&@ldMjR_>1o@-SiUYH59fLE2PzWCQ5-3-hJLdc_?g|V59e``fR@N{8CcacT$%h(aO*2?+!kN0gl^`{88=+IfNMn74JvUj4` z5#X;47A7;`nGDn>pOfW(KV#SVZeKbp*m)Y(TZzuc7}O^EMEM=j$mogy+3yc11bfXE zQjyWX@)%HLFv#pq=EixoajO^@i~sD})TTD7$W)PmOlM^cWexHr*N|uO7!9Gj_7)*r zl+z$zI*Ee`L2YL`(fVl8(AWRtr_IY3T5)d!I&1|3CdLQYoSIxL=&69{^wCnqfG+T~ zq%dt_QoZO0JBQ!o*u{gabv%HU-lP0 zw#Oq?Ws+wf0FWRvvu=`F-S!|9QYtUJ6F2}taD!j*_#X!YN$s;srFS=Jn>+r48|yr* zIer|qjeV87Z5GBDNY$LlJAvJ=+MqcznWn~^csj`R%h#{JeEX)g`R%vgPNx$EfUZty zY$v(&OsWbn>Y8nh+tE}(6Z>}Fj6Q4tkA($5&KX3KWSXYKbT}N2hw1q8@&de+QrI?v zd=Gj9P#6bDw`#J*JK6|#`^~$S=TCY!s$6dEhsO7)B|jW-{q?!DFB<;is9BHL4K&K) zU7I3MK?WB-mHBkW;cz@2j}t$ogKsrC9MbU!K+hH}%ZvgLa?W{H$77_7$$e{bDcMdE z-~`g3iUmc8KN|J%AV}U@$U3O~58KbcWFp@I0axhb3yJMz2W+Ums5`soZ>5z1@akI+ zW!5S)rtv^>sL7c=SLa_fU{nBUw;g&tFtqAAJ+!S=eXM?#LL|&(gv>1?0Q$ZVCvw~d zbwB9r4Cp`X3gLhZsO}%OWntC*zR}83Ye+B{3mf&&)lS!jq3|j=LB&dV03E?71eB79 z?brlj6e`4$5_1A4(3k0nzWz#yG3f}G1M!jMAjjjv3)3PbER&>6D89f44?R;D1f=F{ zN=wkHqvgJR>fjOlltnijoUzQ90YX7K$TUrQM9sIuGqYG!2T4iNb1JV1f2Z@g z4@Xgghr9!Thoua%kb;BEbQ4nFSbUo33eadOlz=U&O%o@;c`x~ z@L1hf>3q!&7-OgybE|J*_4e&_>qi(HqIblmtuj=Ca7^YOFm)A z<#i_E!ctE2a$c6a=xLOknbjg(3e81qi!che+2X5k5Ml;ISy=CZ8cfQMHxr^9+_l^6 zecWep^$2KOwbcHbQrIHKZu+WGJK35ep$8`lq-7Woq0JHW9mkI~H78DZ_{ZV5ip-?SV zedWRod5eVKWCdFb>X&2&msh!V>r(;0eLIvGe~>scXGSAopD_*zr~d8ot=;1*^`lawavnT|#N zQqn;V$8`K>dHrX}8gFo7nGTakVwP`*=Uw>jJJ*q-+S?TM`zPI9vt_{cTe1M#MTSR9s5iKdH@#bM5I%shEFhxS z8T^`=n0O($OFxlr4ptG7+eV7Ql%*}NR`@DlQIm}+bFHoRYq_e_jdZ_{?C|-ur$i^A z^XZ&(hC6(*#j>>&<9<2Z6qOeQMpa`(Pc_5waQt@oGELJoP0K;@l1``7>7?fXiJm{M z5hnE=^{G9*p8k0GV=iZe;}buc-enzmOYUx@eAUW$$y4@ibcNO5oXQVKozwHR3f|k@ zn@(bnJ0@XuL5~Ol<<<|Dfqu|_+#`&}k$wsCYU_Pp2op9G-tx|B`ftK-Um~PnyGFIc zp&fOgn00L^VLK(qoYZu`wfhZHsls>_S=dT5K=o@l;R3Cbztm7$H!o+{TWVKrK{T3? z{yiu-9uQH4bse=WMAci-gjdBO?>Jqq*lRzQ?#b461g})*0I&#MxPUiO(?R;oR*mm= z;&{V~@uLpo<|$kk{lhNBl+x4j>Fe>!Uyfh&>G|cKzrQRRoSS?klX^tuaz3B`c=^MQ z;sF5SQY1q+ioGT}37yWTTyha_84D){<(rT77YHce#7wNG&m51(U%&mTuDv-6N&?FH zd{WQd^Z9%}pI={JUtdppBG=Q?^Yiob>*@97d2Cf8S*r3VgBDlTz%+>pBOyI^W@ z(0crXaA#+fhYt9`r@`bF8vpg5!R)+`Z7Fd_cQ;vY$8~DQ3yT_~)((^#|86JhWvHLf zrU@`yZuiGsj=kuww?cnXaDExo$94-qE+w(J_oTD?%JMhJpUbj zx~N+XQ~RfIYicd17k~lEjM6(|?lx52!CuX@wkl*uvFgmdD!pC1z7=;&-~A0sUsY~m zBJ-nA`ZgW;`4O-tdWOlg`p3GtcA8Rb-RX38G>f*C9{NuFq4GL~F&DOsqnTYA*y z!>t=az=Pm&fOZ^itfKag_=&~@^LCi?{QK!et*`_nwbgTC-139=gv-B<6w(Y(5m#fNhEdlSE_ za@R~ZZ?(JE0q_56P(VAf`JsO3jb^L3nPDaBod~=C#5^CTd%v#gx_`eRUfw{1=jsQn za@<4FKk-7<2Jz+hV)PtyFaoFsOaNJ2Tl-J^F36yanr<^!VF*D(c}d??`5c0Kx6(h* zAGrAM{Rs@H{PNQ^O+azf-;3w)-GBe@|6NMst@@BD8$_f6*AK0T&Fk>wf{)sGyHhLN zGHWMNiAFr-_-c^e!BteZ1XfTh5HMO9Hmd$c`%J~kSBJ*+^l_Vv?|R#sYdbZz9alv( z{Ag@ME3!jE4}dW8*UROpPMHc@JqD^!Sl8F{T3i&2qd!>o*gBJ-KD7*RccQ8esCLFg zpORl06X2ovLtVlFC_6Qy%|0EI@r`J#vC6;<=HSozYdZWgO<75D=0#(@6y}+5Mmd-A zn&{-Zy@yB0LO{vLg_&7~)@xcw39NvLYe=uc-G;ClLTf7KDdAmY{Bv2B-%l@3I6esp z=!xXZ)7SJhO~ey35iQH|hvdH>nDFHoSHsfmavHOq{GT6XVTSO1tjq-K>FSH{F{ zU9S4e?g7$a!0!IzH!fx~X(%6JCJof;;Ngxjv7R#zjq$q1zyHQ?w$N?l?bwGqpk5I5 zn&aqpfKr;>-u+kN`#Z&rI@qd7dXLgRiBAyAH<9m{!vz;rYhlnuXdc4_bhn!_630Si z6@Ih!qpC!k4!*&5Y)8l5TFsVILw#U3&VCnC)3+YUeJcFNV)rxUj9g=9>MpC4(#%w{ zRnnQGuS9{MC-lG;s9gK-A;{J92pvlUuG*2zp^MG0*N>i|Wm!%c%RIlnz6vOT)N%If z@tBTJipjx9A_y62iqtKh{1A(XSN41D>y8*@MEK|Cn%!=F-1E?lcP^Cn)98&VeEj^K zD+jfOl!7*IoE1HeYd?%?5%2n9MR(V0v_4-Hk-NJo9--dh)+7aLHs86A&;yI^eibJB zCE7#KmEw@9~@0QY3{D3*NgYYNq40D`B2E^ah zldfXfcGAM`NaxD12C7NLcgG#~A5WjoMh(^0()8YDwQZSMBWS%fKeq@|%w}CG!<=pO zhNZ3=jRBqUc=SE`9BLeJkdd&xUjR-EUf9&C1PHJvb>f>l^+2m@Zm5W4u|y1w=ajIo=Z*>OG>3G z98nAG3!y<8z;AnpF79c1Qa3*`6e9Uy_J-0>{wb6#~rY-Ac)w*g8Ul;A&Xs>zi z%i}^XHLwwo2B?Lb;{JpJ(;S$EIA_Ypu_&7>34QYMHE-Fg3uUgqt}VlE%|$^eM1{JZ zuHRm!0ad}HI{4|{?3~28Otlbm^+Vj{>e5q6Z`ZNZ_Hntl4!&6q?NP&YNwbBR!r}7h~2IVI~w5CYro6 zve2vObDlC#h!e{si}0DsOjwvukY*$hh*RMy8-&e_QafIo7}i$N1tN#yy+2;OFe$X+ zJ0qv=^Keb!mf02Q=E=Lw5wEwy?GYF@pT0l6Z`W-~gG;Y(DkRM-iJ3+8M~ZQgKCi9x zKOFe>opig9u4?C-@+L9{vQy7$alAhKM;u3;eBQ=p7evA8gAJ*3U+3J{R$Z@jV{144 zu&>7rdyZ=SD{09!d212B7!=&b*a40MnT}`Ht06XG_A=hq%vbBQq8l1w4<202rE79H zs13k^S@(Q=N9%}Uk?OeW1sNeq6sffe;di7u4sAo2ABQVq{+R2zQjJv#vWw%|;;`G& zj6?h>poUuCx(NV85Gnux{{ns&GiM5u5CNIy`Kj=8 z;V;5vl1wNJ1+~QsR)EAJESe4pics|&F+VCMDU`AmJWD$!w<}{nvGK9SsVxOSIjGMT zKtzjBPDI-NOjsb3ltWq)oe48z76rBD^*d#n45i|nXcmRrHT2?0WoJ7Ezu%PHOb4rr zotJeWZ~B#A&gb8bsr=+rm-s~1-e>!$_D_0{xWC>qcU<^l_aS={AFgifQ5-m6~Ui@4Di!8|hv+p8mcLnXONn@ZrC zfmXffmNWxRL1OglDuZS6F1o{evF2R;4}v1n3PKbI_^q5otH9Oez=impjYS7eElo!Q zmNgF*3?gU{uS43Gl#ZR9q3hSKwC!py-Hm5<>cD{`Q=spQEF1q^xxBg;bNg`Rq zm;N81t z@qC<~IW0NooD1@dtRG$&Jnti&u7T6HrG10@>M*JYE&JW+V*0m)VyN`9?or$C@s$Cq zy=0EHWyRHRXocPwOdr;@cTl&y_GlXY*Bi~+HZ|<$^RE82KOya6E^yzp%D1<+J2gv@ zts=Vc4zggQ3(&mvI!k7ACLFlMj*z`x$D8uPMgRZ~7D+@wRIT#%iQJvW1)9Qc7zec# z(R`frFL-yMZ)M~-Buwg*48_!}IBMI-gGSa^{>b_>+AyalGuTFWaE-eYXf~72{9(II2QKM3`f| zyHB(E{Z#bPt<;$zhl`(y%o;%M(HN^x?R*w!X86?2aX}E8HH70kgRz6uQsZU_Usl>? zRhwwK7X0mfyiVj{51Gl0P#`Krg;Oc*{8(lt?yJL_CFo1GQNsQXssPYcenN38c(WYa zAJnhwkgaKK=A>Lm6cLCd(V+0^S+NU@4Ok>*LXh-2cs>nTUxKF)=4_u|;!$NxfGYoH8Fk%yOnOQ`sIZtu;ac z*t`VTm3<~K6PVmT7l6jPB5B9=+Ef+_YFgVg7NZ{^=2U?*0gNInECQggM!YEFaI{8( z7GJr8*gq{0m7&pY@xx==h9qh=4W63AYd7?5)Yha;w0(6($in%N$>xIUjMHCCk3g{1bQNQ z<|ITJB~8=w*RN0PS`qUxO-D)7;cz5AQ~AA|hroF@9?W;F_mE(137Bhh8%x?^#;Cm| z*c52vGwEzRu)Ma6n>CGJ$h}x)r(ji52M=n43yCY`}RJ z#Km1fF+SU}xr_tGbmw*RtnURKxpm|!8hOK%!B4buJ&rDgLxH1Q?h73>Y;e8dqYH}5 z+E{BnqKvb$cMgf&CtmMbYcwIyctNa1&p0-r(oR;^a2(QUxQJ>$sNk;ijzeqPV7AgB zjskx}Z(l@6LuEaB{9V*FN@d0rb$_4fJqqz2Z^JAI`4 z=#(<}Rqq*aN@Ag`8Fh|TAf7*fG%mmzzk zf)(7VkRrd!xMx zcIl;URC^f-Z&c(>bp87}{Hbb^I=VQ33^qZHFiX4f8Px-BvinVE!-gX6ZSzL`<%oi+Lmsl!;TKC$E* zl2cYnB+jJ*wni5*YHchVGwa%|E59RF`$d5n`L-?o!nW(^_nejRl0r zETI^85UgRiMjNO?GFH{)noZw2YlxWncs%}cp!qzX=QHL^%OWWyk<)yBIiK~T1NaEm zIJ;?@rfFL8l5<|>S>tDWGos>}RY^zrOARj(*;YmLFNYSXJpJZ2s%)`a+H3M_eC~ z4=?vHVgtN^(C_HD<0~`1t>BI#K6U6DnOWpN`r1l>uBvTjg!Z%t`%$rvNdL-k@AER7 zth4^U5Z!-O8*Zvlkov$n!@H5|o9RPx+-yj6FI?Xz*LBd)8b>3_q7s&*DUCVScZD5SN zhm1o>21H9EvU`Xgb`AM)sF&6@Fwk`xcQ_CV3t3zed>Gdlb-DiG2Jod$#@OW1yD^3_ z?~l0~$3!qnnGo!hzqKmMZc7N&su(d8v@TA7`)?Z;aQ)%&vBw4~)CAcf+ChdX3<=1V z4Aee-I~-4^({!3xqI<@BT4G@j1g<8CIdUI=qn%2)h-`_$y4t&Z7zwk9xHxg8kI;frFXXfbf zT@c8SHwU7o*nTH4^cb!ksLr3tfSl!YO5XbNZmP=naC<<^`xP4G1#@GFBZRp|aqw*- z+BedLe%X8Up3<V81M`L*?Db@mBvHgK3` z21qk_Z9tD9v3*)iy=GAS*a6gU;k`-U+I$`R4+tKYH2&!8r4)!8u2_+Y6qM4Gr49+` zWyh=9a!c2O!Q{qm%X$wB)@NfN6 zJ{YtOp+B$lhd~-$E*#i+bZv_Up}JIHx9#s1SE#+lum0{Q?%OGB5xqZ`AGuZI!1jbi(3sXkS}}4jDvO<@zz( z3>YYKDHH3hx=pIKfx{zt=q_R=X|TYH;LFo>O4mXG@u%_4R$C4_fy1RucpBLEXAYf< zv}ZionMhHV5L(|cv+hz7XPq#F*DQ9zoZ2Z?mc+n2D=%uUiI)rO+MK%8@aWlAA6Z9T zU?>&WvX(RSA1cf2F_A?-skqih#n^sLP;)3AwBoReS)hWE$i<>)mVnuYH)GJidk)rvkff6 z>(>`i%FdC%0s$)u4Mq!=3?f<7xaU^X>t9YbgVw zy(5p0ZW~ucDC&!vvBjfg5t$}~rlpiziXE0YCWWfHc@l(8_XFe54cI~b+w7}2_^Q0P zT8mbj#twp6w7D+XY%saH(H|Tz&L*O@$sDS3y`!}Iy*vXPq59A6LfX2zKgYCL(XHyF zqN`rT(C=H%*0ls*%DzpAUd~mC>E4t^RnG=FDkiQAi&TM~Yjqb>b*}*j@kA9tbuVeV z#0u2w>OWN56aDAH3^w1>B`-P8wKlyLZYSWO2m1FK30gaJ#cgwnYF%0c31(*HJ^EVC zCcv225~3L@V-E)>D1d0o`Kp_{WzABl(*3+M15G^X2u0Jw_w zL3!iSzZdA;i*yz8ni|2~E4@XFJ*5tv(CQ6x5wXhavgCf)j=R!(Ai^Sv3CNl1A`9Xt z7t-^qRUPj(XM#n_VLR_d^8UsNE|4>cj zv9|co{bKb-ka8i}w~r+bN|0G14biG8M7;s$WuE6{S*R4$1|BWqbwQ4ai2fhf W1Sl@Wyburo00005#$%7?y=Q;^{5<|2LQ%wk{wn;ipM5JFqGXf3VQ z)_dQzZryvU>YR-CM`lE3o~qm3cs%pHqgLIjbMoYgjEsz5L}X+hqMLsN000I+=sEhF z0tn5y7FX@KcFocT2<&VRce{wUy-B7D`a`B+FVPs)qX2 z6HypnqL|4XQJ{?Q%;ET6ioPq4K@`=-{&6vrrM60=10Q-x4UJWi2z~2LkdnvMe)5tZ z$c_q;u$Fpw<;nK<`Mbi6+Dwj18P_yojtdfzk%30+2O#?q$5N{dD3aQZF$6>8Mw=Va z1%mVtfJ}cBZ7#Y+S=hA}cUHM9QFh4|!aF7+f^h^G%NbkOMs~`=T5J6?;`+%LLu5=Q zymSSnBy(n^sAYE$n0&M4*`7%Z&uM=W5ideFfg_&B%1&ey^;YjySs^H9O@0kRr!~Z2?l{# zb+DjTbquo7Bj_57L@*y^w2`WKIHe~1lmT8fqaszESYL=WP|}Ugv;m7{!)iv!P>gRO z4niX>@XcbXiklzh0jiAH9At^!ZE4wB2ABS*`p88F1mMY~gUyOd=n&%IbNd)>oI!TOE3uriI*d=&x_;3TH*!f+dg2M}2! zP8@xPdP1+$K7%uh_+z;m0Lz?Qn>3zN?RaO02 zmXetuPHI|H4}0Z#6zJn#%dARdK!pgkW9F07#!wuVTOz=gK@m47*qx!}L0d9<^tkdX z@-{Tokyx)J6_7&^Hz4&<0YxdI834nADQ2Yj>#jq*QWQsz84P1G%FUq3Gt=#snJL=_ z-L5UWY)hd!;0044fQXD!cg#K%6!|p*g-}Qg6bU?vPSqBKF-XoRbv2Mv``TzVcK~Sb zDPqTpIO?D9ycjpNa3BJqUn<=vA4$(9-(x)^sz{&4%oKR1e2PbNpa|@wTM<)D6g}Zl z)te2zrxGX*&ThqRAR=Q-Ew2p@42+D7jE;^NqE4q{8AVZaI-SCnrDgFt9o3d0VxwKB z&(hJ!-iW9Ue+Ee0P3e^Ldy0LJb@bhLeMEie+*?mFlkqVCB4${yA(Uduc_AWUePjkP zDRtUMMC{|P1XpiqOD?=vT1$Wt3xOl4yeJi%;An_^RzKA?i2{u0)0x!sMc^~myM7EL zVc2ylrS&c+`VKG=H=}V_#TkT4ArjPk>AWPZcT~}k(w~*5M2|}<>1S*xE>_WA9?`@0 z3y>b7h|x{j#TD?a4jQTo08^@dl5eCyt2T@TuaZ&j2S)XjRMF4W03uBtpGwHp=86xX zfGKuo+%^w*Y*~>)19U2{2F8e;&enPtFv|$YEyIFK%8aRV&Za(MhP&u?sok<`EiMY! z0$dUi6SMG=goiFj$6&+O&9E?AhcV(-cpx<(AQOMVhk#A&iaEvL{eOq{k#NKO746mpz^4cOX2c@1K>GDd`dF-U!48w-K&7ugd zk!Iif4o(dO>Y!2d#HNaUL(fTo8J3)o0L;X$?M_125Hdn7GsYOUc`eIwV>0hrI)aIq z#Ju95$s(K12fx*{v=Gj)v_E_UNNdScMpce=v|;7a#lvD1rnNE&%y>DYsDl%w?A>!u zfD=&FB@}wXT{k`I!_{Lgduxf*8jBF(A`mf=dwrgqO=Dqc?)6Q*u5o(tmO` zF3bob6kH|hDYxFeeIJ}QUkfHyLg>dHfgb}NVTLHbx#Ec!ITd!oot zuh?qo>G%=V3rRzX<1$IBh=T&vI|UKhqoXKZuw`P=Z2@20KsNBR%mkAeLd|3_Oc|9$ z!QD0Pwym{n%aSb-2quCE8FOUBpKwzpY^{YeDFxuc)-lvb6FmOOJyvE&Db~Im&AV|V zVGgilxP=laxB7IfpKp;1%s#o{$xeD$83w+8|%mXVj)f3>Xf6D*hp0ZF8&C1C*TZG*A)ayFeG-g ziC_{A`Zcm1n?fw(Q^=-1zKco}#0Cs>M|#uMm%8~?+)^>52oZIxt6mIeL;dCQ_Qd$yOCDmIL&3i;S4}ECr|8xB|gsM~ziBBM{KtiFndaDACco_DW zt?`L>!VqWeHLwpiZ;tW40W!>1%jG-Zu z=O_x>9k87?ih_#{7i~wnAIe}N@8al`93cZUh%+*lt*hNy7j~1$NADDh0wL$dFc~jl z0`1X1(d+F=nYQm>kWhLbMy!WLZsa@ESpoIXbw zX4I=zdsJ4>Kt*)Lm*+4{Jk&+Qh@=^8VF+xPGXSs_#=yD`u>=c}c0z+XESYHlycz07 zN~JBrOCqDbLnOXHz`{TsrBy(1PGOHYV7G+LJ(h@1<34Sad`pq2!<8l%)p!0N0@qVD z>Q1DA^hyf?Kb5;df&fWEU>{~+upbw4uUAu)JfPZRsUl9f6q6DeQGEb2fgaTwJ=YTX z68i(nYOaQVD=vGY*4bl1h)zV4^8szsP`^A``y%$Vg+9%1?P$4e1A)s^?MSSTZ6*AyUzZ8i$B}j+&WjX@J<0pJ)_)M9Mm1 zA|)3DE1|v2MVwSa7>62HSN4N^9HgPN&oDmfgZ~$=0$h!G)U&gE)rD z7~!R-k_gtvP$5&{tiUNV+FtOO@sFBQOpdCq{3ktJMiRr4#~bf$C6gHZPfWmhYwM?@ zW!Sq8c9yEhrD`k>lADAtZ*Hb9;e%JvJ9 z^&>%0a2;EyU->Yq{xKrt1zua0fMn1yfwuVR>GRyghzqForJvUQ5s{PRT%TqJ8gEv~+;I_(H%zkN>f|(u?#83dLsp}1w_9}AiVoYdWQMiYbw>s->pq!8C?;bFWDFTH1}MtX0TEWU7Rs9#>;M#tgt16PxMbsUCRP7`^7JGr5s4w$!Rs6B#16D#P7S zmSqQQt+ho#fMxD>UFftd8Ezeog|$Ak9Vk{85SnzuqHVPCuBS-65OE0z1TqSW=NXw7 zqvS495q>u}iH?Oah{X;BE*T8VYLEM-2Sc~-lu@LBtL+Wph#n<%Asy*-O3*9&Rg|VMkQp!(d9I=< z5`!QbnZ3;6%6VmQC=w4L)fV9Os_l0~#&c4+T8ihXC-`EBT+%>auk9mheLYJ0SRU(9 zEnh_U`RA+Sn989KL$UOZ^FdO7w@))AY82WbH$}{}Oix4f!J~0jU~1&K2|!OKd4aDDaGq1WG~L0xK3EooEjuVX?1F4u!p|Y< z;9~+2BlF&zU%E&{kWd^m!&+7ciAa!jAwQnkk4G3~iq5l#)kAi@zQ93v}_qA$kAveS`4>tUDu{KiYT%J zqERd1U>WD6PB_49N%FLTJhEZX=lDlK-ns|H-_`+RKNLCWf6^iC0LL;6EXlkwEBXhu zj$Tc%-s9w2Fq+QO=E!dLLLY_i9N}U{u|T6n2>|bwiL`nr-iKU5*Y(14s=@=#z*iTv z2pBLCath9i;|y#kG_8*zx4d#)CXd#KpyE0ipt0XRFp3$x0Pqb zofy$saRJw5u6C%>CiPS0LEQ6$Rl*&Ms!#B^6A$|fwN2$M$V(J=b80TS>gkMf_#nz# znOaSPS`sm7T#c`d8gO<8i$ zL9tdA1s4UE9m&hEV1TVl%{QS^27wG2%2+{&*^+^^V$J%*ctapbfO0z#l% zBniU!2S}(+V8R;@{q=5Y7m}QeO;UFughe5f5<$cJgQBTKtqQ43dbxK-NZ_mYpTuO8 zvFwe0;|&GrU9Fmeof?P$*jh_u3=!FoK`rYE#NuEga6jA6il$r?7s+g$dZ5I!PZ2fk4M!?~lU-P;?jl932~<1j{bXT6=`VH|uGDx7MrZvThGnC4ZeG z0azU)j?4&X&VNKhSa0!qH%+4Ixv}4bSrxIOZwX40;<~ni)1rMsl!^Zo{zQ;)kwUY+ zj71JXd~oG!#HL>Qs+LI1r+CsdeWrX%vAsX}sWwiY6&na@c7X-O!~#PiJ%IWsi1nkU zS|mY^9!o2@?|wc#rj*v97U6Lw%kwPDsFs;BE6cJhI<}h?MPZAAi^6ir%xp^{!)}g} z$t&(?!GZ?|A6c;^{xTD>F~n9m%hpo7v_{o2#0Vj^Mp(~T4&Ng-C2jHTac&U%0IGUE zUY|hy@nleNdc;qN!kjXVMt&k!fl#d>z=M2b4S5U5PwqIJC*xOgkuk>PS*AXBS#-PY zwxg-EOk`Q~AsG|o!-cy+aPzMcF|(3X;TRL7O`2c~dDLg8NFmY|JC7A{34CyS_bAhd z$ja)H|Is=AH6a0c;CNaa@o$hvF!iDs?`0?T1=x;Ajud8J| zA_C65G6X|R2FAb`Hsk}UhzRrfQ_PUKi?Q$vmjR7OusDCg3ABFriG~q_h&{jrwbic? zk$aLfOYDj0HnHZ#8JDvhstIgFqz08T^}qV|go0KT=6lZcSMeOH?kFId7O#MAnv8MxbBe-4pAM$w(LDkZ)11gmKT8wC_SxPKx!+1S;+))*Pt1AxR(~ z&eDwOkFlE68}KnaK)jG1`rTuxdQO{A;gLfVR=i0@Cq>dFx4RxDHkJv740DzZFf*0b z)Qj9&TNXvpp`zfTi=yo!t8LqbwXjU375^zD?YV~=Z8!U6amI+TWf_Jt%Cs5!&H1Ko zAq;~vPOX_V;EBixiq=_!BvdF`Koo()GmQkWUyLVbNP$5Gl;Gx2wdYCBdT_QCt5h38 zKKAUzOt?*%KWgr%*Rm|nvMkF@p66MX8)J&1yS&t#J#(h)c5SzCDlRjeA=8a)v_jvB zL~h4U3y=6ETi++L(}HENW$PEO13(72g)7j7A&6ly%vdRB-H@>qn_-E8okuFGN1oS# zfcUt`sg!k(VAZboY@HD`1Pf!}R+Yl|s3TY$o4!Qr>AtO7$BpQXaRq|DBAE{CZCyV$lVqP(0&Y^)2qKDW zlB^6*wOtQv#MjiXPg4ufhqqFdAP&$QQjG5Gw@^RyplY31JSZ*}D=Y%4jyS8JRG~eB z9`W-zR29(>H){RgeQ-?8m%#8aQb`0ubeyM?-FXJ0ndsz+5u(P8>JMirHDdQf!Wgih zC`|6C6p_y2R6OAR%SGce@uljph>+BSw{8&N)~*qQm`p7L8@5^5Ev@CE!<{u-bZyZ= z*X?@hmp4X{LbzBf1$7$H=I6uw1)m(^rHniSjAdAld`X6kpM+$Fb5g}w3kFAI%97YF z-Z9e-AY*(&tjstXV|=tzJay;us8E@}E?J(TMh1s=%7O|&bunsx~71mQq`4CS&_kqLMp$Pg2N+FTVEE+OKK`}&1 zA|*-;m+TFys@BR=V_59#V8x=Xa~M5$RCJE0Ge1<~>Uy*`BG0vQMDiEYl4!!deZ1}= zglQ$*uY!JhE3F~^p`uY0%Aj-C6Ia%x`+gUrI^q+FaT*a6v{FKAdbTQfoLtaUOiCp% zBB1XwWnaVkZCMY!buF3~+eoWuG1k~tL`aO9GL)N)!M28a-tBaXZcc{EqKl#c8FDWbaFH9fp;?}S@C=s8JU6unGVr_S zNNmx|E5%XSPz}4Rb9EMjbW=J_=y~KITk}dtu$MyUk6bhTN|Ruf$fqhqhGfl&Z>cc` z5Xb={m5s+ZZMm(p0MvK_H=CVEqvo~UR-QbYC8 z6_ky}WbciBrW|sY;0=6JBL>AUh zMEd=2NLMGA;BXm7fDdWKVnmSiRSl|!B^@DmMN}5MS0nhv!bX%=#J3RX0YheDG-M^X zV3f1Y|8ui{d7fpNe?^6%dc9t&Il!xDwLH&qlV>K&0{9u@;MeWmtqKu<3wz3lV+K=Z zYQsb08#gR>*4Bz{Sr%^3y264DWkBvX@W8={Js_BqaHV*XRYDOY~!kaVVmZbukdlzo-1NTu+_ z*>wHdcwPk;F)z{7{-B7pdX7MT4GxTnHe}aoP+jQVr|ErBQ2<*Du#Ox*^a5R|D$0vL zyz8pUKg?HZy(9~DSW5P+cCkl`Br(k+djxPHXVY5eSG7C-S+ zJ87W+^Ki}l(#^v^am|n~`S;78e7fUH#$K;e>02c@A5` zmZnqVqOfI&Zr9BVnzFEE$!vAiCkKl)wjqd!95N6QlUvR~;)XDbBSZRsI_(g7nSo2p z6rvLZhh7Mi9ne`1=P6o&KsZ;=_)kM_*HG_b8i#bX+#{cdMU&;Z$+FB9ciYku;G9M^ zJrVMDMI|6aL|q>l-%nYV4Gj&AjgNQR9oz17+ifmNV+^z3k=7gjff*FZNi^vi3MU#s zd>y?vk}7s1oWs;~@U7H$l)9otXD&e{@f0hLiBy=_Yn&7b=aV1l)pa#lP(2k0jI7tR z9w!T6BMyxKyeRPgNB{aNl=lD+_5Pr!2fTC&JXf171Kk*7Y>+A$8>v>j0AwXR*B`2g zIGksS%&4?Qy%?bNxh_b2M1nW*6C_Wk+)`ntKAenXn5uS*l)7X?eZ6)+eXdirGqlFA zmsg@o+;P>G`ul%q!={l;&unevZ$6lR-=)KM-*e`Xlbt|PayS?eMpyfjZ`nEUA6`Gc zb39c0?1BwOyOt!}vZMYVUfb9?W}=eiI&vKz!M&XvJzZ&gW_JF{%^O>t?%y7MDp2bm z9S^41P>`-7fq%pT7<6+~xH>{-Mn~M~NNl-o2@?0j8L26-;u$K zSfVTKh&_Jy>2G8&87iAn1$im)>-U)f>jy1}$S^1)$^iyjs@2GrWSNSBtz~Obbh#){ z6l_btEoJlXWY9J+jQ33~WFof|MJr)ajt0Bf@qWdm57W57C8cob%}}RAB)i3}bSFJP z5pEHYi+g6qh!<$II0yoi&I?Q~>KEZ3BZ`PZz+Lzs1g+9p-i`(tlhtd(qoeJ$_S(t{ z1BL0bPpGvW6*3`Sr&ygNv%DtE3knBV@W{jv{suHg&qaYgeVHk?FAj=$kFgz-j zYLzf>sK7KD^>R5dx8noD?;*e9RN_Obb8cqLLPLZ_)n+483aiAb=;% zbgRCa+Igb!!b7FPMxEaO=8c<1Ov!lPL(MN9UCRx<^M=ve_Y4l^_~loRz4gPhDUyW> z180M#_89WJuN!~c)k6T*3beXBJwyPWoiBR_%kSOMc-xhO{YuJI|9S`Y>uYVfq)5E` z3tu0qjj4=jWHXHk;UL_<^MK%IQ zUU!2w2gq7ji*A>SE|mq9ZYwxn5m{DYW0{E2^cCh(0-63_Shqm{8DxGz0vVGTa#<|y zpJ11Vr;IF-E8`~bGL3j<64Ow8jDS+GFf$(HA~Q%OE37Zn`ArEZ#`ZQxT}&@DqW}OP z07*naRKt*Yq@Y4%ej=ze*bwA4^`W7mMq{wmvL?gY8VYM|$<`KJuD9L?hyeV_{fqiL&*-=B+TalJ zqla3*_PP1<-k*{QZXA*O2EgzB!{UE=py{sN`(pdipPL!2)1@102%`vLMvS7` zdXC0`aftZfiQ*Uke(@u3nF4Tnxm@W~V2&DtfVK)o$Ux^>Vmx6FBYVJ_Tfh5&xlZ<9;!KnT7|&lg(wJ%4qk z0BpJa^5 z^E@-mHR%2?xcAbA9eu<$&Z<-CX5CM+2pwOVatc%+<~8X6qx zwmV#u)>>=Jvh1+m&|4O-u$K)1Hw#<(K&Z8BWre5qo?B_6Go5O``TmPihm7}6$cL0= z>J4IXfecX&a{hR}e*1gFkpy65V)Tta`y*`a7yj~-H{5m0*!0B7qc7b5$uD2^JvZ*X z_VV`X>iwVi^8Cp&@ok%SZrykN6&tp19vB)bi(>B7xo5t0==d|wg*wL@Z~U3Ju(e-! z|9`*XuA9fEs&zi_i7(HcIO7CByb}Y;V8GUgBVvxZ5?8(cj>}*3Jpk_g%X^MLam1Y+ z+p_ufKmV@)Jpb*-9{BLbwfVKd!F?}(+4ie0ADNgK7#S`)-IayKmku9!@*DRRYn`~- z`taZt-*fBsD-P6$hnlmq-~RhAk4}!?^!;}MxcB3qI{x%gkaY>ed6pl%;bq(Q?Hw8! zZZ(@n9(nBfqetKT&bI?N{@nBTe&+AM4C@ElrfoBOuf2N1_L+g9;j-w?ojm=_Hy=9j z)YCwuA0z7<={ruP7(jGYWA}f)@?8U__O-bu;=b##8$>u_5efJZ?e}IRnBrGSMpC1; zzV{dDb(akN#hW()`0X#x|Ixh*ai{#oT^rtU!#IF{^VzfSe`ra__BBilXMgtQO|RTF z*e&_jzcBxo4>dhPtF@7|CBb9gE&{;U&G>liUp=;>OYPbvijo03)3OruBd3-lO!5XU zBdM8zeUsVZ8vo`$H19dIIysna93}uq=dJWf_}Dj*FShwNzrJ$M;nm5(Y~v6CIJ#it zGHG*=UZN_80TBK6UAOI&5W*0pov@bG_m<7)tXHdd_ zdGF-J@4WUFq{nZ)?pFPNbbjGiKKC^zINQd2eD$TJrQ7%Jyz{``nX!>pyZG|47e4a% z5%oN@&DU(*bjSW(mrPHN4c6DX#nIV?&p!R^!za$f`u$xmzxMXMI|2O6$3OSVUEA)s zWap-lk>yVJE5}~^=%J@rJ5YNs?lw`B5_>Fksn(rWBC2nIZM<1*aXmGrc?R zHU@wUR>l?R8_}(2(ZAfUz)CUF{^lA z6uKHwPL+a@T0(j4pPOZwp*TS7x|9t0g(M_!C_AjWTp<%|G>Q&G#$>UlxGp-z_}rM9 z0MJ@me%YO`YD|r1wS4q~o_{ikAD>kut^DBSgjmI86tp90KHd)6K8C}KFkuV-0z3@YFt_Hv z-@bQfV#oma)REPws)~6Hog9v)C5VBAHoy8WX3w=OK>Mb=N<8XgryQ{Z3vK)A_b;4V zwE*p#^nvK33uQm9M&BZ^RJwdXi2%Zu(a}mXPb@XVaFD(9T!gc*rCTG?=PAs;Rbmu8D_==6wZ@%(UceXy1 z{oob*YsP%=(I+73sUVIsBO;&k9p`YhwgJtK0p) z%lEzUvVE@bec_z;qt4Kp)Hwrbrvfhqde{f6!9=CZ@vgs4u}^yepfNoGU}U`U z)xY{omgjf=)SCem?an9v@B=S@(`$BKv2SoRjG`-Ux!xh-((K}~M~}2uS2t|iyyu$B zi0H~&Z#Z`7$#!cE0*WK!jjw*_@3K6*^C#~HP;@$<_`?spLh57{7;^5hfnkQ*G~Br8 zPsl1{0BCI72!O3^&CY38DN;7ioYlU&{!Mo|M11<*2TwlvRM9Pl$H%Vv-rGhdCnvUS z+H%RB6Hh)(05jk4&+c@H*lw*H|IU+?nO#?3x%1%V0GPQsJLl%-*xDQJxZNRQx6^s) z=(A;6Zrii_(yOm@k6fCcWA7&N<*&TSA>z{P{IN$LYp<+s*tT`gwO13-mABn`?6E_g z<(0l&!eMv^tQxP4>>u3*;8%})@c7!CocG=LmYG}r_3k$w7~b|9Pk-2lgq$s9$o5@O z=510AqqZ{C!lxgxCzkE}nw=ap2R77Vef{>ECWdMTz5&y3?4{=(lr(YpKKFo55A{p7EFeqnx%Z{I!eTi-hg;Ng>Hdndgq`Rqc8IOfCvaBQJeUL_^_AmaK5iRvN%RLimlkDqc^ z#s}-yZQTrwVJa>HAj~wpVfTgud;jXOCr&IbU$$xb4VUgE(3P7v?46!CHopjf*yG=7 zQOvKc32h#M032^FyOXO$@s;Oa0%Iu8UcP-RfZ3JR$IqNoTkKmeoz!*04wBcp#hv^2 zeDkGKvn#9DZQHzMWEjBrUb6eck00rl-e7slHJ3X??3Cq0FP&a$cdpnxy<@xq;BD7j z@wHoe9VvY*HuM~Hp38Gn zrZP1fFY0lrS4JxFF zLXv1)>Zv54>Q#j{x1){Qw9RKKN#B}iK)W6@J@jh<3o4|SFXkn~NvjHVK5ixR+dk3UUWw&$t?CNtApHk~;7 zLa6iP*|g4MAQXkKQ#YvhbQprm`{EklmV&w^bYcS$jZRMiSe~1=CHV!8z}V(Zu7ag= zvyN4Hy}sqreE`lp``ja+`a8|?UOIDbYWobF{|7K*Xl!)m()|Edmztk@@B7-V7KmnF zJaNOD?gFr~xX49mh%D2{cw^?0y#Q95%U}G^->j~zfbhid@Ed;oN8Qs~b8}RdY;ApL z=&~Dc05E_0?3e!Xp0el?@cg5P$Ygu2xzc22dS>g%r;f&5h-$1@MTy`y!~=i=W$H!} zfRCNL|J74h+_mZY72E#(W1oa;n2RDZ>!fMY{pvvy!d4JLr?}7LwkJ+^UbSm*|Ax9T zUZ``)$1T{+n--}C6|AKbgtwQ61qTSy<`aaWczx^%** zX#{}wO$pS^m6bk0U=D$>Z&H0qAG6gQmPFxH7%m@LvRf4Ix%XSH+M9Q6bD(&9sil6T zhyZOF^^046=d1TUJGVff2VOkU7^uH`_YMHt#u^S3^Nco)4g)y3)bgW-h!Fh36HCjk z(r+C<^{tmqGUJMk(+(6LK5^!cAABU~d=LnkF`Gt401Vb@zxTBV9zJmfz()=}`A2Vh z?NFW%1K<;#+Y}%?w0*i6B*I|>B)yqoB}Xh ztBnu%VEAu;<^B`RWdOyn?nIU$1o0tif*u_#cah2R0p}bayf@8C*p=}1Sib%A+2)(AYbR4}Hy&uWeAHpvvUjjoYN9%=*TeKGCJxgIUydQo49f@RR&JB zmQ|Qt(wK%@PcARVHi*)`b=0rj{LYzk4qs}SWcTHW;U~5XS58?(z&x%_@ zJ>RG*R$;fsDhHC!I7K`R^u!5^g*Tyy;@drrQMA4}NPl#jYq5=FDT3$7{)k&0aI>dJ zDJn)jaH#E2TR0wJ6}Z26Q1mToOgofX0@!(YWw%&qwjd7QvW&)wtv*nB-D_WY?H#Yw ziW~+2Se{=3K!NvBH8$u(3qYA(3)GYwsh=SU0hmSS{fP~YfMjl|F8VQ^4xrDZf@!H?CGP&PCk7! z*1gj^wz)6oo_`5|WAC8Y=FM|+e$X&BY@cx_&%XE)yLXck01ONb0qC|nYsl67>!wS+!FIfVJoXVy|i2`{#t+;=>{``Dl2tWPuaR5tge&2(Ov8HiKvoD#c@bRK;kxvg1a`xlf4PH(`>J z$!L!mTse51^8hd-8J;KoTwst3jh#MqZZ5uMYRE@lPA_}sG9c^nvd2RJAQw}eTU~8y zcB^R1nZ~d_H$>PXBDV>E9Xc~BcQSx6k6y*%THA@rUNL-+oYn9?2-K(#xbx>$R-Kon zp!m$}0)o$m$)N#P=Tf^vBtt{gpXQXx6dY7^0q?V@#piNx1a!jDJ0-^f1;bhov8241 z`n8AR^pVCkbeWQ$xB~ls0(9h`Ah_soQ0Kk?XnyEAlFsSz|y&MVjzPo-}k|f zy!@?qk4%meQDb_lF+H_q|0M@*dHLDrUi{ko|Eg&F?9;K00<@}h7^9O@{^Z$NST|u$ zjmZgjb@|*Z%F+!KljlROr7m{L47OuaQy1XU{30Srh>l1aIN8nY+l$Zq%wzBQm%Hye zFtV-3Tm*nYQ_sn)m7RsI^C84QjZC#Tj+%@SO232!PvJOx)`Q}u8}lz5#a#!6c2DL2 z-uJDAraEw5z>|AVEET`--_O1FlAZMo`=)DA$)qS({zi*M{{3slub-&{c<0CG?t8KA zr2So|IuHKKEmK40|Gasu7ZiJr{yIml(e8;1zza)d*UDgy{7AjqP$*g0=#3KP3%pA04d*d`fdCzqFe1^5V&SEZoH=ZKk{5ArBrMX22>^0|>AR$lyOA`0lHOqgY|86g!V7X^#~18f@`JlHIsohA4L%dw3<^|X0z zj*JWAGZE%qI{w+;|D)+0+b3o=k4#Q9Hf-3ue~-zsjk|YTddn*gfAJrDi#ARJSX*ut zosNd;8`C~fera~rn;VSb@o@lUSrnZv0O!VS+_BA#qUPMZTbKjp#?%ym*22Q4-}5Kl zjMebA<5B=BvGkOQy@KqSOHVAn@V_7W<0xCp?*T->!N$%%xcnVCnO}P91IO0Rkdc`U z-C80%t|~`85A@-pD3-&-^z>}ETXHR<1JiW?KlAc&04rVo(+3vUA=-~;0yW#b(y{d+ zv)ZY~jU)8!U&-iz`N1oO0X%xDd;be-O7~j9r<>)}keM8$!JO7oFGyYhE|x)PTnb+V z06WG_Jp+KFvqf0^r)mkl831;SQQZK*(K(qrAZ1x%z56rO(He|ul6k6`kPXyi&%;HIQ#qyuE3W4dtd#Iw*i>gyvc>r>O+IIfdK%kOHD}l zg~8)nHoIGz=VoOzuv_br<@x01%?qbaGmvH3!CP+jCFkbIYp2Zlj-9nm6beW`1*7^f zv3DHz1u&I+!W97#@A>xf^Dw!Xb28%}AC9C%1{1r+&vQhG;Qka$Pt6twH`Vq{)o$E2 zaNW!RfdBUGrTMim3bv2s@4Rswz~R%Kj~;Sq9mL?h(>1qt;_*|Ro@O#YMEr*R!2jy5V|~YXV|1Vn;90dSncdc@0QOH#K6>g57#W#2AM{h^$7OB4cDo_kJURm4Y-^=t z*Bq5gzgBR@&qwm9W=rL0X1u!a!;lYtF1Oq2R}iqRG1?fY12{InsJCw&_jR6LZfTHh zYmEJYjvm2JRlK@}r2Gs^#u0fblvLueFREF0UO|+J8dNJgmxFcOkV}5^D=LWD02w<+ z5ym+^fB_8YO9RL`%Kr7ekhw_x=Z0P41+Js$WyQPdlwcEx9V$y2`#@qv>)7ZqULwVI z(mWYQzkh1POW#q(8z35FQK%%;N?d2+75WtkiXgpMgM4m0#hC0j&dysbKiu zEQ=Hun$|KIGcw))(41Q!S--fv&~%9*P5##Ah+z@v0?jW0M8wIra8aB zAcumjg{HNZ3~8MZU(?rFZG>A!Mb_{6Lnb2-kueS?)hr#`vT=E73C7fh2lrfmH2_h-zlx#cHk0i!t%K}Dpf?7h#FH9wfca6Q8lpjl06%C zYyyr*o06tI*L8_=<7{KAP-GiHITgS4yuN(!?F8Kd_psCuOfzi78>6cFcII&dx{Zp;w z4g(m-&F{S4yZ9eDysYDc!mIl5?mH%b;$@=%e*RTsul}=B&(3uf_Dd=AvYGl|j&94ZUEL&wD@rMv3p_5_p)oG%+WCVUH=J&+0LU}* zqu2UXKo1>1t;IF<=FJB$-P#ygSY5k*X3MDLd7fNq2?f62#|H;9A^>Ye$!tk;Lv-?p z*kRSV)@rvb)sWg+NoOTkLSb!g%;wRN&5hC1%@%-~F+X~(U(NjB@l&e!6p6c5yluwT zQFR}eRY5v`%Q-b_$XgRi%w8vQG-dSx@N=n2|X1dj-h>z|@2m=@k zw;xRgGC)Si+}sM0VfPAQ5MV5bT(W8y&ji2rF*?Zs`^bgNtNG(1C8TD8;=fYMQLGuB zI}zWa8rd^eL^f=bml)KlIXqkRUeV0Dv#F>m7P4d@fV?fKFqe?QaK>yPPx~j1{D9p` zjG)I<$0aR_vGThNpH7GT($R@AlNq>~ypVw7tx>i-d;H9X?VIy@?Y19zfBM{^uRY}JoC@w{ROeFV(t1a1B@y}MnrzI%$leaEc;igx$0&o>rNpCOZe&S3Q2QgfuSMMGK@S#VS&$P<;hNsVUPA!*PMzfi*{Bu9K zQWj-Gt@Uj!FV@PDb8w!_}j8 z4_6x{?0Lh?mYw5c09xJ7fBn|u0BV`pFfs(-Ol#$*ZoKBIts7gN?p2#NI#_yPap|ki zzu;?R`pU8AzyH#`wJbA)TX$^-aC*7*_^GqE?Aiw4xXWve=veJ`9c{ZO$A0DZn-|vF z4u1aR!G~Q$c5-mgyRb{mco|;E=xH_~M#GV_b60NOkQ?(Gue9 z`NihF&mVWUOb-pzjRA17nXJk%3IY!rPe zi5}>xclJAR0ZzuXUIdX5jIRTVTrKAgiI>jncL2*#sIz%40N5j6y8pJfz9FyICbw*O z*_I7@{@jbFzVWfotI!GZ1=kS3^8BLy^jS82$<&NXb`#VFhF~m=ed>XS_uO#J;OIzR zukX1&Y!-9s=<|<#`97G804A&~Ex&N+$(>hTnh(^j|Gw|7)c^SBzC3&Ul)Nz*Pe1U` z!P{>Eu=T*ctq1l2_~yqxecv=?XrR*@W|)BblZ=;HLuquw{Cvf)&Ae|Gn#+|aIx{AXV=q0jvGiO&D_(b*Cv4G}R2qXVWU+m$!l_R&)=PUy|` zl`ekuON+mM=cFMV+*JGbuL(I>Cz|#he>;D+RZ^sJ9L+s-Mq39EX2!CAebW$nj_*6* zf$C#NI`A9jF7Eg1w3A&= zqn_57>dED0$a4039)03hUvu+do{!XOx9$m>+8keM{{Gh=EJcRGo;%GXH_ExB40cne zA^l$L9r#>qHym^hD``>WCLy*)LW-xWGO|eJh>V-O*)4? zUtMNYc#n)Uy0VqLSXk7PYzlykrUXc#NLPlkejRSO6jdRbOG{tKQ%rkH7DxodT5GKq zoeqQC&!xEq<;whtGoSy9zrEt->o)D$IxsxcURhl{JAdr4CtrH%Ikr|sMAu_L+|9Mt zYPa11`Acz@&H5w?zlg|WFx*~gf8mcmaPT!ZZ`rqJaCErnb{9^aJND=k&mVdc0Fis? zD46(xPkrI^b1&_^?qFkbygocsbc&V5rMZ`mKYib~=8vBgL?jTN`06)6wCB332S8EH|^OqFg)CDwHD8wJNEEnFCBT(zq}&qx#Ts)fdMLnnkgPJC$XRXYz4xK zqezTZw5oZ`v_1 zHDs3C_VLr*k37-(_!Fy^;a)fzh-3ozWV8J9Z!f>)s*#h;^51=NaitTC24|mt_|VF+ z`QoQMtCG1R$H`{-=MS&E<;tOxP5W=ZxYX*#`;^lD zsSAveXXXpnwEdIj0wov9cy5E@E>P=&!gpe9X*Bxk;)wWVrwnx6{p`xx?|to?Z@=!! zJyT=t!aj2H?B5(Za;DXSHy=Dx51l^yE1&zSf=Zsz_VH0TH!*k9=-SXnTjTx5DG;+|WCXzM%4$(sC6B~7qDWx9R!1U73AeSS8g~>F4agpl zD6K~44&<~%`UMRoKgvlc2_m|fpUV!cM#%fvzY_7&X7*L>X}kRQRQEghkX2(IDgCPX zupc-$8rhUI5SHYHijiRSFkJI!WMoD}C{I~3jN&n45ji>txlxJL=*sA1Z>4W}UE?L8 zpgMCe(Ca1UmbdliuCIvVyOQdwt?Wa=`Ho(Wr58CVdEv^9?9xDG30oFL30s0K2p~ho z04@jB#8z7n61K2~-~Yn;)KF-jI2(z`M-y2#-UlFSlzI}eD7LKj-*o+TcfJn5GY>xW z?azKeN)qDxLer#{F#f#WPXSCW`oh{Og7&XwNE!lVWNI$mRA%)3JMj!ctNP`XQ$KvUWfTN^z>Qmg4jGplYRQv;DBFW?)Iw-EOhqDzsJ-x@X3(EC4 z;N#U^)KHnd)|m}*+btm?DfsNwi5E(iTcp=GVLyfUYega!=6-(Q@&o_k>dOH9?$;i8 z_{7-|R`g`D?zkMak~DDmz5DmP^JP~9_|%bSKJdt4caJ7KR|PYnlvMpuWECN1sK{6> z>xv=k)vXp_uMP@FG;Dm>8R<%|5#>?gi<;YkGa?VlIp={B+!p7qN0`But>0uP)fv?$>7XG4 zHX+GgDIrgao{4zqDyb+74(8BzzoX6nl4HG5(06qD!N@S|n3=gHu?E(-1@iET&*WAn zxFM;tN|HuubXdrnW+G(rT3Xy8Yu#!{|L&(Mk`REs*Iz@%fMBw0di%_dgO>y7u62%l z{egaiyDtageKum<88+>31KjDYNc1RN@l9}|V&qMp`8&XM^q*X0!5eOty6-^ zjb@S<(i2g*hBOYO8{6noHvc@$BvTCxO8IRi;o0+xV?3#>#|SgNUc(WyVZV&lReJYT zm*qqN8N!ZD1r2@iX_K$k$=+_o|=RSoDmQ3