diff --git a/go.mod b/go.mod index cb5b587..c0c8e88 100644 --- a/go.mod +++ b/go.mod @@ -6,7 +6,7 @@ require ( github.com/alecthomas/kingpin v2.2.6+incompatible github.com/gorilla/handlers v1.5.1 github.com/gorilla/mux v1.8.0 - github.com/hashicorp/consul/api v1.21.0 + github.com/hashicorp/consul/api v1.25.1 github.com/maxbrunsfeld/counterfeiter/v6 v6.5.0 github.com/onsi/ginkgo v1.16.5 github.com/onsi/gomega v1.22.1 @@ -22,31 +22,32 @@ require ( require ( github.com/alecthomas/template v0.0.0-20190718012654-fb15b899a751 // indirect github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 // indirect - github.com/armon/go-metrics v0.3.10 // indirect + github.com/armon/go-metrics v0.4.1 // indirect github.com/beorn7/perks v1.0.1 // indirect github.com/cespare/xxhash/v2 v2.2.0 // indirect - github.com/fatih/color v1.9.0 // indirect + github.com/fatih/color v1.14.1 // indirect github.com/felixge/httpsnoop v1.0.2 // indirect github.com/fsnotify/fsnotify v1.4.9 // indirect github.com/golang/protobuf v1.5.3 // indirect github.com/google/go-cmp v0.5.9 // indirect - github.com/hashicorp/go-cleanhttp v0.5.1 // indirect - github.com/hashicorp/go-hclog v0.14.1 // indirect - github.com/hashicorp/go-immutable-radix v1.3.0 // indirect + github.com/hashicorp/go-cleanhttp v0.5.2 // indirect + github.com/hashicorp/go-hclog v1.5.0 // indirect + github.com/hashicorp/go-immutable-radix v1.3.1 // indirect github.com/hashicorp/go-rootcerts v1.0.2 // indirect github.com/hashicorp/golang-lru v0.5.4 // indirect github.com/hashicorp/serf v0.10.1 // indirect - github.com/mattn/go-colorable v0.1.6 // indirect - github.com/mattn/go-isatty v0.0.12 // indirect + github.com/mattn/go-colorable v0.1.13 // indirect + github.com/mattn/go-isatty v0.0.17 // indirect github.com/matttproud/golang_protobuf_extensions v1.0.4 // indirect github.com/mitchellh/go-homedir v1.1.0 // indirect - github.com/mitchellh/mapstructure v1.4.1 // indirect + github.com/mitchellh/mapstructure v1.5.0 // indirect github.com/nxadm/tail v1.4.8 // indirect github.com/prometheus/procfs v0.11.1 // indirect + golang.org/x/exp v0.0.0-20230321023759-10a507213a29 // indirect golang.org/x/mod v0.8.0 // indirect - golang.org/x/net v0.10.0 // indirect + golang.org/x/net v0.13.0 // indirect golang.org/x/sys v0.11.0 // indirect - golang.org/x/text v0.9.0 // indirect + golang.org/x/text v0.11.0 // indirect golang.org/x/tools v0.6.0 // indirect google.golang.org/protobuf v1.31.0 // indirect gopkg.in/tomb.v1 v1.0.0-20141024135613-dd632973f1e7 // indirect diff --git a/go.sum b/go.sum index 6aba3db..0f87ec3 100644 --- a/go.sum +++ b/go.sum @@ -49,8 +49,8 @@ github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 h1:s6gZFSlWYmbqAu github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137/go.mod h1:OMCwj8VM1Kc9e19TLln2VL61YJF0x1XFtfdL4JdbSyE= github.com/armon/circbuf v0.0.0-20150827004946-bbbad097214e/go.mod h1:3U/XgcO3hCbHZ8TKRvWD2dDTCfh9M9ya+I9JpbB7O8o= github.com/armon/go-metrics v0.0.0-20180917152333-f0300d1749da/go.mod h1:Q73ZrmVTwzkszR9V5SSuryQ31EELlFMUz1kKyl939pY= -github.com/armon/go-metrics v0.3.10 h1:FR+drcQStOe+32sYyJYyZ7FIdgoGGBnwLl+flodp8Uo= -github.com/armon/go-metrics v0.3.10/go.mod h1:4O98XIr/9W0sxpJ8UaYkvjk10Iff7SnFrb4QAOwNTFc= +github.com/armon/go-metrics v0.4.1 h1:hR91U9KYmb6bLBYLQjyM+3j+rcd/UhE+G78SFnF8gJA= +github.com/armon/go-metrics v0.4.1/go.mod h1:E6amYzXo6aW1tqzoZGT755KkbgrJsSdpwZ+3JqfkOG4= github.com/armon/go-radix v0.0.0-20180808171621-7fddfc383310/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= github.com/armon/go-radix v1.0.0/go.mod h1:ufUuZ+zHj4x4TnLV4JWEpy2hxWSpsRywHrMgIH9cCH8= github.com/beorn7/perks v0.0.0-20180321164747-3a771d992973/go.mod h1:Dwedo/Wpr24TaqPxmxbtue+5NUziq4I4S80YR8gNf3Q= @@ -72,15 +72,18 @@ github.com/client9/misspell v0.3.4/go.mod h1:qj6jICC3Q7zFZvVWo7KLAzC3yx5G7kyvSDk github.com/cncf/udpa/go v0.0.0-20191209042840-269d4d468f6f/go.mod h1:M8M6+tZqaGXZJjfX53e64911xZQV5JYwmTeXPW+k8Sc= github.com/creack/pty v1.1.9/go.mod h1:oKZEueFk5CKHvIhNR5MUki03XCEU+Q6VDXinZuGJ33E= github.com/davecgh/go-spew v1.1.0/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= -github.com/davecgh/go-spew v1.1.1 h1:vj9j/u1bqnvCEfJOwUhtlOARqs3+rkHYY13jYWTU97c= github.com/davecgh/go-spew v1.1.1/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc h1:U9qPSI2PIWSS1VwoXQT9A3Wy9MM3WgvqSxFWenqJduM= +github.com/davecgh/go-spew v1.1.2-0.20180830191138-d8f796af33cc/go.mod h1:J7Y8YcW2NihsgmVo/mv3lAwl/skON4iLHjSsI+c5H38= github.com/envoyproxy/go-control-plane v0.9.0/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4= github.com/envoyproxy/go-control-plane v0.9.1-0.20191026205805-5f8ba28d4473/go.mod h1:YTl/9mNaCwkRvm6d1a2C3ymFceY/DCBVvsKhRF0iEA4= github.com/envoyproxy/go-control-plane v0.9.4/go.mod h1:6rpuAdCZL397s3pYoYcLgu1mIlRU8Am5FuJP05cCM98= github.com/envoyproxy/protoc-gen-validate v0.1.0/go.mod h1:iSmxcyjqTsJpI2R4NaDN7+kN2VEUnK/pcBlmesArF7c= github.com/fatih/color v1.7.0/go.mod h1:Zm6kSWBoL9eyXnKyktHP6abPY2pDugNf5KwzbycvMj4= -github.com/fatih/color v1.9.0 h1:8xPHl4/q1VyqGIPif1F+1V3Y3lSmrq01EabUW3CoW5s= github.com/fatih/color v1.9.0/go.mod h1:eQcE1qtQxscV5RaZvpXrrb8Drkc3/DdQ+uUYCNjL+zU= +github.com/fatih/color v1.13.0/go.mod h1:kLAiJbzzSOZDVNGyDpeOxJ47H46qBXwg5ILebYFFOfk= +github.com/fatih/color v1.14.1 h1:qfhVLaG5s+nCROl1zJsZRxFeYrHLqWroPOQ8BWiNb4w= +github.com/fatih/color v1.14.1/go.mod h1:2oHN61fhTpgcxD3TSWCgKDiH1+x4OiDVVGH8WlgGZGg= github.com/felixge/httpsnoop v1.0.1/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= github.com/felixge/httpsnoop v1.0.2 h1:+nS9g82KMXccJ/wp0zyRW9ZBHFETmMGtkk+2CTTrW4o= github.com/felixge/httpsnoop v1.0.2/go.mod h1:m8KPJKqk1gH5J9DgRY2ASl2lWCfGKXixSwevea8zH2U= @@ -131,10 +134,10 @@ github.com/golang/protobuf v1.5.0/go.mod h1:FsONVRAS9T7sI+LIUmWTfcYkHO4aIWwzhcaS github.com/golang/protobuf v1.5.2/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= github.com/golang/protobuf v1.5.3 h1:KhyjKVUg7Usr/dYsdSqoFveMYd5ko72D+zANwlG1mmg= github.com/golang/protobuf v1.5.3/go.mod h1:XVQd3VNwM+JqD3oG2Ue2ip4fOMUkwXdXDdiuN0vRsmY= -github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c h1:964Od4U6p2jUkFxvCydnIczKteheJEzHRToSGK3Bnlw= github.com/google/btree v0.0.0-20180813153112-4030bb1f1f0c/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= -github.com/google/btree v1.0.0 h1:0udJVsspx3VBr5FwtLhQQtuAsVc79tTq0ocGIPAU6qo= github.com/google/btree v1.0.0/go.mod h1:lNA+9X1NB3Zf8V7Ke586lFgjr2dZNuvo3lPJSGZ5JPQ= +github.com/google/btree v1.0.1 h1:gK4Kx5IaGY9CD5sPJ36FHiBJ6ZXl0kilRiiCj+jdYp4= +github.com/google/btree v1.0.1/go.mod h1:xXMiIv4Fb/0kKde4SpL7qlzvu5cMJDRkFDxJfI9uaxA= github.com/google/go-cmp v0.2.0/go.mod h1:oXzfMopK8JAjlY9xF4vHSVASa0yLyX7SntLO5aqRK0M= github.com/google/go-cmp v0.3.0/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= github.com/google/go-cmp v0.3.1/go.mod h1:8QqcDgzrUqlUb/G2PQTWiueGozuR1884gddMywk6iLU= @@ -144,7 +147,6 @@ github.com/google/go-cmp v0.5.0/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/ github.com/google/go-cmp v0.5.1/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.4/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= github.com/google/go-cmp v0.5.5/go.mod h1:v8dTdLbMG2kIc/vJvl+f65V22dbkXbowE6jgT/gNBxE= -github.com/google/go-cmp v0.5.7/go.mod h1:n+brtR0CgQNWTVd5ZUFpTBC8YFBDLK/h/bpaJ8/DtOE= github.com/google/go-cmp v0.5.8/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= github.com/google/go-cmp v0.5.9 h1:O2Tfq5qg4qc4AmwVlvv0oLiVAGB7enBSJ2x2DqQFi38= github.com/google/go-cmp v0.5.9/go.mod h1:17dUlkBOakJ0+DkrSSNjCkIjxS6bF9zb3elmeNGIjoY= @@ -166,26 +168,28 @@ github.com/gorilla/handlers v1.5.1 h1:9lRY6j8DEeeBT10CvO9hGW0gmky0BprnvDI5vfhUHH github.com/gorilla/handlers v1.5.1/go.mod h1:t8XrUpc4KVXb7HGyJ4/cEnwQiaxrX/hz1Zv/4g96P1Q= github.com/gorilla/mux v1.8.0 h1:i40aqfkR1h2SlN9hojwV5ZA91wcXFOvkdNIeFDP5koI= github.com/gorilla/mux v1.8.0/go.mod h1:DVbg23sWSpFRCP0SfiEN6jmj59UnW/n46BH5rLB71So= -github.com/hashicorp/consul/api v1.21.0 h1:WMR2JiyuaQWRAMFaOGiYfY4Q4HRpyYRe/oYQofjyduM= -github.com/hashicorp/consul/api v1.21.0/go.mod h1:f8zVJwBcLdr1IQnfdfszjUM0xzp31Zl3bpws3pL9uFM= -github.com/hashicorp/consul/sdk v0.13.1 h1:EygWVWWMczTzXGpO93awkHFzfUka6hLYJ0qhETd+6lY= -github.com/hashicorp/consul/sdk v0.13.1/go.mod h1:SW/mM4LbKfqmMvcFu8v+eiQQ7oitXEFeiBe9StxERb0= -github.com/hashicorp/errwrap v1.0.0 h1:hLrqtEDnRye3+sgx6z4qVLNuviH3MR5aQ0ykNJa/UYA= +github.com/hashicorp/consul/api v1.25.1 h1:CqrdhYzc8XZuPnhIYZWH45toM0LB9ZeYr/gvpLVI3PE= +github.com/hashicorp/consul/api v1.25.1/go.mod h1:iiLVwR/htV7mas/sy0O+XSuEnrdBUUydemjxcUrAt4g= +github.com/hashicorp/consul/sdk v0.14.1 h1:ZiwE2bKb+zro68sWzZ1SgHF3kRMBZ94TwOCFRF4ylPs= +github.com/hashicorp/consul/sdk v0.14.1/go.mod h1:vFt03juSzocLRFo59NkeQHHmQa6+g7oU0pfzdI1mUhg= github.com/hashicorp/errwrap v1.0.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= +github.com/hashicorp/errwrap v1.1.0 h1:OxrOeh75EUXMY8TBjag2fzXGZ40LB6IKw45YeGUDY2I= +github.com/hashicorp/errwrap v1.1.0/go.mod h1:YH+1FKiLXxHSkmPseP+kNlulaMuP3n2brvKWEqk/Jc4= github.com/hashicorp/go-cleanhttp v0.5.0/go.mod h1:JpRdi6/HCYpAwUzNwuwqhbovhLtngrth3wmdIIUrZ80= -github.com/hashicorp/go-cleanhttp v0.5.1 h1:dH3aiDG9Jvb5r5+bYHsikaOUIpcM0xvgMXVoDkXMzJM= -github.com/hashicorp/go-cleanhttp v0.5.1/go.mod h1:JpRdi6/HCYpAwUzNwuwqhbovhLtngrth3wmdIIUrZ80= -github.com/hashicorp/go-hclog v0.12.0/go.mod h1:whpDNt7SSdeAju8AWKIWsul05p54N/39EeqMAyrmvFQ= -github.com/hashicorp/go-hclog v0.14.1 h1:nQcJDQwIAGnmoUWp8ubocEX40cCml/17YkF6csQLReU= -github.com/hashicorp/go-hclog v0.14.1/go.mod h1:whpDNt7SSdeAju8AWKIWsul05p54N/39EeqMAyrmvFQ= +github.com/hashicorp/go-cleanhttp v0.5.2 h1:035FKYIWjmULyFRBKPs8TBQoi0x6d9G4xc9neXJWAZQ= +github.com/hashicorp/go-cleanhttp v0.5.2/go.mod h1:kO/YDlP8L1346E6Sodw+PrpBSV4/SoxCXGY6BqNFT48= +github.com/hashicorp/go-hclog v1.5.0 h1:bI2ocEMgcVlz55Oj1xZNBsVi900c7II+fWDyV9o+13c= +github.com/hashicorp/go-hclog v1.5.0/go.mod h1:W4Qnvbt70Wk/zYJryRzDRU/4r0kIg0PVHBcfoyhpF5M= github.com/hashicorp/go-immutable-radix v1.0.0/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= -github.com/hashicorp/go-immutable-radix v1.3.0 h1:8exGP7ego3OmkfksihtSouGMZ+hQrhxx+FVELeXpVPE= -github.com/hashicorp/go-immutable-radix v1.3.0/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= -github.com/hashicorp/go-msgpack v0.5.3 h1:zKjpN5BK/P5lMYrLmBHdBULWbJ0XpYR+7NGzqkZzoD4= +github.com/hashicorp/go-immutable-radix v1.3.1 h1:DKHmCUm2hRBK510BaiZlwvpD40f8bJFeZnpfm2KLowc= +github.com/hashicorp/go-immutable-radix v1.3.1/go.mod h1:0y9vanUI8NX6FsYoO3zeMjhV/C5i9g4Q3DwcSNZ4P60= github.com/hashicorp/go-msgpack v0.5.3/go.mod h1:ahLV/dePpqEmjfWmKiqvPkv/twdG7iPBM1vqhUKIvfM= +github.com/hashicorp/go-msgpack v0.5.5 h1:i9R9JSrqIz0QVLz3sz+i3YJdT7TTSLcfLLzJi9aZTuI= +github.com/hashicorp/go-msgpack v0.5.5/go.mod h1:ahLV/dePpqEmjfWmKiqvPkv/twdG7iPBM1vqhUKIvfM= github.com/hashicorp/go-multierror v1.0.0/go.mod h1:dHtQlpGsu+cZNNAkkCN/P3hoUDHhCYQXV3UM06sGGrk= -github.com/hashicorp/go-multierror v1.1.0 h1:B9UzwGQJehnUY1yNrnwREHc3fGbC2xefo8g4TbElacI= github.com/hashicorp/go-multierror v1.1.0/go.mod h1:spPvp8C1qA32ftKqdAHm4hHTbPw+vmowP0z+KUhOZdA= +github.com/hashicorp/go-multierror v1.1.1 h1:H5DkEtf6CXdFp0N0Em5UCwQpXMWke8IA0+lD48awMYo= +github.com/hashicorp/go-multierror v1.1.1/go.mod h1:iw975J/qwKPdAO1clOe2L8331t/9/fmwbPZ6JB6eMoM= github.com/hashicorp/go-retryablehttp v0.5.3/go.mod h1:9B5zBasrRhHXnJnui7y6sL7es7NDiJgTc6Er0maI1Xs= github.com/hashicorp/go-rootcerts v1.0.2 h1:jzhAVGtqPKbwpyCPELlgNWhE1znq+qwJtW5Oi2viEzc= github.com/hashicorp/go-rootcerts v1.0.2/go.mod h1:pqUvnprVnM5bf7AOirdbb01K4ccR319Vf4pU3K5EGc8= @@ -195,8 +199,8 @@ github.com/hashicorp/go-sockaddr v1.0.2/go.mod h1:rB4wwRAUzs07qva3c5SdrY/NEtAUjG github.com/hashicorp/go-syslog v1.0.0/go.mod h1:qPfqrKkXGihmCqbJM2mZgkZGvKG1dFdvsLplgctolz4= github.com/hashicorp/go-uuid v1.0.0/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= github.com/hashicorp/go-uuid v1.0.1/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= -github.com/hashicorp/go-uuid v1.0.2 h1:cfejS+Tpcp13yd5nYHWDI6qVCny6wyX2Mt5SGur2IGE= -github.com/hashicorp/go-uuid v1.0.2/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= +github.com/hashicorp/go-uuid v1.0.3 h1:2gKiV6YVmrJ1i2CKKa9obLvRieoRGviZFL26PcT/Co8= +github.com/hashicorp/go-uuid v1.0.3/go.mod h1:6SBZvOh/SIDV7/2o3Jml5SYk/TvGqwFJ/bN7x4byOro= github.com/hashicorp/go-version v1.2.1 h1:zEfKbn2+PDgroKdiOzqiE8rsmLqU2uwi5PB5pBJ3TkI= github.com/hashicorp/go-version v1.2.1/go.mod h1:fltr4n8CU8Ke44wwGCBoEymUuxUHl09ZGVZPK5anwXA= github.com/hashicorp/golang-lru v0.5.0/go.mod h1:/m3WP610KZHVQ1SGc6re/UDhFvYD7pJ4Ao+sR/qLZy8= @@ -227,8 +231,8 @@ github.com/konsorten/go-windows-terminal-sequences v1.0.1/go.mod h1:T0+1ngSBFLxv github.com/konsorten/go-windows-terminal-sequences v1.0.3/go.mod h1:T0+1ngSBFLxvqU3pZ+m/2kptfBszLMUkC4ZK/EgS/cQ= github.com/kr/logfmt v0.0.0-20140226030751-b84e30acd515/go.mod h1:+0opPa2QZZtGFBFZlji/RkVcI2GknAs/DXo4wKdlNEc= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= -github.com/kr/pretty v0.2.0/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= github.com/kr/pretty v0.2.1/go.mod h1:ipq/a2n7PKx3OHsz4KJII5eveXtPO4qwEXGdVfWzfnI= +github.com/kr/pretty v0.3.0/go.mod h1:640gp4NfQd8pI5XOwp5fnNeVWj67G7CFk/SaSQn7NBk= github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= github.com/kr/pretty v0.3.1/go.mod h1:hoEshYVHaxMs3cyo3Yncou5ZscifuDolrwPKZanG3xk= github.com/kr/pty v1.1.1/go.mod h1:pFQYn66WHrOpPYNljwOMqo10TkYh1fy3cYio2l3bCsQ= @@ -237,14 +241,19 @@ github.com/kr/text v0.2.0 h1:5Nx0Ya0ZqY2ygV366QzturHI13Jq95ApcVaJBhpS+AY= github.com/kr/text v0.2.0/go.mod h1:eLer722TekiGuMkidMxC/pM04lWEeraHUUmBw8l2grE= github.com/mattn/go-colorable v0.0.9/go.mod h1:9vuHe8Xs5qXnSaW/c/ABM9alt+Vo+STaOChaDxuIBZU= github.com/mattn/go-colorable v0.1.4/go.mod h1:U0ppj6V5qS13XJ6of8GYAs25YV2eR4EVcfRqFIhoBtE= -github.com/mattn/go-colorable v0.1.6 h1:6Su7aK7lXmJ/U79bYtBjLNaha4Fs1Rg9plHpcH+vvnE= github.com/mattn/go-colorable v0.1.6/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= +github.com/mattn/go-colorable v0.1.9/go.mod h1:u6P/XSegPjTcexA+o6vUJrdnUu04hMope9wVRipJSqc= +github.com/mattn/go-colorable v0.1.12/go.mod h1:u5H1YNBxpqRaxsYJYSkiCWKzEfiAb1Gb520KVy5xxl4= +github.com/mattn/go-colorable v0.1.13 h1:fFA4WZxdEF4tXPZVKMLwD8oUnCTTo08duU7wxecdEvA= +github.com/mattn/go-colorable v0.1.13/go.mod h1:7S9/ev0klgBDR4GtXTXX8a3vIGJpMovkB8vQcUbaXHg= github.com/mattn/go-isatty v0.0.3/go.mod h1:M+lRXTBqGeGNdLjl/ufCoiOlB5xdOkqRJdNxMWT7Zi4= github.com/mattn/go-isatty v0.0.8/go.mod h1:Iq45c/XA43vh69/j3iqttzPXn0bhXyGjM0Hdxcsrc5s= -github.com/mattn/go-isatty v0.0.10/go.mod h1:qgIWMr58cqv1PHHyhnkY9lrL7etaEgOFcMEpPG5Rm84= github.com/mattn/go-isatty v0.0.11/go.mod h1:PhnuNfih5lzO57/f3n+odYbM4JtupLOxQOAqxQCu2WE= -github.com/mattn/go-isatty v0.0.12 h1:wuysRhFDzyxgEmMf5xjvJ2M9dZoWAXNNr5LSBS7uHXY= github.com/mattn/go-isatty v0.0.12/go.mod h1:cbi8OIDigv2wuxKPP5vlRcQ1OAZbq2CE4Kysco4FUpU= +github.com/mattn/go-isatty v0.0.14/go.mod h1:7GGIvUiUoEMVVmxf/4nioHXj79iQHKdU27kJ6hsGG94= +github.com/mattn/go-isatty v0.0.16/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= +github.com/mattn/go-isatty v0.0.17 h1:BTarxUcIeDqL27Mc+vyvdWYSL28zpIhv3RoTdsLMPng= +github.com/mattn/go-isatty v0.0.17/go.mod h1:kYGgaQfpe5nmfYZH+SKPsOc2e4SrIfOl2e/yFXSvRLM= github.com/matttproud/golang_protobuf_extensions v1.0.1/go.mod h1:D8He9yQNgCq6Z5Ld7szi9bcBfOoFv/3dc6xSMkL2PC0= github.com/matttproud/golang_protobuf_extensions v1.0.4 h1:mmDVorXM7PCGKw94cs5zkfA9PSy5pEvNWRP0ET0TIVo= github.com/matttproud/golang_protobuf_extensions v1.0.4/go.mod h1:BSXmuO+STAnVfrANrmjBb36TMTDstsz7MSK+HVaYKv4= @@ -259,8 +268,8 @@ github.com/mitchellh/go-homedir v1.1.0 h1:lukF9ziXFxDFPkA1vsr5zpc1XuPDn/wFntq5mG github.com/mitchellh/go-homedir v1.1.0/go.mod h1:SfyaCUpYCn1Vlf4IUYiD9fPX4A5wJrkLzIz1N1q0pr0= github.com/mitchellh/go-wordwrap v1.0.0/go.mod h1:ZXFpozHsX6DPmq2I0TCekCxypsnAUbP2oI0UX1GXzOo= github.com/mitchellh/mapstructure v0.0.0-20160808181253-ca63d7c062ee/go.mod h1:FVVH3fgwuzCH5S8UJGiWEs2h04kUh9fWfEaFds41c1Y= -github.com/mitchellh/mapstructure v1.4.1 h1:CpVNEelQCZBooIPDn+AR3NpivK/TIKU8bDxdASFVQag= -github.com/mitchellh/mapstructure v1.4.1/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= +github.com/mitchellh/mapstructure v1.5.0 h1:jeMsZIYE/09sWLaz43PL7Gy6RuMjD2eJVyuac5Z2hdY= +github.com/mitchellh/mapstructure v1.5.0/go.mod h1:bFUtVrKA4DC2yAKiSyO/QUcy7e+RRV2QTWOzhPopBRo= github.com/modern-go/concurrent v0.0.0-20180228061459-e0a39a4cb421/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/concurrent v0.0.0-20180306012644-bacd9c7ef1dd/go.mod h1:6dJC0mAP4ikYIbvyc7fijjWJddQyLn8Ig3JB5CqoB9Q= github.com/modern-go/reflect2 v0.0.0-20180701023420-4b7aa43c6742/go.mod h1:bx2lNnkwVCuqBIxFjflWJWanXIb3RllmbCylyMrvgv0= @@ -299,8 +308,9 @@ github.com/pkg/errors v0.8.0/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINE github.com/pkg/errors v0.8.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= github.com/pkg/errors v0.9.1 h1:FEBLx1zS214owpjy7qsBeixbURkuhQAwrK5UwLGTwt4= github.com/pkg/errors v0.9.1/go.mod h1:bwawxfHBFNV+L2hUp1rHADufV3IMtnDRdf1r5NINEl0= -github.com/pmezard/go-difflib v1.0.0 h1:4DBwDE0NGyQoBHbLQYPwSUPoCMWR5BEzIk/f1lZbAQM= github.com/pmezard/go-difflib v1.0.0/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2 h1:Jamvg5psRIccs7FGNTlIRMkT8wgtp5eCXdBlqhYGL6U= +github.com/pmezard/go-difflib v1.0.1-0.20181226105442-5d4384ee4fb2/go.mod h1:iKH77koFhYxTK1pcRnkKkqfTogsbg7gZNVY4sRDYZ/4= github.com/posener/complete v1.1.1/go.mod h1:em0nMJCgc9GFtwrmVmEMR/ZL6WyhyjMBndrE9hABlRI= github.com/posener/complete v1.2.3/go.mod h1:WZIdtGGp+qx0sLrYKtIRAruyNpv6hFCicSgv7Sy7s/s= github.com/prometheus/client_golang v0.9.1/go.mod h1:7SWBe2y4D6OKWSNQJUaRYU/AaXPKyh/dDVn+NZz0KFw= @@ -341,6 +351,7 @@ github.com/prometheus/procfs v0.9.0/go.mod h1:+pB4zwohETzFnmlpe6yd2lSc+0/46IYZRB github.com/prometheus/procfs v0.11.1 h1:xRC8Iq1yyca5ypa9n1EZnWZkt7dwcoRPQwX/5gwaUuI= github.com/prometheus/procfs v0.11.1/go.mod h1:eesXgaPo1q7lBpVMoMy0ZOFTth9hBn4W/y0/p/ScXhY= github.com/rogpeppe/go-internal v1.3.0/go.mod h1:M8bDsm7K2OlrFYOpmOWEs/qY81heoFRclV5y23lUDJ4= +github.com/rogpeppe/go-internal v1.6.1/go.mod h1:xXDCJY+GAPziupqXw64V24skbSoqbTEfhy4qGm1nDQc= github.com/rogpeppe/go-internal v1.9.0/go.mod h1:WtVeX8xhTBvf0smdhujwtBcq4Qrzq/fJaraNFVN+nFs= github.com/rogpeppe/go-internal v1.10.0 h1:TMyTOH3F/DB16zRVcYyreMH6GnZZrwQVAoYjRBZyWFQ= github.com/rogpeppe/go-internal v1.10.0/go.mod h1:UQnix2H7Ngw/k4C5ijL5+65zddjncjaFoBhdsK/akog= @@ -358,7 +369,6 @@ github.com/sirupsen/logrus v1.6.0/go.mod h1:7uNnSEd1DgxDLC74fIahvMZmmYsHGZGEOFrf github.com/sirupsen/logrus v1.9.3 h1:dueUQJ1C2q9oE3F7wvmSGAaVtTmUizReu6fjN8uqzbQ= github.com/sirupsen/logrus v1.9.3/go.mod h1:naHLuLoDiP4jHNo9R0sCBMtWGeIprob74mVsIT4qYEQ= github.com/stretchr/objx v0.1.0/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= -github.com/stretchr/objx v0.1.1 h1:2vfRuCMp5sSVIDSqO8oNnWJq7mPa6KVP3iPIwFBuy8A= github.com/stretchr/objx v0.1.1/go.mod h1:HFkY916IF+rwdDfMAkV7OtwuqBVzrE8GR6GFx+wExME= github.com/stretchr/objx v0.4.0/go.mod h1:YvHI0jy2hoMjB+UWwv71VJQ9isScKT/TqJzVSSt89Yw= github.com/stretchr/objx v0.5.0 h1:1zr/of2m5FGMsad5YfcqgdqdWrIhu+EBEJRhR1U7z/c= @@ -367,12 +377,13 @@ github.com/stretchr/testify v1.2.2/go.mod h1:a8OnRcib4nhh0OaRAV+Yts87kKdq0PP7pXf github.com/stretchr/testify v1.3.0/go.mod h1:M5WIy9Dh21IEIfnGCwXGc5bZfKNJtfHm1UVUgZn+9EI= github.com/stretchr/testify v1.4.0/go.mod h1:j7eGeouHqKxXV5pUuKE4zz7dFj8WfuZ+81PSLYec5m4= github.com/stretchr/testify v1.5.1/go.mod h1:5W2xD1RspED5o8YsWQXVCued0rvSQ+mT+I5cxcmMvtA= -github.com/stretchr/testify v1.7.0 h1:nwc3DEeHmmLAfoZucVR881uASk0Mfjw8xYJ99tb5CcY= github.com/stretchr/testify v1.7.0/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= github.com/stretchr/testify v1.7.1/go.mod h1:6Fq8oRcR53rry900zMqJjRRixrwX3KX962/h/Wwjteg= +github.com/stretchr/testify v1.7.2/go.mod h1:R6va5+xMeoiuVRoj+gSkQ7d3FALtqAAGI1FQKckRals= github.com/stretchr/testify v1.8.0/go.mod h1:yNjHg4UonilssWZ8iaSj1OCr/vHnekPRkoO+kdMU+MU= -github.com/stretchr/testify v1.8.2 h1:+h33VjcLVPDHtOdpUCuF+7gSuG3yGIftsP1YvFihtJ8= github.com/stretchr/testify v1.8.2/go.mod h1:w2LPCIKwWwSfY2zedu0+kehJoqGctiVI29o6fzry7u4= +github.com/stretchr/testify v1.8.3 h1:RP3t2pwF7cMEbC1dqtB6poj3niw/9gnV4Cjg5oW5gtY= +github.com/stretchr/testify v1.8.3/go.mod h1:sz/lmYIOXD/1dqDmKjjqLyZ2RngseejIcXlSw2iwfAo= github.com/tv42/httpunix v0.0.0-20150427012821-b75d8614f926/go.mod h1:9ESjWnEqriFuLhtthL60Sar/7RFoluCcXsuvEwTV5KM= github.com/xhit/go-str2duration v1.2.0/go.mod h1:3cPSlfZlUHVlneIVfePFWcJZsuwf+P1v2SRTV4cUmp4= github.com/xhit/go-str2duration/v2 v2.1.0/go.mod h1:ohY8p+0f07DiV6Em5LKB0s2YpLtXVyJfNt1+BlmyAsU= @@ -395,6 +406,8 @@ golang.org/x/crypto v0.0.0-20190923035154-9ee001bba392/go.mod h1:/lpIB1dKB+9EgE3 golang.org/x/crypto v0.0.0-20191011191535-87dc89f01550/go.mod h1:yigFU9vqHzYiE8UmvKecakEJjdnWj3jj499lnFckfCI= golang.org/x/crypto v0.0.0-20200622213623-75b288015ac9/go.mod h1:LzIPMQfyMNhhGPhUkYOs5KpL4U8rLKemX1yGLhDgUto= golang.org/x/crypto v0.0.0-20210921155107-089bfa567519/go.mod h1:GvvjBRRGRdwPK5ydBHafDWAxML/pGHZbMvKqRZ5+Abc= +golang.org/x/crypto v0.1.0/go.mod h1:RecgLatLF4+eUMCP1PoPZQb+cVrJcOPbHkTkbkB9sbw= +golang.org/x/crypto v0.11.0/go.mod h1:xgJhtzW8F9jGdVFWZESrid1U1bjeNy4zgy5cRr/CIio= golang.org/x/exp v0.0.0-20190121172915-509febef88a4/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190306152737-a1d7652674e8/go.mod h1:CJ0aWSM057203Lf6IL+f9T1iT9GByDxfZKAQTCR3kQA= golang.org/x/exp v0.0.0-20190510132918-efd6b22b2522/go.mod h1:ZjyILWgesfNpC6sMxTJOJm9Kp84zZh5NQWvqDGG3Qr8= @@ -405,6 +418,8 @@ golang.org/x/exp v0.0.0-20191227195350-da58074b4299/go.mod h1:2RIsYlXP63K8oxa1u0 golang.org/x/exp v0.0.0-20200119233911-0405dc783f0a/go.mod h1:2RIsYlXP63K8oxa1u096TMicItID8zy7Y6sNkU49FU4= golang.org/x/exp v0.0.0-20200207192155-f17229e696bd/go.mod h1:J/WKrq2StrnmMY6+EHIKF9dgMWnmCNThgcyBT1FY9mM= golang.org/x/exp v0.0.0-20200224162631-6cc2880d07d6/go.mod h1:3jZMyOhIsHpP37uCMkUooju7aAi5cS1Q23tOzKc+0MU= +golang.org/x/exp v0.0.0-20230321023759-10a507213a29 h1:ooxPy7fPvB4kwsA2h+iBNHkAbp/4JxTSwCmvdjEYmug= +golang.org/x/exp v0.0.0-20230321023759-10a507213a29/go.mod h1:CxIveKay+FTh1D0yPZemJVgC/95VzuuOLq5Qi4xnoYc= golang.org/x/image v0.0.0-20190227222117-0694c2d4d067/go.mod h1:kZ7UVZpmo3dzQBMxlp+ypCbDeSB+sBbTgSJuh5dn5js= golang.org/x/image v0.0.0-20190802002840-cff245a6509b/go.mod h1:FeLwcggjj3mMvU+oOTbSwawSJRM1uh48EjtB4UJZlP0= golang.org/x/lint v0.0.0-20181026193005-c67002cb31c3/go.mod h1:UVdnD1Gm6xHRNCYTkRU2/jEulfH38KcIWyp/GAMgvoE= @@ -427,6 +442,7 @@ golang.org/x/mod v0.2.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.3.0/go.mod h1:s0Qsj1ACt9ePp/hMypM3fl4fZqREWJwdYDEqhRiZZUA= golang.org/x/mod v0.6.0-dev.0.20220106191415-9b9b3d81d5e3/go.mod h1:3p9vT2HGsQu2K1YbXdKPJLVgG5VJdoTa1poYQBtP1AY= golang.org/x/mod v0.6.0-dev.0.20220419223038-86c51ed26bb4/go.mod h1:jJ57K6gSWd91VN4djpZkiMVwK6gcyfeH4XE8wZrZaV4= +golang.org/x/mod v0.6.0/go.mod h1:4mET923SAdbXp2ki8ey+zGs1SLqsuM2Y0uvdZR/fUNI= golang.org/x/mod v0.8.0 h1:LUYupSeNrTNCGzR/hVBk2NHZO4hXcVaW1k4Qx7rjPx8= golang.org/x/mod v0.8.0/go.mod h1:iBbtSCu2XBx23ZKBPSOrRkjjQPZFPuis4dIYUhu/chs= golang.org/x/net v0.0.0-20180724234803-3673e40ba225/go.mod h1:mL1N/T3taQHkDXs73rZJwtUhF3w3ftmwwsq0BUmARs4= @@ -466,15 +482,16 @@ golang.org/x/net v0.0.0-20210410081132-afb366fc7cd1/go.mod h1:9tjilg8BloeKEkVJvy golang.org/x/net v0.0.0-20210428140749-89ef3d95e781/go.mod h1:OJAsFXCWl8Ukc7SiCT/9KSuxbyM7479/AVlXFRxuMCk= golang.org/x/net v0.0.0-20210525063256-abc453219eb5/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20211015210444-4f30a5c0130f/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= -golang.org/x/net v0.0.0-20211216030914-fe4d6282115f/go.mod h1:9nx3DQGgdP8bBQD5qxJ1jj9UTztislL4KSBs9R2vV5Y= golang.org/x/net v0.0.0-20220127200216-cd36cc0744dd/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220225172249-27dd8689420f/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220425223048-2871e0cb64e4/go.mod h1:CfG3xpIq0wQ8r1q4Su4UZFWDARRcnwPjda9FqA0JpMk= golang.org/x/net v0.0.0-20220722155237-a158d28d115b/go.mod h1:XRhObCWvk6IyKnWLug+ECip1KBveYUHfp+8e9klMJ9c= +golang.org/x/net v0.1.0/go.mod h1:Cx3nUiGt4eDBEyega/BKRp+/AlGL8hYe7U9odMt2Cco= golang.org/x/net v0.6.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs= golang.org/x/net v0.7.0/go.mod h1:2Tu9+aMcznHK/AK1HMvgo6xiTLG5rD5rZLDS+rp2Bjs= -golang.org/x/net v0.10.0 h1:X2//UzNDwYmtCLn7To6G58Wr6f5ahEAQgKNzv9Y951M= golang.org/x/net v0.10.0/go.mod h1:0qNGK6F8kojg2nk9dLZ2mShWaEBan6FAoqfSigmmuDg= +golang.org/x/net v0.13.0 h1:Nvo8UFsZ8X3BhAC9699Z1j7XQ3rsZnUUm7jfBEk1ueY= +golang.org/x/net v0.13.0/go.mod h1:zEVYFnQC7m/vmpQFELhcD1EWkZlX69l4oqgmer6hfKA= golang.org/x/oauth2 v0.0.0-20180821212333-d2e6202438be/go.mod h1:N/0e6XlmueqKjAGxoOufVs8QHGRruUQn6yWY3a++T0U= golang.org/x/oauth2 v0.0.0-20190226205417-e64efc72b421/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= golang.org/x/oauth2 v0.0.0-20190604053449-0f29369cfe45/go.mod h1:gOpvHmFTYa4IltrdGE7lF6nIHvwfUNPOp7c8zoXwtLw= @@ -498,6 +515,7 @@ golang.org/x/sync v0.0.0-20210220032951-036812b2e83c/go.mod h1:RxMgew5VJxzue5/jJ golang.org/x/sync v0.0.0-20220601150217-0de741cfad7f/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.0.0-20220722155255-886fb9371eb4/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.1.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= +golang.org/x/sync v0.2.0/go.mod h1:RxMgew5VJxzue5/jJTE5uejpjVlOe/izrB70Jof72aM= golang.org/x/sync v0.3.0 h1:ftCYgMx6zT/asHUrPw8BLLscYtGznsLAnjq5RH9P66E= golang.org/x/sync v0.3.0/go.mod h1:FU7BRWz2tNW+3quACPkgCx/L+uEAv1htQ0V83Z9Rj+Y= golang.org/x/sys v0.0.0-20180823144017-11551d06cbcc/go.mod h1:STP8DvDyc/dI5b8T5hshtkjS+E42TnysNCUPdjciGhY= @@ -520,7 +538,6 @@ golang.org/x/sys v0.0.0-20190922100055-0a153f010e69/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20190924154521-2837fb4f24fe/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191001151750-bb3f8db39f24/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191005200804-aed5e4c7ecf9/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= -golang.org/x/sys v0.0.0-20191008105621-543471e840be/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191026070338-33540a1f6037/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191120155948-bd437916bb0e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20191204072324-ce4227a45e2e/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= @@ -551,28 +568,35 @@ golang.org/x/sys v0.0.0-20210330210617-4fbd30eecc44/go.mod h1:h1NjWce9XRLGQEsW7w golang.org/x/sys v0.0.0-20210423082822-04245dca01da/go.mod h1:h1NjWce9XRLGQEsW7wpKNCjG9DtNlClVuFLEZdDNbEs= golang.org/x/sys v0.0.0-20210603081109-ebe580a85c40/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20210615035016-665e8c7367d1/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20210630005230-0f9fa26af87c/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20210927094055-39ccf1dd6fa6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211019181941-9d821ace8654/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20211216021012-1d35b9e2eb4e/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220114195835-da31bd327af9/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220315194320-039c03cc5b86/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220319134239-a9b59b0215f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= -golang.org/x/sys v0.0.0-20220412211240-33da011f77ad/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220422013727-9388b58f7150/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220503163025-988cb79eb6c6/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220520151302-bc2c85ada10a/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220715151400-c0bba94af5f8/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220722155257-8c9f86f7a55f/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.0.0-20220728004956-3c1f35247d10/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.0.0-20220811171246-fbc7d0a398ab/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.1.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.3.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.5.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.6.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.8.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.9.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= +golang.org/x/sys v0.10.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/sys v0.11.0 h1:eG7RXZHdqOJ1i+0lgLgCpSXAp6M3LYlAo6osgSi0xOM= golang.org/x/sys v0.11.0/go.mod h1:oPkhp1MJrh7nUepCBck5+mAzfO9JrbApNNgaTdGDITg= golang.org/x/term v0.0.0-20201126162022-7de9c90e9dd1/go.mod h1:bj7SfCRtBDWHUb9snDiAeCFNEtKQo2Wmx5Cou7ajbmo= golang.org/x/term v0.0.0-20210927222741-03fcf44c2211/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= +golang.org/x/term v0.1.0/go.mod h1:jbD1KX2456YbFQfuXm/mYQcufACuNUgVhRMnK/tPxf8= golang.org/x/term v0.5.0/go.mod h1:jMB1sMXY+tzblOD4FWmEbocvup2/aLOaQEp7JmGp78k= golang.org/x/term v0.8.0/go.mod h1:xPskH00ivmX89bAKVGSKKtLOWNx2+17Eiy94tnKShWo= +golang.org/x/term v0.10.0/go.mod h1:lpqdcUyK/oCiQxvxVrppt5ggO2KCZ5QblwqPnfZ6d5o= golang.org/x/text v0.0.0-20170915032832-14c0d48ead0c/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.0/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= golang.org/x/text v0.3.1-0.20180807135948-17ff2d5776d2/go.mod h1:NqM8EUOU14njkJ3fqMW+pc6Ldnwhi/IjpwHt7yyuwOQ= @@ -580,9 +604,11 @@ golang.org/x/text v0.3.2/go.mod h1:bEr9sfX3Q8Zfm5fL9x+3itogRgK3+ptLWKqgva+5dAk= golang.org/x/text v0.3.3/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.6/go.mod h1:5Zoc/QRtKVWzQhOtBMvqHzDpF6irO9z98xDceosuGiQ= golang.org/x/text v0.3.7/go.mod h1:u+2+/6zg+i71rQMx5EYifcz6MCKuco9NR6JIITiCfzQ= +golang.org/x/text v0.4.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= golang.org/x/text v0.7.0/go.mod h1:mrYo+phRRbMaCq/xk9113O4dZlRixOauAjOtrjsXDZ8= -golang.org/x/text v0.9.0 h1:2sjJmO8cDvYveuX97RDLsxlyUxLl+GHoLxBiRdHllBE= golang.org/x/text v0.9.0/go.mod h1:e1OnstbJyHTd6l/uOt8jFFHp6TRDWZR/bV3emEE/zU8= +golang.org/x/text v0.11.0 h1:LAntKIrcmeSKERyiOh0XMV39LXS8IE9UL2yP7+f5ij4= +golang.org/x/text v0.11.0/go.mod h1:TvPlkZtksWOMsz7fbANvkp4WM8x/WCo/om8BMLbz+aE= golang.org/x/time v0.0.0-20181108054448-85acf8d2951c/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20190308202827-9d24e82272b4/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= golang.org/x/time v0.0.0-20191024005414-555d28b269f0/go.mod h1:tRJNPiyCQ0inRvYxbN9jk5I+vvW/OXSQhTDSoE431IQ= @@ -630,6 +656,7 @@ golang.org/x/tools v0.0.0-20200825202427-b303f430e36d/go.mod h1:njjCfa9FT2d7l9Bc golang.org/x/tools v0.0.0-20201224043029-2b0845dc783e/go.mod h1:emZCQorbCU4vsT4fOWvOPXz4eW1wZW4PmDk9uLelYpA= golang.org/x/tools v0.1.10/go.mod h1:Uh6Zz+xoGYZom868N8YTex3t7RhtHDBrE8Gzo9bV56E= golang.org/x/tools v0.1.12/go.mod h1:hNGJHUnrk76NpqgfD5Aqm5Crs+Hm0VOH/i9J2+nxYbc= +golang.org/x/tools v0.2.0/go.mod h1:y4OqIKeOV/fWJetJ8bXPU1sEVniLMIyDAZWeHdV+NTA= golang.org/x/tools v0.6.0 h1:BOw41kyTf3PuCW1pVQf8+Cyg8pMlkYB1oo9iJ6D/lKM= golang.org/x/tools v0.6.0/go.mod h1:Xwgl3UAJ/d3gWutnCtw505GrjyAbvKui8lOU390QaIU= golang.org/x/xerrors v0.0.0-20190717185122-a985d3407aa7/go.mod h1:I/5z698sn9Ka8TeJc9MKroUUfqBBauWjQqLJ2OPfmY0= @@ -731,7 +758,6 @@ gopkg.in/yaml.v2 v2.2.1/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.2/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.4/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.2.5/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= -gopkg.in/yaml.v2 v2.2.8/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.3.0/go.mod h1:hI93XBmqTisBFMUTm0b8Fm+jr3Dg1NNxqwp+5A1VGuI= gopkg.in/yaml.v2 v2.4.0 h1:D8xgwECY7CYvx+Y2n4sBz93Jn9JRvxdiyyo8CTfuKaY= gopkg.in/yaml.v2 v2.4.0/go.mod h1:RDklbk79AGWmwhnvt/jBztapEOGDOx6ZbXqjP6csGnQ= diff --git a/vendor/github.com/armon/go-metrics/metrics.go b/vendor/github.com/armon/go-metrics/metrics.go index 6753b13..36642a4 100644 --- a/vendor/github.com/armon/go-metrics/metrics.go +++ b/vendor/github.com/armon/go-metrics/metrics.go @@ -5,7 +5,7 @@ import ( "strings" "time" - "github.com/hashicorp/go-immutable-radix" + iradix "github.com/hashicorp/go-immutable-radix" ) type Label struct { @@ -172,6 +172,12 @@ func (m *Metrics) UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabe } } +func (m *Metrics) Shutdown() { + if ss, ok := m.sink.(ShutdownSink); ok { + ss.Shutdown() + } +} + // labelIsAllowed return true if a should be included in metric // the caller should lock m.filterLock while calling this method func (m *Metrics) labelIsAllowed(label *Label) bool { diff --git a/vendor/github.com/armon/go-metrics/sink.go b/vendor/github.com/armon/go-metrics/sink.go index 0b7d6e4..6f4108f 100644 --- a/vendor/github.com/armon/go-metrics/sink.go +++ b/vendor/github.com/armon/go-metrics/sink.go @@ -24,6 +24,15 @@ type MetricSink interface { AddSampleWithLabels(key []string, val float32, labels []Label) } +type ShutdownSink interface { + MetricSink + + // Shutdown the metric sink, flush metrics to storage, and cleanup resources. + // Called immediately prior to application exit. Implementations must block + // until metrics are flushed to storage. + Shutdown() +} + // BlackholeSink is used to just blackhole messages type BlackholeSink struct{} @@ -74,6 +83,14 @@ func (fh FanoutSink) AddSampleWithLabels(key []string, val float32, labels []Lab } } +func (fh FanoutSink) Shutdown() { + for _, s := range fh { + if ss, ok := s.(ShutdownSink); ok { + ss.Shutdown() + } + } +} + // sinkURLFactoryFunc is an generic interface around the *SinkFromURL() function provided // by each sink type type sinkURLFactoryFunc func(*url.URL) (MetricSink, error) diff --git a/vendor/github.com/armon/go-metrics/start.go b/vendor/github.com/armon/go-metrics/start.go index 6aa0bd3..38976f8 100644 --- a/vendor/github.com/armon/go-metrics/start.go +++ b/vendor/github.com/armon/go-metrics/start.go @@ -144,3 +144,15 @@ func UpdateFilter(allow, block []string) { func UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels []string) { globalMetrics.Load().(*Metrics).UpdateFilterAndLabels(allow, block, allowedLabels, blockedLabels) } + +// Shutdown disables metric collection, then blocks while attempting to flush metrics to storage. +// WARNING: Not all MetricSink backends support this functionality, and calling this will cause them to leak resources. +// This is intended for use immediately prior to application exit. +func Shutdown() { + m := globalMetrics.Load().(*Metrics) + // Swap whatever MetricSink is currently active with a BlackholeSink. Callers must not have a + // reason to expect that calls to the library will successfully collect metrics after Shutdown + // has been called. + globalMetrics.Store(&Metrics{sink: &BlackholeSink{}}) + m.Shutdown() +} diff --git a/vendor/github.com/fatih/color/README.md b/vendor/github.com/fatih/color/README.md index 42d9abc..be82827 100644 --- a/vendor/github.com/fatih/color/README.md +++ b/vendor/github.com/fatih/color/README.md @@ -1,21 +1,11 @@ -# Archived project. No maintenance. - -This project is not maintained anymore and is archived. Feel free to fork and -make your own changes if needed. For more detail read my blog post: [Taking an indefinite sabbatical from my projects](https://arslan.io/2018/10/09/taking-an-indefinite-sabbatical-from-my-projects/) - -Thanks to everyone for their valuable feedback and contributions. - - -# Color [![GoDoc](https://godoc.org/github.com/fatih/color?status.svg)](https://godoc.org/github.com/fatih/color) +# color [![](https://github.com/fatih/color/workflows/build/badge.svg)](https://github.com/fatih/color/actions) [![PkgGoDev](https://pkg.go.dev/badge/github.com/fatih/color)](https://pkg.go.dev/github.com/fatih/color) Color lets you use colorized outputs in terms of [ANSI Escape Codes](http://en.wikipedia.org/wiki/ANSI_escape_code#Colors) in Go (Golang). It has support for Windows too! The API can be used in several ways, pick one that suits you. - -![Color](https://i.imgur.com/c1JI0lA.png) - +![Color](https://user-images.githubusercontent.com/438920/96832689-03b3e000-13f4-11eb-9803-46f4c4de3406.jpg) ## Install @@ -87,7 +77,7 @@ notice("Don't forget this...") ### Custom fprint functions (FprintFunc) ```go -blue := color.New(FgBlue).FprintfFunc() +blue := color.New(color.FgBlue).FprintfFunc() blue(myWriter, "important notice: %s", stars) // Mix up with multiple attributes @@ -133,17 +123,19 @@ fmt.Println("All text will now be bold magenta.") ``` ### Disable/Enable color - + There might be a case where you want to explicitly disable/enable color output. the `go-isatty` package will automatically disable color output for non-tty output streams -(for example if the output were piped directly to `less`) +(for example if the output were piped directly to `less`). -`Color` has support to disable/enable colors both globally and for single color -definitions. For example suppose you have a CLI app and a `--no-color` bool flag. You -can easily disable the color output with: +The `color` package also disables color output if the [`NO_COLOR`](https://no-color.org) environment +variable is set to a non-empty string. -```go +`Color` has support to disable/enable colors programmatically both globally and +for single color definitions. For example suppose you have a CLI app and a +`-no-color` bool flag. You can easily disable the color output with: +```go var flagNoColor = flag.Bool("no-color", false, "Disable color output") if *flagNoColor { @@ -165,18 +157,20 @@ c.EnableColor() c.Println("This prints again cyan...") ``` +## GitHub Actions + +To output color in GitHub Actions (or other CI systems that support ANSI colors), make sure to set `color.NoColor = false` so that it bypasses the check for non-tty output streams. + ## Todo * Save/Return previous values * Evaluate fmt.Formatter interface - ## Credits - * [Fatih Arslan](https://github.com/fatih) - * Windows support via @mattn: [colorable](https://github.com/mattn/go-colorable) +* [Fatih Arslan](https://github.com/fatih) +* Windows support via @mattn: [colorable](https://github.com/mattn/go-colorable) ## License The MIT License (MIT) - see [`LICENSE.md`](https://github.com/fatih/color/blob/master/LICENSE.md) for more details - diff --git a/vendor/github.com/fatih/color/color.go b/vendor/github.com/fatih/color/color.go index 91c8e9f..889f9e7 100644 --- a/vendor/github.com/fatih/color/color.go +++ b/vendor/github.com/fatih/color/color.go @@ -15,12 +15,14 @@ import ( var ( // NoColor defines if the output is colorized or not. It's dynamically set to // false or true based on the stdout's file descriptor referring to a terminal - // or not. This is a global option and affects all colors. For more control - // over each color block use the methods DisableColor() individually. - NoColor = os.Getenv("TERM") == "dumb" || + // or not. It's also set to true if the NO_COLOR environment variable is + // set (regardless of its value). This is a global option and affects all + // colors. For more control over each color block use the methods + // DisableColor() individually. + NoColor = noColorIsSet() || os.Getenv("TERM") == "dumb" || (!isatty.IsTerminal(os.Stdout.Fd()) && !isatty.IsCygwinTerminal(os.Stdout.Fd())) - // Output defines the standard output of the print functions. By default + // Output defines the standard output of the print functions. By default, // os.Stdout is used. Output = colorable.NewColorableStdout() @@ -33,6 +35,11 @@ var ( colorsCacheMu sync.Mutex // protects colorsCache ) +// noColorIsSet returns true if the environment variable NO_COLOR is set to a non-empty string. +func noColorIsSet() bool { + return os.Getenv("NO_COLOR") != "" +} + // Color defines a custom color object which is defined by SGR parameters. type Color struct { params []Attribute @@ -108,7 +115,14 @@ const ( // New returns a newly created color object. func New(value ...Attribute) *Color { - c := &Color{params: make([]Attribute, 0)} + c := &Color{ + params: make([]Attribute, 0), + } + + if noColorIsSet() { + c.noColor = boolPtr(true) + } + c.Add(value...) return c } @@ -137,7 +151,7 @@ func (c *Color) Set() *Color { return c } - fmt.Fprintf(Output, c.format()) + fmt.Fprint(Output, c.format()) return c } @@ -149,16 +163,21 @@ func (c *Color) unset() { Unset() } -func (c *Color) setWriter(w io.Writer) *Color { +// SetWriter is used to set the SGR sequence with the given io.Writer. This is +// a low-level function, and users should use the higher-level functions, such +// as color.Fprint, color.Print, etc. +func (c *Color) SetWriter(w io.Writer) *Color { if c.isNoColorSet() { return c } - fmt.Fprintf(w, c.format()) + fmt.Fprint(w, c.format()) return c } -func (c *Color) unsetWriter(w io.Writer) { +// UnsetWriter resets all escape attributes and clears the output with the give +// io.Writer. Usually should be called after SetWriter(). +func (c *Color) UnsetWriter(w io.Writer) { if c.isNoColorSet() { return } @@ -177,20 +196,14 @@ func (c *Color) Add(value ...Attribute) *Color { return c } -func (c *Color) prepend(value Attribute) { - c.params = append(c.params, 0) - copy(c.params[1:], c.params[0:]) - c.params[0] = value -} - // Fprint formats using the default formats for its operands and writes to w. // Spaces are added between operands when neither is a string. // It returns the number of bytes written and any write error encountered. // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprint(w io.Writer, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprint(w, a...) } @@ -212,8 +225,8 @@ func (c *Color) Print(a ...interface{}) (n int, err error) { // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprintf(w io.Writer, format string, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprintf(w, format, a...) } @@ -233,8 +246,8 @@ func (c *Color) Printf(format string, a ...interface{}) (n int, err error) { // On Windows, users should wrap w with colorable.NewColorable() if w is of // type *os.File. func (c *Color) Fprintln(w io.Writer, a ...interface{}) (n int, err error) { - c.setWriter(w) - defer c.unsetWriter(w) + c.SetWriter(w) + defer c.UnsetWriter(w) return fmt.Fprintln(w, a...) } @@ -381,13 +394,13 @@ func (c *Color) DisableColor() { } // EnableColor enables the color output. Use it in conjunction with -// DisableColor(). Otherwise this method has no side effects. +// DisableColor(). Otherwise, this method has no side effects. func (c *Color) EnableColor() { c.noColor = boolPtr(false) } func (c *Color) isNoColorSet() bool { - // check first if we have user setted action + // check first if we have user set action if c.noColor != nil { return *c.noColor } diff --git a/vendor/github.com/fatih/color/doc.go b/vendor/github.com/fatih/color/doc.go index cf1e965..9491ad5 100644 --- a/vendor/github.com/fatih/color/doc.go +++ b/vendor/github.com/fatih/color/doc.go @@ -5,106 +5,105 @@ that suits you. Use simple and default helper functions with predefined foreground colors: - color.Cyan("Prints text in cyan.") + color.Cyan("Prints text in cyan.") - // a newline will be appended automatically - color.Blue("Prints %s in blue.", "text") + // a newline will be appended automatically + color.Blue("Prints %s in blue.", "text") - // More default foreground colors.. - color.Red("We have red") - color.Yellow("Yellow color too!") - color.Magenta("And many others ..") + // More default foreground colors.. + color.Red("We have red") + color.Yellow("Yellow color too!") + color.Magenta("And many others ..") - // Hi-intensity colors - color.HiGreen("Bright green color.") - color.HiBlack("Bright black means gray..") - color.HiWhite("Shiny white color!") + // Hi-intensity colors + color.HiGreen("Bright green color.") + color.HiBlack("Bright black means gray..") + color.HiWhite("Shiny white color!") -However there are times where custom color mixes are required. Below are some +However, there are times when custom color mixes are required. Below are some examples to create custom color objects and use the print functions of each separate color object. - // Create a new color object - c := color.New(color.FgCyan).Add(color.Underline) - c.Println("Prints cyan text with an underline.") + // Create a new color object + c := color.New(color.FgCyan).Add(color.Underline) + c.Println("Prints cyan text with an underline.") - // Or just add them to New() - d := color.New(color.FgCyan, color.Bold) - d.Printf("This prints bold cyan %s\n", "too!.") + // Or just add them to New() + d := color.New(color.FgCyan, color.Bold) + d.Printf("This prints bold cyan %s\n", "too!.") - // Mix up foreground and background colors, create new mixes! - red := color.New(color.FgRed) + // Mix up foreground and background colors, create new mixes! + red := color.New(color.FgRed) - boldRed := red.Add(color.Bold) - boldRed.Println("This will print text in bold red.") + boldRed := red.Add(color.Bold) + boldRed.Println("This will print text in bold red.") - whiteBackground := red.Add(color.BgWhite) - whiteBackground.Println("Red text with White background.") + whiteBackground := red.Add(color.BgWhite) + whiteBackground.Println("Red text with White background.") - // Use your own io.Writer output - color.New(color.FgBlue).Fprintln(myWriter, "blue color!") + // Use your own io.Writer output + color.New(color.FgBlue).Fprintln(myWriter, "blue color!") - blue := color.New(color.FgBlue) - blue.Fprint(myWriter, "This will print text in blue.") + blue := color.New(color.FgBlue) + blue.Fprint(myWriter, "This will print text in blue.") You can create PrintXxx functions to simplify even more: - // Create a custom print function for convenient - red := color.New(color.FgRed).PrintfFunc() - red("warning") - red("error: %s", err) + // Create a custom print function for convenient + red := color.New(color.FgRed).PrintfFunc() + red("warning") + red("error: %s", err) - // Mix up multiple attributes - notice := color.New(color.Bold, color.FgGreen).PrintlnFunc() - notice("don't forget this...") + // Mix up multiple attributes + notice := color.New(color.Bold, color.FgGreen).PrintlnFunc() + notice("don't forget this...") You can also FprintXxx functions to pass your own io.Writer: - blue := color.New(FgBlue).FprintfFunc() - blue(myWriter, "important notice: %s", stars) - - // Mix up with multiple attributes - success := color.New(color.Bold, color.FgGreen).FprintlnFunc() - success(myWriter, don't forget this...") + blue := color.New(FgBlue).FprintfFunc() + blue(myWriter, "important notice: %s", stars) + // Mix up with multiple attributes + success := color.New(color.Bold, color.FgGreen).FprintlnFunc() + success(myWriter, don't forget this...") Or create SprintXxx functions to mix strings with other non-colorized strings: - yellow := New(FgYellow).SprintFunc() - red := New(FgRed).SprintFunc() + yellow := New(FgYellow).SprintFunc() + red := New(FgRed).SprintFunc() - fmt.Printf("this is a %s and this is %s.\n", yellow("warning"), red("error")) + fmt.Printf("this is a %s and this is %s.\n", yellow("warning"), red("error")) - info := New(FgWhite, BgGreen).SprintFunc() - fmt.Printf("this %s rocks!\n", info("package")) + info := New(FgWhite, BgGreen).SprintFunc() + fmt.Printf("this %s rocks!\n", info("package")) Windows support is enabled by default. All Print functions work as intended. -However only for color.SprintXXX functions, user should use fmt.FprintXXX and +However, only for color.SprintXXX functions, user should use fmt.FprintXXX and set the output to color.Output: - fmt.Fprintf(color.Output, "Windows support: %s", color.GreenString("PASS")) + fmt.Fprintf(color.Output, "Windows support: %s", color.GreenString("PASS")) - info := New(FgWhite, BgGreen).SprintFunc() - fmt.Fprintf(color.Output, "this %s rocks!\n", info("package")) + info := New(FgWhite, BgGreen).SprintFunc() + fmt.Fprintf(color.Output, "this %s rocks!\n", info("package")) Using with existing code is possible. Just use the Set() method to set the standard output to the given parameters. That way a rewrite of an existing code is not required. - // Use handy standard colors. - color.Set(color.FgYellow) + // Use handy standard colors. + color.Set(color.FgYellow) - fmt.Println("Existing text will be now in Yellow") - fmt.Printf("This one %s\n", "too") + fmt.Println("Existing text will be now in Yellow") + fmt.Printf("This one %s\n", "too") - color.Unset() // don't forget to unset + color.Unset() // don't forget to unset - // You can mix up parameters - color.Set(color.FgMagenta, color.Bold) - defer color.Unset() // use it in your function + // You can mix up parameters + color.Set(color.FgMagenta, color.Bold) + defer color.Unset() // use it in your function - fmt.Println("All text will be now bold magenta.") + fmt.Println("All text will be now bold magenta.") There might be a case where you want to disable color output (for example to pipe the standard output of your app to somewhere else). `Color` has support to @@ -112,22 +111,24 @@ disable colors both globally and for single color definition. For example suppose you have a CLI app and a `--no-color` bool flag. You can easily disable the color output with: - var flagNoColor = flag.Bool("no-color", false, "Disable color output") + var flagNoColor = flag.Bool("no-color", false, "Disable color output") + + if *flagNoColor { + color.NoColor = true // disables colorized output + } - if *flagNoColor { - color.NoColor = true // disables colorized output - } +You can also disable the color by setting the NO_COLOR environment variable to any value. It also has support for single color definitions (local). You can disable/enable color output on the fly: - c := color.New(color.FgCyan) - c.Println("Prints cyan text") + c := color.New(color.FgCyan) + c.Println("Prints cyan text") - c.DisableColor() - c.Println("This is printed without any color") + c.DisableColor() + c.Println("This is printed without any color") - c.EnableColor() - c.Println("This prints again cyan...") + c.EnableColor() + c.Println("This prints again cyan...") */ package color diff --git a/vendor/github.com/hashicorp/consul/api/acl.go b/vendor/github.com/hashicorp/consul/api/acl.go index 3e13ccc..48d2e66 100644 --- a/vendor/github.com/hashicorp/consul/api/acl.go +++ b/vendor/github.com/hashicorp/consul/api/acl.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -269,6 +272,13 @@ type ACLAuthMethod struct { Partition string `json:",omitempty"` } +type ACLTokenFilterOptions struct { + AuthMethod string `json:",omitempty"` + Policy string `json:",omitempty"` + Role string `json:",omitempty"` + ServiceName string `json:",omitempty"` +} + func (m *ACLAuthMethod) MarshalJSON() ([]byte, error) { type Alias ACLAuthMethod exported := &struct { @@ -892,6 +902,44 @@ func (a *ACL) TokenList(q *QueryOptions) ([]*ACLTokenListEntry, *QueryMeta, erro return entries, qm, nil } +// TokenListFiltered lists all tokens that match the given filter options. +// The listing does not contain any SecretIDs as those may only be retrieved by a call to TokenRead. +func (a *ACL) TokenListFiltered(t ACLTokenFilterOptions, q *QueryOptions) ([]*ACLTokenListEntry, *QueryMeta, error) { + r := a.c.newRequest("GET", "/v1/acl/tokens") + r.setQueryOptions(q) + + if t.AuthMethod != "" { + r.params.Set("authmethod", t.AuthMethod) + } + if t.Policy != "" { + r.params.Set("policy", t.Policy) + } + if t.Role != "" { + r.params.Set("role", t.Role) + } + if t.ServiceName != "" { + r.params.Set("servicename", t.ServiceName) + } + + rtt, resp, err := a.c.doRequest(r) + if err != nil { + return nil, nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, nil, err + } + qm := &QueryMeta{} + parseQueryMeta(resp, qm) + qm.RequestTime = rtt + + var entries []*ACLTokenListEntry + if err := decodeBody(resp, &entries); err != nil { + return nil, nil, err + } + return entries, qm, nil +} + // PolicyCreate will create a new policy. It is not allowed for the policy parameters // ID field to be set as this will be generated by Consul while processing the request. func (a *ACL) PolicyCreate(policy *ACLPolicy, q *WriteOptions) (*ACLPolicy, *WriteMeta, error) { diff --git a/vendor/github.com/hashicorp/consul/api/agent.go b/vendor/github.com/hashicorp/consul/api/agent.go index 7904e7b..6775edf 100644 --- a/vendor/github.com/hashicorp/consul/api/agent.go +++ b/vendor/github.com/hashicorp/consul/api/agent.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -104,7 +107,8 @@ type AgentService struct { Namespace string `json:",omitempty" bexpr:"-" hash:"ignore"` Partition string `json:",omitempty" bexpr:"-" hash:"ignore"` // Datacenter is only ever returned and is ignored if presented. - Datacenter string `json:",omitempty" bexpr:"-" hash:"ignore"` + Datacenter string `json:",omitempty" bexpr:"-" hash:"ignore"` + Locality *Locality `json:",omitempty" bexpr:"-" hash:"ignore"` } // AgentServiceChecksInfo returns information about a Service and its checks @@ -270,6 +274,8 @@ type MembersOpts struct { // Segment is the LAN segment to show members for. Setting this to the // AllSegments value above will show members in all segments. Segment string + + Filter string } // AgentServiceRegistration is used to register a new service @@ -291,6 +297,7 @@ type AgentServiceRegistration struct { Connect *AgentServiceConnect `json:",omitempty"` Namespace string `json:",omitempty" bexpr:"-" hash:"ignore"` Partition string `json:",omitempty" bexpr:"-" hash:"ignore"` + Locality *Locality `json:",omitempty" bexpr:"-" hash:"ignore"` } // ServiceRegisterOpts is used to pass extra options to the service register. @@ -338,6 +345,7 @@ type AgentServiceCheck struct { Method string `json:",omitempty"` Body string `json:",omitempty"` TCP string `json:",omitempty"` + TCPUseTLS bool `json:",omitempty"` UDP string `json:",omitempty"` Status string `json:",omitempty"` Notes string `json:",omitempty"` @@ -498,6 +506,24 @@ func (a *Agent) Host() (map[string]interface{}, error) { return out, nil } +// Version is used to retrieve information about the running Consul version and build. +func (a *Agent) Version() (map[string]interface{}, error) { + r := a.c.newRequest("GET", "/v1/agent/version") + _, resp, err := a.c.doRequest(r) + if err != nil { + return nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, err + } + var out map[string]interface{} + if err := decodeBody(resp, &out); err != nil { + return nil, err + } + return out, nil +} + // Metrics is used to query the agent we are speaking to for // its current internal metric data func (a *Agent) Metrics() (*MetricsInfo, error) { @@ -767,6 +793,10 @@ func (a *Agent) MembersOpts(opts MembersOpts) ([]*AgentMember, error) { r.params.Set("wan", "1") } + if opts.Filter != "" { + r.params.Set("filter", opts.Filter) + } + _, resp, err := a.c.doRequest(r) if err != nil { return nil, err @@ -1050,8 +1080,17 @@ func (a *Agent) ForceLeavePrune(node string) error { // ForceLeaveOpts is used to have the agent eject a failed node or remove it // completely from the list of members. +// +// DEPRECATED - Use ForceLeaveOptions instead. func (a *Agent) ForceLeaveOpts(node string, opts ForceLeaveOpts) error { + return a.ForceLeaveOptions(node, opts, nil) +} + +// ForceLeaveOptions is used to have the agent eject a failed node or remove it +// completely from the list of members. Allows usage of QueryOptions on-top of ForceLeaveOpts +func (a *Agent) ForceLeaveOptions(node string, opts ForceLeaveOpts, q *QueryOptions) error { r := a.c.newRequest("PUT", "/v1/agent/force-leave/"+node) + r.setQueryOptions(q) if opts.Prune { r.params.Set("prune", "1") } diff --git a/vendor/github.com/hashicorp/consul/api/api.go b/vendor/github.com/hashicorp/consul/api/api.go index 772f869..f62c0c5 100644 --- a/vendor/github.com/hashicorp/consul/api/api.go +++ b/vendor/github.com/hashicorp/consul/api/api.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -833,12 +836,21 @@ func (r *request) setQueryOptions(q *QueryOptions) { return } if q.Namespace != "" { + // For backwards-compatibility with existing tests, + // use the short-hand query param name "ns" + // rather than the alternative long-hand "namespace" r.params.Set("ns", q.Namespace) } if q.Partition != "" { + // For backwards-compatibility with existing tests, + // use the long-hand query param name "partition" + // rather than the alternative short-hand "ap" r.params.Set("partition", q.Partition) } if q.Datacenter != "" { + // For backwards-compatibility with existing tests, + // use the short-hand query param name "dc" + // rather than the alternative long-hand "datacenter" r.params.Set("dc", q.Datacenter) } if q.Peer != "" { @@ -946,12 +958,16 @@ func (r *request) setWriteOptions(q *WriteOptions) { if q == nil { return } + // For backwards-compatibility, continue to use the shorthand "ns" + // rather than "namespace" if q.Namespace != "" { r.params.Set("ns", q.Namespace) } if q.Partition != "" { r.params.Set("partition", q.Partition) } + // For backwards-compatibility, continue to use the shorthand "dc" + // rather than "datacenter" if q.Datacenter != "" { r.params.Set("dc", q.Datacenter) } @@ -984,6 +1000,19 @@ func (r *request) toHTTP() (*http.Request, error) { return nil, err } + // validate that socket communications that do not use the host, detect + // slashes in the host name and replace it with local host. + // this is required since go started validating req.host in 1.20.6 and 1.19.11. + // prior to that they would strip out the slashes for you. They removed that + // behavior and added more strict validation as part of a CVE. + // This issue is being tracked by the Go team: + // https://github.com/golang/go/issues/61431 + // If there is a resolution in this issue, we will remove this code. + // In the time being, this is the accepted workaround. + if strings.HasPrefix(r.url.Host, "/") { + r.url.Host = "localhost" + } + req.URL.Host = r.url.Host req.URL.Scheme = r.url.Scheme req.Host = r.url.Host diff --git a/vendor/github.com/hashicorp/consul/api/catalog.go b/vendor/github.com/hashicorp/consul/api/catalog.go index 84a2bdb..0040ca6 100644 --- a/vendor/github.com/hashicorp/consul/api/catalog.go +++ b/vendor/github.com/hashicorp/consul/api/catalog.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -19,8 +22,9 @@ type Node struct { Meta map[string]string CreateIndex uint64 ModifyIndex uint64 - Partition string `json:",omitempty"` - PeerName string `json:",omitempty"` + Partition string `json:",omitempty"` + PeerName string `json:",omitempty"` + Locality *Locality `json:",omitempty"` } type ServiceAddress struct { @@ -45,6 +49,7 @@ type CatalogService struct { ServiceWeights Weights ServiceEnableTagOverride bool ServiceProxy *AgentServiceConnectProxyConfig + ServiceLocality *Locality `json:",omitempty"` CreateIndex uint64 Checks HealthChecks ModifyIndex uint64 @@ -73,7 +78,8 @@ type CatalogRegistration struct { Check *AgentCheck Checks HealthChecks SkipNodeUpdate bool - Partition string `json:",omitempty"` + Partition string `json:",omitempty"` + Locality *Locality `json:",omitempty"` } type CatalogDeregistration struct { diff --git a/vendor/github.com/hashicorp/consul/api/config_entry.go b/vendor/github.com/hashicorp/consul/api/config_entry.go index 7160d7d..405e92e 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -23,6 +26,8 @@ const ( ServiceIntentions string = "service-intentions" MeshConfig string = "mesh" ExportedServices string = "exported-services" + SamenessGroup string = "sameness-group" + RateLimitIPConfig string = "control-plane-request-limit" ProxyConfigGlobal string = "global" MeshConfigMesh string = "mesh" @@ -30,11 +35,15 @@ const ( TCPRoute string = "tcp-route" InlineCertificate string = "inline-certificate" HTTPRoute string = "http-route" + JWTProvider string = "jwt-provider" ) const ( - BuiltinAWSLambdaExtension string = "builtin/aws/lambda" - BuiltinLuaExtension string = "builtin/lua" + BuiltinAWSLambdaExtension string = "builtin/aws/lambda" + BuiltinExtAuthzExtension string = "builtin/ext-authz" + BuiltinLuaExtension string = "builtin/lua" + BuiltinPropertyOverrideExtension string = "builtin/property-override" + BuiltinWasmExtension string = "builtin/wasm" // BuiltinValidateExtension should not be exposed directly or accepted as a valid configured // extension type, as it is only used indirectly via troubleshooting tools. It is included here // for common reference alongside other builtin extensions. @@ -106,6 +115,21 @@ type TransparentProxyConfig struct { DialedDirectly bool `json:",omitempty" alias:"dialed_directly"` } +type MutualTLSMode string + +const ( + // MutualTLSModeDefault represents no specific mode and should + // be used to indicate that a different layer of the configuration + // chain should take precedence. + MutualTLSModeDefault MutualTLSMode = "" + + // MutualTLSModeStrict requires mTLS for incoming traffic. + MutualTLSModeStrict MutualTLSMode = "strict" + + // MutualTLSModePermissive allows incoming non-mTLS traffic. + MutualTLSModePermissive MutualTLSMode = "permissive" +) + // ExposeConfig describes HTTP paths to expose through Envoy outside of Connect. // Users can expose individual paths and/or all HTTP/GRPC paths for checks. type ExposeConfig struct { @@ -119,9 +143,11 @@ type ExposeConfig struct { // EnvoyExtension has configuration for an extension that patches Envoy resources. type EnvoyExtension struct { - Name string - Required bool - Arguments map[string]interface{} `bexpr:"-"` + Name string + Required bool + Arguments map[string]interface{} `bexpr:"-"` + ConsulVersion string + EnvoyVersion string } type ExposePath struct { @@ -296,6 +322,7 @@ type ServiceConfigEntry struct { Protocol string `json:",omitempty"` Mode ProxyMode `json:",omitempty"` TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` + MutualTLSMode MutualTLSMode `json:",omitempty" alias:"mutual_tls_mode"` MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` Expose ExposeConfig `json:",omitempty"` ExternalSNI string `json:",omitempty" alias:"external_sni"` @@ -320,17 +347,20 @@ func (s *ServiceConfigEntry) GetCreateIndex() uint64 { return s.CreateIndex func (s *ServiceConfigEntry) GetModifyIndex() uint64 { return s.ModifyIndex } type ProxyConfigEntry struct { - Kind string - Name string - Partition string `json:",omitempty"` - Namespace string `json:",omitempty"` - Mode ProxyMode `json:",omitempty"` - TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` - Config map[string]interface{} `json:",omitempty"` - MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` - Expose ExposeConfig `json:",omitempty"` - AccessLogs *AccessLogsConfig `json:",omitempty" alias:"access_logs"` - EnvoyExtensions []EnvoyExtension `json:",omitempty" alias:"envoy_extensions"` + Kind string + Name string + Partition string `json:",omitempty"` + Namespace string `json:",omitempty"` + Mode ProxyMode `json:",omitempty"` + TransparentProxy *TransparentProxyConfig `json:",omitempty" alias:"transparent_proxy"` + MutualTLSMode MutualTLSMode `json:",omitempty" alias:"mutual_tls_mode"` + Config map[string]interface{} `json:",omitempty"` + MeshGateway MeshGatewayConfig `json:",omitempty" alias:"mesh_gateway"` + Expose ExposeConfig `json:",omitempty"` + AccessLogs *AccessLogsConfig `json:",omitempty" alias:"access_logs"` + EnvoyExtensions []EnvoyExtension `json:",omitempty" alias:"envoy_extensions"` + FailoverPolicy *ServiceResolverFailoverPolicy `json:",omitempty" alias:"failover_policy"` + PrioritizeByLocality *ServiceResolverPrioritizeByLocality `json:",omitempty" alias:"prioritize_by_locality"` Meta map[string]string `json:",omitempty"` CreateIndex uint64 @@ -367,6 +397,8 @@ func makeConfigEntry(kind, name string) (ConfigEntry, error) { return &MeshConfigEntry{}, nil case ExportedServices: return &ExportedServicesConfigEntry{Name: name}, nil + case SamenessGroup: + return &SamenessGroupConfigEntry{Kind: kind, Name: name}, nil case APIGateway: return &APIGatewayConfigEntry{Kind: kind, Name: name}, nil case TCPRoute: @@ -375,6 +407,10 @@ func makeConfigEntry(kind, name string) (ConfigEntry, error) { return &InlineCertificateConfigEntry{Kind: kind, Name: name}, nil case HTTPRoute: return &HTTPRouteConfigEntry{Kind: kind, Name: name}, nil + case RateLimitIPConfig: + return &RateLimitIPConfigEntry{Kind: kind, Name: name}, nil + case JWTProvider: + return &JWTProviderConfigEntry{Kind: kind, Name: name}, nil default: return nil, fmt.Errorf("invalid config entry kind: %s", kind) } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go b/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go index acc05e1..3696f7b 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_discoverychain.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -169,6 +172,10 @@ type ServiceResolverConfigEntry struct { ConnectTimeout time.Duration `json:",omitempty" alias:"connect_timeout"` RequestTimeout time.Duration `json:",omitempty" alias:"request_timeout"` + // PrioritizeByLocality controls whether the locality of services within the + // local partition will be used to prioritize connectivity. + PrioritizeByLocality *ServiceResolverPrioritizeByLocality `json:",omitempty" alias:"prioritize_by_locality"` + // LoadBalancer determines the load balancing policy and configuration for services // issuing requests to this upstream service. LoadBalancer *LoadBalancer `json:",omitempty" alias:"load_balancer"` @@ -234,15 +241,18 @@ type ServiceResolverRedirect struct { Partition string `json:",omitempty"` Datacenter string `json:",omitempty"` Peer string `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } type ServiceResolverFailover struct { Service string `json:",omitempty"` ServiceSubset string `json:",omitempty" alias:"service_subset"` // Referencing other partitions is not supported. - Namespace string `json:",omitempty"` - Datacenters []string `json:",omitempty"` - Targets []ServiceResolverFailoverTarget `json:",omitempty"` + Namespace string `json:",omitempty"` + Datacenters []string `json:",omitempty"` + Targets []ServiceResolverFailoverTarget `json:",omitempty"` + Policy *ServiceResolverFailoverPolicy `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } type ServiceResolverFailoverTarget struct { @@ -254,6 +264,20 @@ type ServiceResolverFailoverTarget struct { Peer string `json:",omitempty"` } +type ServiceResolverFailoverPolicy struct { + // Mode specifies the type of failover that will be performed. Valid values are + // "sequential", "" (equivalent to "sequential") and "order-by-locality". + Mode string `json:",omitempty"` + Regions []string `json:",omitempty"` +} + +type ServiceResolverPrioritizeByLocality struct { + // Mode specifies the type of prioritization that will be performed + // when selecting nodes in the local partition. + // Valid values are: "" (default "none"), "none", and "failover". + Mode string `json:",omitempty"` +} + // LoadBalancer determines the load balancing policy and configuration for services // issuing requests to this upstream service. type LoadBalancer struct { diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_exports.go b/vendor/github.com/hashicorp/consul/api/config_entry_exports.go index 52b0491..97920e4 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_exports.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_exports.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import "encoding/json" @@ -51,6 +54,9 @@ type ServiceConsumer struct { // Peer is the name of the peer to export the service to. Peer string `json:",omitempty" alias:"peer_name"` + + // SamenessGroup is the name of the sameness group to export the service to. + SamenessGroup string `json:",omitempty" alias:"sameness_group"` } func (e *ExportedServicesConfigEntry) GetKind() string { return ExportedServices } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go b/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go index 05e4383..b59f1c0 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_gateways.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // IngressGatewayConfigEntry manages the configuration for an ingress service diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go b/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go index bbf12cc..47a1ead 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_inline_certificate.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // InlineCertificateConfigEntry -- TODO stub diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go b/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go index 0bff5e8..3f03b08 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_intentions.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import "time" @@ -9,6 +12,7 @@ type ServiceIntentionsConfigEntry struct { Namespace string `json:",omitempty"` Sources []*SourceIntention + JWT *IntentionJWTRequirement `json:",omitempty"` Meta map[string]string `json:",omitempty"` @@ -17,15 +21,16 @@ type ServiceIntentionsConfigEntry struct { } type SourceIntention struct { - Name string - Peer string `json:",omitempty"` - Partition string `json:",omitempty"` - Namespace string `json:",omitempty"` - Action IntentionAction `json:",omitempty"` - Permissions []*IntentionPermission `json:",omitempty"` - Precedence int - Type IntentionSourceType - Description string `json:",omitempty"` + Name string + Peer string `json:",omitempty"` + Partition string `json:",omitempty"` + Namespace string `json:",omitempty"` + SamenessGroup string `json:",omitempty" alias:"sameness_group"` + Action IntentionAction `json:",omitempty"` + Permissions []*IntentionPermission `json:",omitempty"` + Precedence int + Type IntentionSourceType + Description string `json:",omitempty"` LegacyID string `json:",omitempty" alias:"legacy_id"` LegacyMeta map[string]string `json:",omitempty" alias:"legacy_meta"` @@ -44,6 +49,7 @@ func (e *ServiceIntentionsConfigEntry) GetModifyIndex() uint64 { return e.Mo type IntentionPermission struct { Action IntentionAction HTTP *IntentionHTTPPermission `json:",omitempty"` + JWT *IntentionJWTRequirement `json:",omitempty"` } type IntentionHTTPPermission struct { @@ -65,3 +71,30 @@ type IntentionHTTPHeaderPermission struct { Regex string `json:",omitempty"` Invert bool `json:",omitempty"` } + +type IntentionJWTRequirement struct { + // Providers is a list of providers to consider when verifying a JWT. + Providers []*IntentionJWTProvider `json:",omitempty"` +} + +type IntentionJWTProvider struct { + // Name is the name of the JWT provider. There MUST be a corresponding + // "jwt-provider" config entry with this name. + Name string `json:",omitempty"` + + // VerifyClaims is a list of additional claims to verify in a JWT's payload. + VerifyClaims []*IntentionJWTClaimVerification `json:",omitempty" alias:"verify_claims"` +} + +type IntentionJWTClaimVerification struct { + // Path is the path to the claim in the token JSON. + Path []string `json:",omitempty"` + + // Value is the expected value at the given path: + // - If the type at the path is a list then we verify + // that this value is contained in the list. + // + // - If the type at the path is a string then we verify + // that this value matches. + Value string `json:",omitempty"` +} diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go new file mode 100644 index 0000000..270f0d5 --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_jwt_provider.go @@ -0,0 +1,310 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +import ( + "time" +) + +const ( + DiscoveryTypeStrictDNS ClusterDiscoveryType = "STRICT_DNS" + DiscoveryTypeStatic ClusterDiscoveryType = "STATIC" + DiscoveryTypeLogicalDNS ClusterDiscoveryType = "LOGICAL_DNS" + DiscoveryTypeEDS ClusterDiscoveryType = "EDS" + DiscoveryTypeOriginalDST ClusterDiscoveryType = "ORIGINAL_DST" +) + +type JWTProviderConfigEntry struct { + // Kind is the kind of configuration entry and must be "jwt-provider". + Kind string `json:",omitempty"` + + // Name is the name of the provider being configured. + Name string `json:",omitempty"` + + // JSONWebKeySet defines a JSON Web Key Set, its location on disk, or the + // means with which to fetch a key set from a remote server. + JSONWebKeySet *JSONWebKeySet `json:",omitempty" alias:"json_web_key_set"` + + // Issuer is the entity that must have issued the JWT. + // This value must match the "iss" claim of the token. + Issuer string `json:",omitempty"` + + // Audiences is the set of audiences the JWT is allowed to access. + // If specified, all JWTs verified with this provider must address + // at least one of these to be considered valid. + Audiences []string `json:",omitempty"` + + // Locations where the JWT will be present in requests. + // Envoy will check all of these locations to extract a JWT. + // If no locations are specified Envoy will default to: + // 1. Authorization header with Bearer schema: + // "Authorization: Bearer " + // 2. access_token query parameter. + Locations []*JWTLocation `json:",omitempty"` + + // Forwarding defines rules for forwarding verified JWTs to the backend. + Forwarding *JWTForwardingConfig `json:",omitempty"` + + // ClockSkewSeconds specifies the maximum allowable time difference + // from clock skew when validating the "exp" (Expiration) and "nbf" + // (Not Before) claims. + // + // Default value is 30 seconds. + ClockSkewSeconds int `json:",omitempty" alias:"clock_skew_seconds"` + + // CacheConfig defines configuration for caching the validation + // result for previously seen JWTs. Caching results can speed up + // verification when individual tokens are expected to be handled + // multiple times. + CacheConfig *JWTCacheConfig `json:",omitempty" alias:"cache_config"` + + Meta map[string]string `json:",omitempty"` + + // CreateIndex is the Raft index this entry was created at. This is a + // read-only field. + CreateIndex uint64 `json:",omitempty"` + + // ModifyIndex is used for the Check-And-Set operations and can also be fed + // back into the WaitIndex of the QueryOptions in order to perform blocking + // queries. + ModifyIndex uint64 `json:",omitempty"` + + // Partition is the partition the JWTProviderConfigEntry applies to. + // Partitioning is a Consul Enterprise feature. + Partition string `json:",omitempty"` + + // Namespace is the namespace the JWTProviderConfigEntry applies to. + // Namespacing is a Consul Enterprise feature. + Namespace string `json:",omitempty"` +} + +// JWTLocation is a location where the JWT could be present in requests. +// +// Only one of Header, QueryParam, or Cookie can be specified. +type JWTLocation struct { + // Header defines how to extract a JWT from an HTTP request header. + Header *JWTLocationHeader `json:",omitempty"` + + // QueryParam defines how to extract a JWT from an HTTP request + // query parameter. + QueryParam *JWTLocationQueryParam `json:",omitempty" alias:"query_param"` + + // Cookie defines how to extract a JWT from an HTTP request cookie. + Cookie *JWTLocationCookie `json:",omitempty"` +} + +// JWTLocationHeader defines how to extract a JWT from an HTTP +// request header. +type JWTLocationHeader struct { + // Name is the name of the header containing the token. + Name string `json:",omitempty"` + + // ValuePrefix is an optional prefix that precedes the token in the + // header value. + // For example, "Bearer " is a standard value prefix for a header named + // "Authorization", but the prefix is not part of the token itself: + // "Authorization: Bearer " + ValuePrefix string `json:",omitempty" alias:"value_prefix"` + + // Forward defines whether the header with the JWT should be + // forwarded after the token has been verified. If false, the + // header will not be forwarded to the backend. + // + // Default value is false. + Forward bool `json:",omitempty"` +} + +// JWTLocationQueryParam defines how to extract a JWT from an HTTP request query parameter. +type JWTLocationQueryParam struct { + // Name is the name of the query param containing the token. + Name string `json:",omitempty"` +} + +// JWTLocationCookie defines how to extract a JWT from an HTTP request cookie. +type JWTLocationCookie struct { + // Name is the name of the cookie containing the token. + Name string `json:",omitempty"` +} + +type JWTForwardingConfig struct { + // HeaderName is a header name to use when forwarding a verified + // JWT to the backend. The verified JWT could have been extracted + // from any location (query param, header, or cookie). + // + // The header value will be base64-URL-encoded, and will not be + // padded unless PadForwardPayloadHeader is true. + HeaderName string `json:",omitempty" alias:"header_name"` + + // PadForwardPayloadHeader determines whether padding should be added + // to the base64 encoded token forwarded with ForwardPayloadHeader. + // + // Default value is false. + PadForwardPayloadHeader bool `json:",omitempty" alias:"pad_forward_payload_header"` +} + +// JSONWebKeySet defines a key set, its location on disk, or the +// means with which to fetch a key set from a remote server. +// +// Exactly one of Local or Remote must be specified. +type JSONWebKeySet struct { + // Local specifies a local source for the key set. + Local *LocalJWKS `json:",omitempty"` + + // Remote specifies how to fetch a key set from a remote server. + Remote *RemoteJWKS `json:",omitempty"` +} + +// LocalJWKS specifies a location for a local JWKS. +// +// Only one of String and Filename can be specified. +type LocalJWKS struct { + // JWKS contains a base64 encoded JWKS. + JWKS string `json:",omitempty"` + + // Filename configures a location on disk where the JWKS can be + // found. If specified, the file must be present on the disk of ALL + // proxies with intentions referencing this provider. + Filename string `json:",omitempty"` +} + +// RemoteJWKS specifies how to fetch a JWKS from a remote server. +type RemoteJWKS struct { + // URI is the URI of the server to query for the JWKS. + URI string `json:",omitempty"` + + // RequestTimeoutMs is the number of milliseconds to + // time out when making a request for the JWKS. + RequestTimeoutMs int `json:",omitempty" alias:"request_timeout_ms"` + + // CacheDuration is the duration after which cached keys + // should be expired. + // + // Default value is 5 minutes. + CacheDuration time.Duration `json:",omitempty" alias:"cache_duration"` + + // FetchAsynchronously indicates that the JWKS should be fetched + // when a client request arrives. Client requests will be paused + // until the JWKS is fetched. + // If false, the proxy listener will wait for the JWKS to be + // fetched before being activated. + // + // Default value is false. + FetchAsynchronously bool `json:",omitempty" alias:"fetch_asynchronously"` + + // RetryPolicy defines a retry policy for fetching JWKS. + // + // There is no retry by default. + RetryPolicy *JWKSRetryPolicy `json:",omitempty" alias:"retry_policy"` + + // JWKSCluster defines how the specified Remote JWKS URI is to be fetched. + JWKSCluster *JWKSCluster `json:",omitempty" alias:"jwks_cluster"` +} + +type JWKSCluster struct { + // DiscoveryType refers to the service discovery type to use for resolving the cluster. + // + // This defaults to STRICT_DNS. + // Other options include STATIC, LOGICAL_DNS, EDS or ORIGINAL_DST. + DiscoveryType ClusterDiscoveryType `json:",omitempty" alias:"discovery_type"` + + // TLSCertificates refers to the data containing certificate authority certificates to use + // in verifying a presented peer certificate. + // If not specified and a peer certificate is presented it will not be verified. + // + // Must be either CaCertificateProviderInstance or TrustedCA. + TLSCertificates *JWKSTLSCertificate `json:",omitempty" alias:"tls_certificates"` + + // The timeout for new network connections to hosts in the cluster. + // If not set, a default value of 5s will be used. + ConnectTimeout time.Duration `json:",omitempty" alias:"connect_timeout"` +} + +type ClusterDiscoveryType string + +// JWKSTLSCertificate refers to the data containing certificate authority certificates to use +// in verifying a presented peer certificate. +// If not specified and a peer certificate is presented it will not be verified. +// +// Must be either CaCertificateProviderInstance or TrustedCA. +type JWKSTLSCertificate struct { + // CaCertificateProviderInstance Certificate provider instance for fetching TLS certificates. + CaCertificateProviderInstance *JWKSTLSCertProviderInstance `json:",omitempty" alias:"ca_certificate_provider_instance"` + + // TrustedCA defines TLS certificate data containing certificate authority certificates + // to use in verifying a presented peer certificate. + // + // Exactly one of Filename, EnvironmentVariable, InlineString or InlineBytes must be specified. + TrustedCA *JWKSTLSCertTrustedCA `json:",omitempty" alias:"trusted_ca"` +} + +// JWKSTLSCertTrustedCA defines TLS certificate data containing certificate authority certificates +// to use in verifying a presented peer certificate. +// +// Exactly one of Filename, EnvironmentVariable, InlineString or InlineBytes must be specified. +type JWKSTLSCertTrustedCA struct { + Filename string `json:",omitempty" alias:"filename"` + EnvironmentVariable string `json:",omitempty" alias:"environment_variable"` + InlineString string `json:",omitempty" alias:"inline_string"` + InlineBytes []byte `json:",omitempty" alias:"inline_bytes"` +} + +type JWKSTLSCertProviderInstance struct { + // InstanceName refers to the certificate provider instance name + // + // The default value is "default". + InstanceName string `json:",omitempty" alias:"instance_name"` + + // CertificateName is used to specify certificate instances or types. For example, "ROOTCA" to specify + // a root-certificate (validation context) or "example.com" to specify a certificate for a + // particular domain. + // + // The default value is the empty string. + CertificateName string `json:",omitempty" alias:"certificate_name"` +} + +type JWKSRetryPolicy struct { + // NumRetries is the number of times to retry fetching the JWKS. + // The retry strategy uses jittered exponential backoff with + // a base interval of 1s and max of 10s. + // + // Default value is 0. + NumRetries int `json:",omitempty" alias:"num_retries"` + + // Backoff policy + // + // Defaults to Envoy's backoff policy + RetryPolicyBackOff *RetryPolicyBackOff `json:",omitempty" alias:"retry_policy_back_off"` +} + +type RetryPolicyBackOff struct { + // BaseInterval to be used for the next back off computation + // + // The default value from envoy is 1s + BaseInterval time.Duration `json:",omitempty" alias:"base_interval"` + + // MaxInternal to be used to specify the maximum interval between retries. + // Optional but should be greater or equal to BaseInterval. + // + // Defaults to 10 times BaseInterval + MaxInterval time.Duration `json:",omitempty" alias:"max_interval"` +} + +type JWTCacheConfig struct { + // Size specifies the maximum number of JWT verification + // results to cache. + // + // Defaults to 0, meaning that JWT caching is disabled. + Size int `json:",omitempty"` +} + +func (e *JWTProviderConfigEntry) GetKind() string { + return JWTProvider +} + +func (e *JWTProviderConfigEntry) GetName() string { return e.Name } +func (e *JWTProviderConfigEntry) GetMeta() map[string]string { return e.Meta } +func (e *JWTProviderConfigEntry) GetCreateIndex() uint64 { return e.CreateIndex } +func (e *JWTProviderConfigEntry) GetModifyIndex() uint64 { return e.ModifyIndex } +func (e *JWTProviderConfigEntry) GetPartition() string { return e.Partition } +func (e *JWTProviderConfigEntry) GetNamespace() string { return e.Namespace } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go b/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go index 98b8822..1a1ebb8 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_mesh.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -19,6 +22,10 @@ type MeshConfigEntry struct { // in transparent mode. TransparentProxy TransparentProxyMeshConfig `alias:"transparent_proxy"` + // AllowEnablingPermissiveMutualTLS must be true in order to allow setting + // MutualTLSMode=permissive in either service-defaults or proxy-defaults. + AllowEnablingPermissiveMutualTLS bool `json:",omitempty" alias:"allow_enabling_permissive_mutual_tls"` + TLS *MeshTLSConfig `json:",omitempty"` HTTP *MeshHTTPConfig `json:",omitempty"` diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go b/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go new file mode 100644 index 0000000..8df7d4c --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_rate_limit_ip.go @@ -0,0 +1,91 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +type ReadWriteRatesConfig struct { + ReadRate float64 + WriteRate float64 +} + +type RateLimitIPConfigEntry struct { + // Kind of the config entry. This will be set to structs.RateLimitIPConfig + Kind string + Name string + Mode string // {permissive, enforcing, disabled} + + Meta map[string]string `json:",omitempty"` + // overall limits + ReadRate float64 + WriteRate float64 + + //limits specific to a type of call + ACL *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryACL OperationCategory = "ACL" + Catalog *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryCatalog OperationCategory = "Catalog" + ConfigEntry *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryConfigEntry OperationCategory = "ConfigEntry" + ConnectCA *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryConnectCA OperationCategory = "ConnectCA" + Coordinate *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryCoordinate OperationCategory = "Coordinate" + DiscoveryChain *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDiscoveryChain OperationCategory = "DiscoveryChain" + ServerDiscovery *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryServerDiscovery OperationCategory = "ServerDiscovery" + Health *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryHealth OperationCategory = "Health" + Intention *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryIntention OperationCategory = "Intention" + KV *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryKV OperationCategory = "KV" + Tenancy *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPartition OperationCategory = "Tenancy" + PreparedQuery *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPreparedQuery OperationCategory = "PreparedQuery" + Session *ReadWriteRatesConfig `json:",omitempty"` // OperationCategorySession OperationCategory = "Session" + Txn *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryTxn OperationCategory = "Txn" + AutoConfig *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryAutoConfig OperationCategory = "AutoConfig" + FederationState *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryFederationState OperationCategory = "FederationState" + Internal *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryInternal OperationCategory = "Internal" + PeerStream *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPeerStream OperationCategory = "PeerStream" + Peering *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryPeering OperationCategory = "Peering" + DataPlane *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDataPlane OperationCategory = "DataPlane" + DNS *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryDNS OperationCategory = "DNS" + Subscribe *ReadWriteRatesConfig `json:",omitempty"` // OperationCategorySubscribe OperationCategory = "Subscribe" + Resource *ReadWriteRatesConfig `json:",omitempty"` // OperationCategoryResource OperationCategory = "Resource" + + // Partition is the partition the config entry is associated with. + // Partitioning is a Consul Enterprise feature. + Partition string `json:",omitempty"` + + // Namespace is the namespace the config entry is associated with. + // Namespacing is a Consul Enterprise feature. + Namespace string `json:",omitempty"` + + // CreateIndex is the Raft index this entry was created at. This is a + // read-only field. + CreateIndex uint64 + + // ModifyIndex is used for the Check-And-Set operations and can also be fed + // back into the WaitIndex of the QueryOptions in order to perform blocking + // queries. + ModifyIndex uint64 +} + +func (r *RateLimitIPConfigEntry) GetKind() string { + return RateLimitIPConfig +} +func (r *RateLimitIPConfigEntry) GetName() string { + if r == nil { + return "" + } + return r.Name +} +func (r *RateLimitIPConfigEntry) GetPartition() string { + return r.Partition +} +func (r *RateLimitIPConfigEntry) GetNamespace() string { + return r.Namespace +} +func (r *RateLimitIPConfigEntry) GetMeta() map[string]string { + if r == nil { + return nil + } + return r.Meta +} +func (r *RateLimitIPConfigEntry) GetCreateIndex() uint64 { + return r.CreateIndex +} +func (r *RateLimitIPConfigEntry) GetModifyIndex() uint64 { + return r.ModifyIndex +} diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_routes.go b/vendor/github.com/hashicorp/consul/api/config_entry_routes.go index 2edf9b2..cfea394 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_routes.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_routes.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // TCPRouteConfigEntry -- TODO stub diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go b/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go new file mode 100644 index 0000000..1217efe --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/config_entry_sameness_group.go @@ -0,0 +1,29 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +package api + +type SamenessGroupConfigEntry struct { + Kind string + Name string + Partition string `json:",omitempty"` + DefaultForFailover bool `json:",omitempty" alias:"default_for_failover"` + IncludeLocal bool `json:",omitempty" alias:"include_local"` + Members []SamenessGroupMember + Meta map[string]string `json:",omitempty"` + CreateIndex uint64 + ModifyIndex uint64 +} + +type SamenessGroupMember struct { + Partition string `json:",omitempty"` + Peer string `json:",omitempty"` +} + +func (s *SamenessGroupConfigEntry) GetKind() string { return s.Kind } +func (s *SamenessGroupConfigEntry) GetName() string { return s.Name } +func (s *SamenessGroupConfigEntry) GetPartition() string { return s.Partition } +func (s *SamenessGroupConfigEntry) GetNamespace() string { return "" } +func (s *SamenessGroupConfigEntry) GetCreateIndex() uint64 { return s.CreateIndex } +func (s *SamenessGroupConfigEntry) GetModifyIndex() uint64 { return s.ModifyIndex } +func (s *SamenessGroupConfigEntry) GetMeta() map[string]string { return s.Meta } diff --git a/vendor/github.com/hashicorp/consul/api/config_entry_status.go b/vendor/github.com/hashicorp/consul/api/config_entry_status.go index 8352364..2d16ea0 100644 --- a/vendor/github.com/hashicorp/consul/api/config_entry_status.go +++ b/vendor/github.com/hashicorp/consul/api/config_entry_status.go @@ -1,7 +1,13 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( + "fmt" "time" + + "golang.org/x/exp/slices" ) // ResourceReference is a reference to a ConfigEntry @@ -43,7 +49,7 @@ type Condition struct { // Type is a value from a bounded set of types that an object might have Type string // Status is a value from a bounded set of statuses that an object might have - Status string + Status ConditionStatus // Reason is a value from a bounded set of reasons for a given status Reason string // Message is a message that gives more detailed information about @@ -55,3 +61,279 @@ type Condition struct { // LastTransitionTime is the time at which this Condition was created LastTransitionTime *time.Time } + +type ( + ConditionStatus string +) + +const ( + ConditionStatusTrue ConditionStatus = "True" + ConditionStatusFalse ConditionStatus = "False" + ConditionStatusUnknown ConditionStatus = "Unknown" +) + +// GatewayConditionType is a type of condition associated with a +// Gateway. This type should be used with the GatewayStatus.Conditions +// field. +type GatewayConditionType string + +// GatewayConditionReason defines the set of reasons that explain why a +// particular Gateway condition type has been raised. +type GatewayConditionReason string + +// the following are directly from the k8s spec +const ( + // This condition is true when the controller managing the Gateway is + // syntactically and semantically valid enough to produce some configuration + // in the underlying data plane. This does not indicate whether or not the + // configuration has been propagated to the data plane. + // + // Possible reasons for this condition to be True are: + // + // * "Accepted" + // + // Possible reasons for this condition to be False are: + // + // * InvalidCertificates + // + GatewayConditionAccepted GatewayConditionType = "Accepted" + + // This reason is used with the "Accepted" condition when the condition is + // True. + GatewayReasonAccepted GatewayConditionReason = "Accepted" + + // This reason is used with the "Accepted" condition when the gateway has multiple invalid + // certificates and cannot bind to any routes + GatewayReasonInvalidCertificates GatewayConditionReason = "InvalidCertificates" + + // This condition indicates that the gateway was unable to resolve + // conflicting specification requirements for this Listener. If a + // Listener is conflicted, its network port should not be configured + // on any network elements. + // + // Possible reasons for this condition to be true are: + // + // * "RouteConflict" + // + // Possible reasons for this condition to be False are: + // + // * "NoConflict" + // + // Controllers may raise this condition with other reasons, + // but should prefer to use the reasons listed above to improve + // interoperability. + GatewayConditionConflicted GatewayConditionType = "Conflicted" + // This reason is used with the "Conflicted" condition when the condition + // is False. + GatewayReasonNoConflict GatewayConditionReason = "NoConflict" + // This reason is used with the "Conflicted" condition when the route is + // in a conflicted state, such as when a TCPListener attempts to bind to two routes + GatewayReasonRouteConflict GatewayConditionReason = "RouteConflict" + + // This condition indicates whether the controller was able to + // resolve all the object references for the Gateway. When setting this + // condition to False, a ResourceReference to the misconfigured Listener should + // be provided. + // + // Possible reasons for this condition to be true are: + // + // * "ResolvedRefs" + // + // Possible reasons for this condition to be False are: + // + // * "InvalidCertificateRef" + // * "InvalidRouteKinds" + // * "RefNotPermitted" + // + GatewayConditionResolvedRefs GatewayConditionType = "ResolvedRefs" + + // This reason is used with the "ResolvedRefs" condition when the condition + // is true. + GatewayReasonResolvedRefs GatewayConditionReason = "ResolvedRefs" + + // This reason is used with the "ResolvedRefs" condition when a + // Listener has a TLS configuration with at least one TLS CertificateRef + // that is invalid or does not exist. + // A CertificateRef is considered invalid when it refers to a nonexistent + // or unsupported resource or kind, or when the data within that resource + // is malformed. + // This reason must be used only when the reference is allowed, either by + // referencing an object in the same namespace as the Gateway, or when + // a cross-namespace reference has been explicitly allowed by a ReferenceGrant. + // If the reference is not allowed, the reason RefNotPermitted must be used + // instead. + GatewayListenerReasonInvalidCertificateRef GatewayConditionReason = "InvalidCertificateRef" +) + +var validGatewayConditionReasonsMapping = map[GatewayConditionType]map[ConditionStatus][]GatewayConditionReason{ + GatewayConditionAccepted: { + ConditionStatusTrue: { + GatewayReasonAccepted, + }, + ConditionStatusFalse: { + GatewayReasonInvalidCertificates, + }, + ConditionStatusUnknown: {}, + }, + GatewayConditionConflicted: { + ConditionStatusTrue: { + GatewayReasonRouteConflict, + }, + ConditionStatusFalse: { + GatewayReasonNoConflict, + }, + ConditionStatusUnknown: {}, + }, + GatewayConditionResolvedRefs: { + ConditionStatusTrue: { + GatewayReasonResolvedRefs, + }, + ConditionStatusFalse: { + GatewayListenerReasonInvalidCertificateRef, + }, + ConditionStatusUnknown: {}, + }, +} + +func ValidateGatewayConditionReason(name GatewayConditionType, status ConditionStatus, reason GatewayConditionReason) error { + if err := checkConditionStatus(status); err != nil { + return err + } + + reasons, ok := validGatewayConditionReasonsMapping[name] + if !ok { + return fmt.Errorf("unrecognized GatewayConditionType %q", name) + } + + reasonsForStatus, ok := reasons[status] + if !ok { + return fmt.Errorf("unrecognized ConditionStatus %q", status) + } + + if !slices.Contains(reasonsForStatus, reason) { + return fmt.Errorf("gateway condition reason %q not allowed for gateway condition type %q with status %q", reason, name, status) + } + return nil +} + +// RouteConditionType is a type of condition for a route. +type RouteConditionType string + +// RouteConditionReason is a reason for a route condition. +type RouteConditionReason string + +// The following statuses are taken from the K8's Spec +// With the exception of: "RouteReasonInvalidDiscoveryChain" and "NoUpstreamServicesTargeted" +const ( + // This condition indicates whether the route has been accepted or rejected + // by a Gateway, and why. + // + // Possible reasons for this condition to be true are: + // + // * "Accepted" + // + // Possible reasons for this condition to be False are: + // + // * "InvalidDiscoveryChain" + // * "NoUpstreamServicesTargeted" + // + // + // Controllers may raise this condition with other reasons, + // but should prefer to use the reasons listed above to improve + // interoperability. + RouteConditionAccepted RouteConditionType = "Accepted" + + // This reason is used with the "Accepted" condition when the Route has been + // accepted by the Gateway. + RouteReasonAccepted RouteConditionReason = "Accepted" + + // This reason is used with the "Accepted" condition when the route has an + // invalid discovery chain, this includes conditions like the protocol being invalid + // or the discovery chain failing to compile + RouteReasonInvalidDiscoveryChain RouteConditionReason = "InvalidDiscoveryChain" + + // This reason is used with the "Accepted" condition when the route + RouteReasonNoUpstreamServicesTargeted RouteConditionReason = "NoUpstreamServicesTargeted" +) + +// the following statuses are custom to Consul +const ( + // This condition indicates whether the route was able to successfully bind the + // Listener on the gateway + // Possible reasons for this condition to be true are: + // + // * "Bound" + // + // Possible reasons for this condition to be false are: + // + // * "FailedToBind" + // * "GatewayNotFound" + // + RouteConditionBound RouteConditionType = "Bound" + + // This reason is used with the "Bound" condition when the condition + // is true + RouteReasonBound RouteConditionReason = "Bound" + + // This reason is used with the "Bound" condition when the route failed + // to bind to the gateway + RouteReasonFailedToBind RouteConditionReason = "FailedToBind" + + // This reason is used with the "Bound" condition when the route fails + // to find the gateway + RouteReasonGatewayNotFound RouteConditionReason = "GatewayNotFound" +) + +var validRouteConditionReasonsMapping = map[RouteConditionType]map[ConditionStatus][]RouteConditionReason{ + RouteConditionAccepted: { + ConditionStatusTrue: { + RouteReasonAccepted, + }, + ConditionStatusFalse: { + RouteReasonInvalidDiscoveryChain, + RouteReasonNoUpstreamServicesTargeted, + }, + ConditionStatusUnknown: {}, + }, + RouteConditionBound: { + ConditionStatusTrue: { + RouteReasonBound, + }, + ConditionStatusFalse: { + RouteReasonGatewayNotFound, + RouteReasonFailedToBind, + }, + ConditionStatusUnknown: {}, + }, +} + +func ValidateRouteConditionReason(name RouteConditionType, status ConditionStatus, reason RouteConditionReason) error { + if err := checkConditionStatus(status); err != nil { + return err + } + + reasons, ok := validRouteConditionReasonsMapping[name] + if !ok { + return fmt.Errorf("unrecognized RouteConditionType %s", name) + } + + reasonsForStatus, ok := reasons[status] + if !ok { + return fmt.Errorf("unrecognized ConditionStatus %s", name) + } + + if !slices.Contains(reasonsForStatus, reason) { + return fmt.Errorf("route condition reason %s not allowed for route condition type %s with status %s", reason, name, status) + } + + return nil +} + +func checkConditionStatus(status ConditionStatus) error { + switch status { + case ConditionStatusTrue, ConditionStatusFalse, ConditionStatusUnknown: + return nil + default: + return fmt.Errorf("unrecognized condition status: %q", status) + } +} diff --git a/vendor/github.com/hashicorp/consul/api/connect.go b/vendor/github.com/hashicorp/consul/api/connect.go index 1c1da9a..77be000 100644 --- a/vendor/github.com/hashicorp/consul/api/connect.go +++ b/vendor/github.com/hashicorp/consul/api/connect.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // TelemetryCollectorName is the service name for the Consul Telemetry Collector diff --git a/vendor/github.com/hashicorp/consul/api/connect_ca.go b/vendor/github.com/hashicorp/consul/api/connect_ca.go index 69c652d..8a5c9f8 100644 --- a/vendor/github.com/hashicorp/consul/api/connect_ca.go +++ b/vendor/github.com/hashicorp/consul/api/connect_ca.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/connect_intention.go b/vendor/github.com/hashicorp/consul/api/connect_intention.go index 0c2500f..e91c03e 100644 --- a/vendor/github.com/hashicorp/consul/api/connect_intention.go +++ b/vendor/github.com/hashicorp/consul/api/connect_intention.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -40,6 +43,10 @@ type Intention struct { // same level of tenancy (partition is local to cluster, peer is remote). SourcePeer string `json:",omitempty"` + // SourceSamenessGroup cannot be wildcards "*" and + // is not compatible with legacy intentions. + SourceSamenessGroup string `json:",omitempty"` + // SourceType is the type of the value for the source. SourceType IntentionSourceType diff --git a/vendor/github.com/hashicorp/consul/api/coordinate.go b/vendor/github.com/hashicorp/consul/api/coordinate.go index 7ef6ce2..b0269ad 100644 --- a/vendor/github.com/hashicorp/consul/api/coordinate.go +++ b/vendor/github.com/hashicorp/consul/api/coordinate.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/debug.go b/vendor/github.com/hashicorp/consul/api/debug.go index b7e80b8..e6b5dc5 100644 --- a/vendor/github.com/hashicorp/consul/api/debug.go +++ b/vendor/github.com/hashicorp/consul/api/debug.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/discovery_chain.go b/vendor/github.com/hashicorp/consul/api/discovery_chain.go index 4217603..4b6260c 100644 --- a/vendor/github.com/hashicorp/consul/api/discovery_chain.go +++ b/vendor/github.com/hashicorp/consul/api/discovery_chain.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -221,6 +224,7 @@ func (r *DiscoveryResolver) UnmarshalJSON(data []byte) error { // compiled form of ServiceResolverFailover type DiscoveryFailover struct { Targets []string + Policy ServiceResolverFailoverPolicy `json:",omitempty"` } // DiscoveryTarget represents all of the inputs necessary to use a resolver diff --git a/vendor/github.com/hashicorp/consul/api/event.go b/vendor/github.com/hashicorp/consul/api/event.go index ceded65..efba89d 100644 --- a/vendor/github.com/hashicorp/consul/api/event.go +++ b/vendor/github.com/hashicorp/consul/api/event.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/health.go b/vendor/github.com/hashicorp/consul/api/health.go index a89b4b7..a023002 100644 --- a/vendor/github.com/hashicorp/consul/api/health.go +++ b/vendor/github.com/hashicorp/consul/api/health.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -64,6 +67,7 @@ type HealthCheckDefinition struct { TLSServerName string TLSSkipVerify bool TCP string + TCPUseTLS bool UDP string GRPC string OSService string diff --git a/vendor/github.com/hashicorp/consul/api/internal.go b/vendor/github.com/hashicorp/consul/api/internal.go new file mode 100644 index 0000000..dee161a --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/internal.go @@ -0,0 +1,64 @@ +package api + +import "context" + +// Internal can be used to query endpoints that are intended for +// Hashicorp internal-use only. +type Internal struct { + c *Client +} + +// Internal returns a handle to endpoints that are for internal +// Hashicorp usage only. There is not guarantee that these will +// be backwards-compatible or supported, so usage of these is +// not encouraged. +func (c *Client) Internal() *Internal { + return &Internal{c} +} + +type AssignServiceManualVIPsRequest struct { + Service string + ManualVIPs []string +} + +type AssignServiceManualVIPsResponse struct { + ServiceFound bool `json:"Found"` + UnassignedFrom []PeeredServiceName +} + +type PeeredServiceName struct { + ServiceName CompoundServiceName + Peer string +} + +func (i *Internal) AssignServiceVirtualIP( + ctx context.Context, + service string, + manualVIPs []string, + wo *WriteOptions, +) (*AssignServiceManualVIPsResponse, *QueryMeta, error) { + req := i.c.newRequest("PUT", "/v1/internal/service-virtual-ip") + req.setWriteOptions(wo) + req.ctx = ctx + req.obj = AssignServiceManualVIPsRequest{ + Service: service, + ManualVIPs: manualVIPs, + } + rtt, resp, err := i.c.doRequest(req) + if err != nil { + return nil, nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, nil, err + } + + qm := &QueryMeta{RequestTime: rtt} + parseQueryMeta(resp, qm) + + var out AssignServiceManualVIPsResponse + if err := decodeBody(resp, &out); err != nil { + return nil, nil, err + } + return &out, qm, nil +} diff --git a/vendor/github.com/hashicorp/consul/api/kv.go b/vendor/github.com/hashicorp/consul/api/kv.go index 85a9d77..b9d330a 100644 --- a/vendor/github.com/hashicorp/consul/api/kv.go +++ b/vendor/github.com/hashicorp/consul/api/kv.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/lock.go b/vendor/github.com/hashicorp/consul/api/lock.go index 221a7ad..e9529f7 100644 --- a/vendor/github.com/hashicorp/consul/api/lock.go +++ b/vendor/github.com/hashicorp/consul/api/lock.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/namespace.go b/vendor/github.com/hashicorp/consul/api/namespace.go index 65cc6f3..98afd22 100644 --- a/vendor/github.com/hashicorp/consul/api/namespace.go +++ b/vendor/github.com/hashicorp/consul/api/namespace.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator.go b/vendor/github.com/hashicorp/consul/api/operator.go index 079e224..667dcd8 100644 --- a/vendor/github.com/hashicorp/consul/api/operator.go +++ b/vendor/github.com/hashicorp/consul/api/operator.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Operator can be used to perform low-level operator tasks for Consul. diff --git a/vendor/github.com/hashicorp/consul/api/operator_area.go b/vendor/github.com/hashicorp/consul/api/operator_area.go index f9fa133..9228d89 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_area.go +++ b/vendor/github.com/hashicorp/consul/api/operator_area.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // The /v1/operator/area endpoints are available only in Consul Enterprise and diff --git a/vendor/github.com/hashicorp/consul/api/operator_audit.go b/vendor/github.com/hashicorp/consul/api/operator_audit.go new file mode 100644 index 0000000..5240d38 --- /dev/null +++ b/vendor/github.com/hashicorp/consul/api/operator_audit.go @@ -0,0 +1,40 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + +// The /v1/operator/audit-hash endpoint is available only in Consul Enterprise and +// interact with its audit logging subsystem. + +package api + +type AuditHashRequest struct { + Input string +} + +type AuditHashResponse struct { + Hash string +} + +func (op *Operator) AuditHash(a *AuditHashRequest, q *QueryOptions) (*AuditHashResponse, error) { + r := op.c.newRequest("POST", "/v1/operator/audit-hash") + r.setQueryOptions(q) + r.obj = a + + rtt, resp, err := op.c.doRequest(r) + if err != nil { + return nil, err + } + defer closeResponseBody(resp) + if err := requireOK(resp); err != nil { + return nil, err + } + + wm := &WriteMeta{} + wm.RequestTime = rtt + + var out AuditHashResponse + if err := decodeBody(resp, &out); err != nil { + return nil, err + } + + return &out, nil +} diff --git a/vendor/github.com/hashicorp/consul/api/operator_autopilot.go b/vendor/github.com/hashicorp/consul/api/operator_autopilot.go index 6ab5769..7628bf6 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_autopilot.go +++ b/vendor/github.com/hashicorp/consul/api/operator_autopilot.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator_keyring.go b/vendor/github.com/hashicorp/consul/api/operator_keyring.go index 6db31a2..aefec9e 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_keyring.go +++ b/vendor/github.com/hashicorp/consul/api/operator_keyring.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // keyringRequest is used for performing Keyring operations diff --git a/vendor/github.com/hashicorp/consul/api/operator_license.go b/vendor/github.com/hashicorp/consul/api/operator_license.go index 74eed3b..1e3496d 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_license.go +++ b/vendor/github.com/hashicorp/consul/api/operator_license.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/operator_raft.go b/vendor/github.com/hashicorp/consul/api/operator_raft.go index 1da20e8..d72c00c 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_raft.go +++ b/vendor/github.com/hashicorp/consul/api/operator_raft.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // RaftServer has information about a server in the Raft configuration. @@ -25,6 +28,9 @@ type RaftServer struct { // it's a non-voting server, which will be added in a future release of // Consul. Voter bool + + // LastIndex is the last log index this server has a record of in its Raft log. + LastIndex uint64 } // RaftConfiguration is returned when querying for the current Raft configuration. diff --git a/vendor/github.com/hashicorp/consul/api/operator_segment.go b/vendor/github.com/hashicorp/consul/api/operator_segment.go index 92b05d3..6115a7a 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_segment.go +++ b/vendor/github.com/hashicorp/consul/api/operator_segment.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // SegmentList returns all the available LAN segments. diff --git a/vendor/github.com/hashicorp/consul/api/operator_usage.go b/vendor/github.com/hashicorp/consul/api/operator_usage.go index d07e774..8977449 100644 --- a/vendor/github.com/hashicorp/consul/api/operator_usage.go +++ b/vendor/github.com/hashicorp/consul/api/operator_usage.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api type Usage struct { @@ -7,6 +10,7 @@ type Usage struct { // ServiceUsage contains information about the number of services and service instances for a datacenter. type ServiceUsage struct { + Nodes int Services int ServiceInstances int ConnectServiceInstances map[string]int diff --git a/vendor/github.com/hashicorp/consul/api/partition.go b/vendor/github.com/hashicorp/consul/api/partition.go index 88edfb7..8467c31 100644 --- a/vendor/github.com/hashicorp/consul/api/partition.go +++ b/vendor/github.com/hashicorp/consul/api/partition.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/peering.go b/vendor/github.com/hashicorp/consul/api/peering.go index 34602c8..dd7780f 100644 --- a/vendor/github.com/hashicorp/consul/api/peering.go +++ b/vendor/github.com/hashicorp/consul/api/peering.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( @@ -44,6 +47,16 @@ type PeeringRemoteInfo struct { Partition string // Datacenter is the remote peer's datacenter. Datacenter string + Locality *Locality `json:",omitempty"` +} + +// Locality identifies where a given entity is running. +type Locality struct { + // Region is region the zone belongs to. + Region string + + // Zone is the zone the entity is running in. + Zone string } type Peering struct { diff --git a/vendor/github.com/hashicorp/consul/api/prepared_query.go b/vendor/github.com/hashicorp/consul/api/prepared_query.go index f47a583..8ebc852 100644 --- a/vendor/github.com/hashicorp/consul/api/prepared_query.go +++ b/vendor/github.com/hashicorp/consul/api/prepared_query.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // QueryFailoverOptions sets options about how we fail over if there are no @@ -26,6 +29,14 @@ type QueryFailoverTarget struct { // Datacenter specifies a datacenter to try during failover. Datacenter string + + // Partition specifies a partition to try during failover + // Note: Partition are available only in Consul Enterprise + Partition string `json:",omitempty"` + + // Namespace specifies a namespace to try during failover + // Note: Namespaces are available only in Consul Enterprise + Namespace string `json:",omitempty"` } // QueryDNSOptions controls settings when query results are served over DNS. @@ -40,9 +51,17 @@ type ServiceQuery struct { // Service is the service to query. Service string + // SamenessGroup specifies a sameness group to query. The first member of the Sameness Group will + // be targeted first on PQ execution and subsequent members will be targeted during failover scenarios. + // This field is mutually exclusive with Failover. + SamenessGroup string `json:",omitempty"` + // Namespace of the service to query Namespace string `json:",omitempty"` + // Partition of the service to query + Partition string `json:",omitempty"` + // Near allows baking in the name of a node to automatically distance- // sort from. The magic "_agent" value is supported, which sorts near // the agent which initiated the request by default. @@ -50,7 +69,7 @@ type ServiceQuery struct { // Failover controls what we do if there are no healthy nodes in the // local datacenter. - Failover QueryFailoverOptions + Failover QueryFailoverOptions `json:",omitempty"` // IgnoreCheckIDs is an optional list of health check IDs to ignore when // considering which nodes are healthy. It is useful as an emergency measure diff --git a/vendor/github.com/hashicorp/consul/api/raw.go b/vendor/github.com/hashicorp/consul/api/raw.go index 745a208..639513d 100644 --- a/vendor/github.com/hashicorp/consul/api/raw.go +++ b/vendor/github.com/hashicorp/consul/api/raw.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Raw can be used to do raw queries against custom endpoints diff --git a/vendor/github.com/hashicorp/consul/api/semaphore.go b/vendor/github.com/hashicorp/consul/api/semaphore.go index 066ce33..9d98ff5 100644 --- a/vendor/github.com/hashicorp/consul/api/semaphore.go +++ b/vendor/github.com/hashicorp/consul/api/semaphore.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/session.go b/vendor/github.com/hashicorp/consul/api/session.go index 3f61acf..69fd77d 100644 --- a/vendor/github.com/hashicorp/consul/api/session.go +++ b/vendor/github.com/hashicorp/consul/api/session.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/snapshot.go b/vendor/github.com/hashicorp/consul/api/snapshot.go index b526b79..bcc80e5 100644 --- a/vendor/github.com/hashicorp/consul/api/snapshot.go +++ b/vendor/github.com/hashicorp/consul/api/snapshot.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/consul/api/status.go b/vendor/github.com/hashicorp/consul/api/status.go index 86f943b..8c52eb2 100644 --- a/vendor/github.com/hashicorp/consul/api/status.go +++ b/vendor/github.com/hashicorp/consul/api/status.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api // Status can be used to query the Status endpoints diff --git a/vendor/github.com/hashicorp/consul/api/txn.go b/vendor/github.com/hashicorp/consul/api/txn.go index 4aa06d9..59adafd 100644 --- a/vendor/github.com/hashicorp/consul/api/txn.go +++ b/vendor/github.com/hashicorp/consul/api/txn.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MPL-2.0 + package api import ( diff --git a/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go b/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go index 8d306bf..fe28d15 100644 --- a/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go +++ b/vendor/github.com/hashicorp/go-cleanhttp/cleanhttp.go @@ -32,6 +32,7 @@ func DefaultPooledTransport() *http.Transport { IdleConnTimeout: 90 * time.Second, TLSHandshakeTimeout: 10 * time.Second, ExpectContinueTimeout: 1 * time.Second, + ForceAttemptHTTP2: true, MaxIdleConnsPerHost: runtime.GOMAXPROCS(0) + 1, } return transport diff --git a/vendor/github.com/hashicorp/go-hclog/LICENSE b/vendor/github.com/hashicorp/go-hclog/LICENSE index abaf1e4..9938fb5 100644 --- a/vendor/github.com/hashicorp/go-hclog/LICENSE +++ b/vendor/github.com/hashicorp/go-hclog/LICENSE @@ -1,6 +1,4 @@ -MIT License - -Copyright (c) 2017 HashiCorp +Copyright (c) 2017 HashiCorp, Inc. Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal diff --git a/vendor/github.com/hashicorp/go-hclog/README.md b/vendor/github.com/hashicorp/go-hclog/README.md index 5d56f4b..21a17c5 100644 --- a/vendor/github.com/hashicorp/go-hclog/README.md +++ b/vendor/github.com/hashicorp/go-hclog/README.md @@ -17,11 +17,8 @@ JSON output mode for production. ## Stability Note -While this library is fully open source and HashiCorp will be maintaining it -(since we are and will be making extensive use of it), the API and output -format is subject to minor changes as we fully bake and vet it in our projects. -This notice will be removed once it's fully integrated into our major projects -and no further changes are anticipated. +This library has reached 1.0 stability. Its API can be considered solidified +and promised through future versions. ## Installation and Docs @@ -102,7 +99,7 @@ into all the callers. ### Using `hclog.Fmt()` ```go -var int totalBandwidth = 200 +totalBandwidth := 200 appLogger.Info("total bandwidth exceeded", "bandwidth", hclog.Fmt("%d GB/s", totalBandwidth)) ``` @@ -146,3 +143,6 @@ log.Printf("[DEBUG] %d", 42) Notice that if `appLogger` is initialized with the `INFO` log level _and_ you specify `InferLevels: true`, you will not see any output here. You must change `appLogger` to `DEBUG` to see output. See the docs for more information. + +If the log lines start with a timestamp you can use the +`InferLevelsWithTimestamp` option to try and ignore them. diff --git a/vendor/github.com/hashicorp/go-hclog/colorize_unix.go b/vendor/github.com/hashicorp/go-hclog/colorize_unix.go index 44aa9bf..d00816b 100644 --- a/vendor/github.com/hashicorp/go-hclog/colorize_unix.go +++ b/vendor/github.com/hashicorp/go-hclog/colorize_unix.go @@ -1,3 +1,7 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +//go:build !windows // +build !windows package hclog @@ -6,22 +10,35 @@ import ( "github.com/mattn/go-isatty" ) +// hasFD is used to check if the writer has an Fd value to check +// if it's a terminal. +type hasFD interface { + Fd() uintptr +} + // setColorization will mutate the values of this logger -// to approperately configure colorization options. It provides +// to appropriately configure colorization options. It provides // a wrapper to the output stream on Windows systems. func (l *intLogger) setColorization(opts *LoggerOptions) { - switch opts.Color { - case ColorOff: - fallthrough - case ForceColor: + if opts.Color != AutoColor { return - case AutoColor: - fi := l.checkWriterIsFile() - isUnixTerm := isatty.IsTerminal(fi.Fd()) - isCygwinTerm := isatty.IsCygwinTerminal(fi.Fd()) - isTerm := isUnixTerm || isCygwinTerm - if !isTerm { + } + + if sc, ok := l.writer.w.(SupportsColor); ok { + if !sc.SupportsColor() { + l.headerColor = ColorOff l.writer.color = ColorOff } + return + } + + fi, ok := l.writer.w.(hasFD) + if !ok { + return + } + + if !isatty.IsTerminal(fi.Fd()) { + l.headerColor = ColorOff + l.writer.color = ColorOff } } diff --git a/vendor/github.com/hashicorp/go-hclog/colorize_windows.go b/vendor/github.com/hashicorp/go-hclog/colorize_windows.go index 23486b6..2c3fb9e 100644 --- a/vendor/github.com/hashicorp/go-hclog/colorize_windows.go +++ b/vendor/github.com/hashicorp/go-hclog/colorize_windows.go @@ -1,3 +1,7 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + +//go:build windows // +build windows package hclog @@ -6,28 +10,32 @@ import ( "os" colorable "github.com/mattn/go-colorable" - "github.com/mattn/go-isatty" ) // setColorization will mutate the values of this logger -// to approperately configure colorization options. It provides +// to appropriately configure colorization options. It provides // a wrapper to the output stream on Windows systems. func (l *intLogger) setColorization(opts *LoggerOptions) { - switch opts.Color { - case ColorOff: + if opts.Color == ColorOff { + return + } + + fi, ok := l.writer.w.(*os.File) + if !ok { + l.writer.color = ColorOff + l.headerColor = ColorOff return - case ForceColor: - fi := l.checkWriterIsFile() - l.writer.w = colorable.NewColorable(fi) - case AutoColor: - fi := l.checkWriterIsFile() - isUnixTerm := isatty.IsTerminal(os.Stdout.Fd()) - isCygwinTerm := isatty.IsCygwinTerminal(os.Stdout.Fd()) - isTerm := isUnixTerm || isCygwinTerm - if !isTerm { - l.writer.color = ColorOff - return - } - l.writer.w = colorable.NewColorable(fi) + } + + cfi := colorable.NewColorable(fi) + + // NewColorable detects if color is possible and if it's not, then it + // returns the original value. So we can test if we got the original + // value back to know if color is possible. + if cfi == fi { + l.writer.color = ColorOff + l.headerColor = ColorOff + } else { + l.writer.w = cfi } } diff --git a/vendor/github.com/hashicorp/go-hclog/context.go b/vendor/github.com/hashicorp/go-hclog/context.go index 7815f50..eb5aba5 100644 --- a/vendor/github.com/hashicorp/go-hclog/context.go +++ b/vendor/github.com/hashicorp/go-hclog/context.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-hclog/exclude.go b/vendor/github.com/hashicorp/go-hclog/exclude.go index cfd4307..4b73ba5 100644 --- a/vendor/github.com/hashicorp/go-hclog/exclude.go +++ b/vendor/github.com/hashicorp/go-hclog/exclude.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-hclog/global.go b/vendor/github.com/hashicorp/go-hclog/global.go index 22ebc57..a7403f5 100644 --- a/vendor/github.com/hashicorp/go-hclog/global.go +++ b/vendor/github.com/hashicorp/go-hclog/global.go @@ -1,7 +1,11 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( "sync" + "time" ) var ( @@ -14,17 +18,18 @@ var ( DefaultOptions = &LoggerOptions{ Level: DefaultLevel, Output: DefaultOutput, + TimeFn: time.Now, } ) // Default returns a globally held logger. This can be a good starting -// place, and then you can use .With() and .Name() to create sub-loggers +// place, and then you can use .With() and .Named() to create sub-loggers // to be used in more specific contexts. // The value of the Default logger can be set via SetDefault() or by // changing the options in DefaultOptions. // // This method is goroutine safe, returning a global from memory, but -// cause should be used if SetDefault() is called it random times +// care should be used if SetDefault() is called it random times // in the program as that may result in race conditions and an unexpected // Logger being returned. func Default() Logger { diff --git a/vendor/github.com/hashicorp/go-hclog/interceptlogger.go b/vendor/github.com/hashicorp/go-hclog/interceptlogger.go index 08a6677..e9b1c18 100644 --- a/vendor/github.com/hashicorp/go-hclog/interceptlogger.go +++ b/vendor/github.com/hashicorp/go-hclog/interceptlogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -18,8 +21,13 @@ type interceptLogger struct { } func NewInterceptLogger(opts *LoggerOptions) InterceptLogger { + l := newLogger(opts) + if l.callerOffset > 0 { + // extra frames for interceptLogger.{Warn,Info,Log,etc...}, and interceptLogger.log + l.callerOffset += 2 + } intercept := &interceptLogger{ - Logger: New(opts), + Logger: l, mu: new(sync.Mutex), sinkCount: new(int32), Sinks: make(map[SinkAdapter]struct{}), @@ -31,6 +39,14 @@ func NewInterceptLogger(opts *LoggerOptions) InterceptLogger { } func (i *interceptLogger) Log(level Level, msg string, args ...interface{}) { + i.log(level, msg, args...) +} + +// log is used to make the caller stack frame lookup consistent. If Warn,Info,etc +// all called Log then direct calls to Log would have a different stack frame +// depth. By having all the methods call the same helper we ensure the stack +// frame depth is the same. +func (i *interceptLogger) log(level Level, msg string, args ...interface{}) { i.Logger.Log(level, msg, args...) if atomic.LoadInt32(i.sinkCount) == 0 { return @@ -45,72 +61,27 @@ func (i *interceptLogger) Log(level Level, msg string, args ...interface{}) { // Emit the message and args at TRACE level to log and sinks func (i *interceptLogger) Trace(msg string, args ...interface{}) { - i.Logger.Trace(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Trace, msg, i.retrieveImplied(args...)...) - } + i.log(Trace, msg, args...) } // Emit the message and args at DEBUG level to log and sinks func (i *interceptLogger) Debug(msg string, args ...interface{}) { - i.Logger.Debug(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Debug, msg, i.retrieveImplied(args...)...) - } + i.log(Debug, msg, args...) } // Emit the message and args at INFO level to log and sinks func (i *interceptLogger) Info(msg string, args ...interface{}) { - i.Logger.Info(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Info, msg, i.retrieveImplied(args...)...) - } + i.log(Info, msg, args...) } // Emit the message and args at WARN level to log and sinks func (i *interceptLogger) Warn(msg string, args ...interface{}) { - i.Logger.Warn(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Warn, msg, i.retrieveImplied(args...)...) - } + i.log(Warn, msg, args...) } // Emit the message and args at ERROR level to log and sinks func (i *interceptLogger) Error(msg string, args ...interface{}) { - i.Logger.Error(msg, args...) - if atomic.LoadInt32(i.sinkCount) == 0 { - return - } - - i.mu.Lock() - defer i.mu.Unlock() - for s := range i.Sinks { - s.Accept(i.Name(), Error, msg, i.retrieveImplied(args...)...) - } + i.log(Error, msg, args...) } func (i *interceptLogger) retrieveImplied(args ...interface{}) []interface{} { @@ -123,17 +94,11 @@ func (i *interceptLogger) retrieveImplied(args ...interface{}) []interface{} { return cp } -// Create a new sub-Logger that a name decending from the current name. +// Create a new sub-Logger that a name descending from the current name. // This is used to create a subsystem specific Logger. // Registered sinks will subscribe to these messages as well. func (i *interceptLogger) Named(name string) Logger { - var sub interceptLogger - - sub = *i - - sub.Logger = i.Logger.Named(name) - - return &sub + return i.NamedIntercept(name) } // Create a new sub-Logger with an explicit name. This ignores the current @@ -141,13 +106,7 @@ func (i *interceptLogger) Named(name string) Logger { // within the normal hierarchy. Registered sinks will subscribe // to these messages as well. func (i *interceptLogger) ResetNamed(name string) Logger { - var sub interceptLogger - - sub = *i - - sub.Logger = i.Logger.ResetNamed(name) - - return &sub + return i.ResetNamedIntercept(name) } // Create a new sub-Logger that a name decending from the current name. @@ -157,9 +116,7 @@ func (i *interceptLogger) NamedIntercept(name string) InterceptLogger { var sub interceptLogger sub = *i - sub.Logger = i.Logger.Named(name) - return &sub } @@ -171,9 +128,7 @@ func (i *interceptLogger) ResetNamedIntercept(name string) InterceptLogger { var sub interceptLogger sub = *i - sub.Logger = i.Logger.ResetNamed(name) - return &sub } @@ -210,22 +165,28 @@ func (i *interceptLogger) DeregisterSink(sink SinkAdapter) { atomic.AddInt32(i.sinkCount, -1) } -// Create a *log.Logger that will send it's data through this Logger. This -// allows packages that expect to be using the standard library to log to -// actually use this logger, which will also send to any registered sinks. func (i *interceptLogger) StandardLoggerIntercept(opts *StandardLoggerOptions) *log.Logger { + return i.StandardLogger(opts) +} + +func (i *interceptLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { if opts == nil { opts = &StandardLoggerOptions{} } - return log.New(i.StandardWriterIntercept(opts), "", 0) + return log.New(i.StandardWriter(opts), "", 0) } func (i *interceptLogger) StandardWriterIntercept(opts *StandardLoggerOptions) io.Writer { + return i.StandardWriter(opts) +} + +func (i *interceptLogger) StandardWriter(opts *StandardLoggerOptions) io.Writer { return &stdlogAdapter{ - log: i, - inferLevels: opts.InferLevels, - forceLevel: opts.ForceLevel, + log: i, + inferLevels: opts.InferLevels, + inferLevelsWithTimestamp: opts.InferLevelsWithTimestamp, + forceLevel: opts.ForceLevel, } } diff --git a/vendor/github.com/hashicorp/go-hclog/intlogger.go b/vendor/github.com/hashicorp/go-hclog/intlogger.go index 7158125..b45064a 100644 --- a/vendor/github.com/hashicorp/go-hclog/intlogger.go +++ b/vendor/github.com/hashicorp/go-hclog/intlogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -8,9 +11,7 @@ import ( "fmt" "io" "log" - "os" "reflect" - "regexp" "runtime" "sort" "strconv" @@ -18,14 +19,20 @@ import ( "sync" "sync/atomic" "time" + "unicode" + "unicode/utf8" "github.com/fatih/color" ) -// TimeFormat to use for logging. This is a version of RFC3339 that contains -// contains millisecond precision +// TimeFormat is the time format to use for plain (non-JSON) output. +// This is a version of RFC3339 that contains millisecond precision. const TimeFormat = "2006-01-02T15:04:05.000Z0700" +// TimeFormatJSON is the time format to use for JSON output. +// This is a version of RFC3339 that contains microsecond precision. +const TimeFormatJSON = "2006-01-02T15:04:05.000000Z07:00" + // errJsonUnsupportedTypeMsg is included in log json entries, if an arg cannot be serialized to json const errJsonUnsupportedTypeMsg = "logging contained values that don't serialize to json" @@ -45,6 +52,12 @@ var ( Warn: color.New(color.FgHiYellow), Error: color.New(color.FgHiRed), } + + faintBoldColor = color.New(color.Faint, color.Bold) + faintColor = color.New(color.Faint) + faintMultiLinePrefix = faintColor.Sprint(" | ") + faintFieldSeparator = faintColor.Sprint("=") + faintFieldSeparatorWithNewLine = faintColor.Sprint("=\n") ) // Make sure that intLogger is a Logger @@ -53,10 +66,12 @@ var _ Logger = &intLogger{} // intLogger is an internal logger implementation. Internal in that it is // defined entirely by this package. type intLogger struct { - json bool - caller bool - name string - timeFormat string + json bool + callerOffset int + name string + timeFormat string + timeFn TimeFunction + disableTime bool // This is an interface so that it's shared by any derived loggers, since // those derived loggers share the bufio.Writer as well. @@ -64,9 +79,17 @@ type intLogger struct { writer *writer level *int32 + headerColor ColorOption + fieldColor ColorOption + implied []interface{} exclude func(level Level, msg string, args ...interface{}) bool + + // create subloggers with their own level setting + independentLevels bool + + subloggerHook func(sub Logger) Logger } // New returns a configured logger. @@ -77,7 +100,12 @@ func New(opts *LoggerOptions) Logger { // NewSinkAdapter returns a SinkAdapter with configured settings // defined by LoggerOptions func NewSinkAdapter(opts *LoggerOptions) SinkAdapter { - return newLogger(opts) + l := newLogger(opts) + if l.callerOffset > 0 { + // extra frames for interceptLogger.{Warn,Info,Log,etc...}, and SinkAdapter.Accept + l.callerOffset += 2 + } + return l } func newLogger(opts *LoggerOptions) *intLogger { @@ -100,30 +128,69 @@ func newLogger(opts *LoggerOptions) *intLogger { mutex = new(sync.Mutex) } - l := &intLogger{ - json: opts.JSONFormat, - caller: opts.IncludeLocation, - name: opts.Name, - timeFormat: TimeFormat, - mutex: mutex, - writer: newWriter(output, opts.Color), - level: new(int32), - exclude: opts.Exclude, + var ( + primaryColor ColorOption = ColorOff + headerColor ColorOption = ColorOff + fieldColor ColorOption = ColorOff + ) + switch { + case opts.ColorHeaderOnly: + headerColor = opts.Color + case opts.ColorHeaderAndFields: + fieldColor = opts.Color + headerColor = opts.Color + default: + primaryColor = opts.Color } - l.setColorization(opts) + l := &intLogger{ + json: opts.JSONFormat, + name: opts.Name, + timeFormat: TimeFormat, + timeFn: time.Now, + disableTime: opts.DisableTime, + mutex: mutex, + writer: newWriter(output, primaryColor), + level: new(int32), + exclude: opts.Exclude, + independentLevels: opts.IndependentLevels, + headerColor: headerColor, + fieldColor: fieldColor, + subloggerHook: opts.SubloggerHook, + } + if opts.IncludeLocation { + l.callerOffset = offsetIntLogger + opts.AdditionalLocationOffset + } - if opts.DisableTime { - l.timeFormat = "" - } else if opts.TimeFormat != "" { + if l.json { + l.timeFormat = TimeFormatJSON + } + if opts.TimeFn != nil { + l.timeFn = opts.TimeFn + } + if opts.TimeFormat != "" { l.timeFormat = opts.TimeFormat } + if l.subloggerHook == nil { + l.subloggerHook = identityHook + } + + l.setColorization(opts) + atomic.StoreInt32(l.level, int32(level)) return l } +func identityHook(logger Logger) Logger { + return logger +} + +// offsetIntLogger is the stack frame offset in the call stack for the caller to +// one of the Warn, Info, Log, etc methods. +const offsetIntLogger = 3 + // Log a message and a set of key/value pairs if the given level is at // or more severe that the threshold configured in the Logger. func (l *intLogger) log(name string, level Level, msg string, args ...interface{}) { @@ -131,7 +198,7 @@ func (l *intLogger) log(name string, level Level, msg string, args ...interface{ return } - t := time.Now() + t := l.timeFn() l.mutex.Lock() defer l.mutex.Unlock() @@ -178,34 +245,56 @@ func trimCallerPath(path string) string { return path[idx+1:] } -var logImplFile = regexp.MustCompile(`.+intlogger.go|.+interceptlogger.go$`) +// isNormal indicates if the rune is one allowed to exist as an unquoted +// string value. This is a subset of ASCII, `-` through `~`. +func isNormal(r rune) bool { + return 0x2D <= r && r <= 0x7E // - through ~ +} -// Non-JSON logging format function +// needsQuoting returns false if all the runes in string are normal, according +// to isNormal +func needsQuoting(str string) bool { + for _, r := range str { + if !isNormal(r) { + return true + } + } + + return false +} + +// logPlain is the non-JSON logging format function which writes directly +// to the underlying writer the logger was initialized with. +// +// If the logger was initialized with a color function, it also handles +// applying the color to the log message. +// +// Color Options +// 1. No color. +// 2. Color the whole log line, based on the level. +// 3. Color only the header (level) part of the log line. +// 4. Color both the header and fields of the log line. func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, args ...interface{}) { - if len(l.timeFormat) > 0 { + + if !l.disableTime { l.writer.WriteString(t.Format(l.timeFormat)) l.writer.WriteByte(' ') } s, ok := _levelToBracket[level] if ok { - l.writer.WriteString(s) + if l.headerColor != ColorOff { + color := _levelToColor[level] + color.Fprint(l.writer, s) + } else { + l.writer.WriteString(s) + } } else { l.writer.WriteString("[?????]") } - offset := 3 - if l.caller { - // Check if the caller is inside our package and inside - // a logger implementation file - if _, file, _, ok := runtime.Caller(3); ok { - match := logImplFile.MatchString(file) - if match { - offset = 4 - } - } - - if _, file, line, ok := runtime.Caller(offset); ok { + if l.callerOffset > 0 { + if _, file, line, ok := runtime.Caller(l.callerOffset); ok { l.writer.WriteByte(' ') l.writer.WriteString(trimCallerPath(file)) l.writer.WriteByte(':') @@ -218,16 +307,19 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, if name != "" { l.writer.WriteString(name) - l.writer.WriteString(": ") + if msg != "" { + l.writer.WriteString(": ") + l.writer.WriteString(msg) + } + } else if msg != "" { + l.writer.WriteString(msg) } - l.writer.WriteString(msg) - args = append(l.implied, args...) var stacktrace CapturedStacktrace - if args != nil && len(args) > 0 { + if len(args) > 0 { if len(args)%2 != 0 { cs, ok := args[len(args)-1].(CapturedStacktrace) if ok { @@ -241,16 +333,23 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, l.writer.WriteByte(':') + // Handle the field arguments, which come in pairs (key=val). FOR: for i := 0; i < len(args); i = i + 2 { var ( + key string val string raw bool ) + // Convert the field value to a string. switch st := args[i+1].(type) { case string: val = st + if st == "" { + val = `""` + raw = true + } case int: val = strconv.FormatInt(int64(st), 10) case int64: @@ -282,6 +381,9 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, continue FOR case Format: val = fmt.Sprintf(st[0].(string), st[1:]...) + case Quote: + raw = true + val = strconv.Quote(string(st)) default: v := reflect.ValueOf(st) if v.Kind() == reflect.Slice { @@ -292,20 +394,57 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, } } - l.writer.WriteByte(' ') + // Convert the field key to a string. switch st := args[i].(type) { case string: - l.writer.WriteString(st) + key = st default: - l.writer.WriteString(fmt.Sprintf("%s", st)) + key = fmt.Sprintf("%s", st) } - l.writer.WriteByte('=') - if !raw && strings.ContainsAny(val, " \t\n\r") { + // Optionally apply the ANSI "faint" and "bold" + // SGR values to the key. + if l.fieldColor != ColorOff { + key = faintBoldColor.Sprint(key) + } + + // Values may contain multiple lines, and that format + // is preserved, with each line prefixed with a " | " + // to show it's part of a collection of lines. + // + // Values may also need quoting, if not all the runes + // in the value string are "normal", like if they + // contain ANSI escape sequences. + if strings.Contains(val, "\n") { + l.writer.WriteString("\n ") + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparatorWithNewLine) + writeIndent(l.writer, val, faintMultiLinePrefix) + } else { + l.writer.WriteString("=\n") + writeIndent(l.writer, val, " | ") + } + l.writer.WriteString(" ") + } else if !raw && needsQuoting(val) { + l.writer.WriteByte(' ') + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } l.writer.WriteByte('"') - l.writer.WriteString(val) + writeEscapedForOutput(l.writer, val, true) l.writer.WriteByte('"') } else { + l.writer.WriteByte(' ') + l.writer.WriteString(key) + if l.fieldColor != ColorOff { + l.writer.WriteString(faintFieldSeparator) + } else { + l.writer.WriteByte('=') + } l.writer.WriteString(val) } } @@ -315,9 +454,108 @@ func (l *intLogger) logPlain(t time.Time, name string, level Level, msg string, if stacktrace != "" { l.writer.WriteString(string(stacktrace)) + l.writer.WriteString("\n") } } +func writeIndent(w *writer, str string, indent string) { + for { + nl := strings.IndexByte(str, "\n"[0]) + if nl == -1 { + if str != "" { + w.WriteString(indent) + writeEscapedForOutput(w, str, false) + w.WriteString("\n") + } + return + } + + w.WriteString(indent) + writeEscapedForOutput(w, str[:nl], false) + w.WriteString("\n") + str = str[nl+1:] + } +} + +func needsEscaping(str string) bool { + for _, b := range str { + if !unicode.IsPrint(b) || b == '"' { + return true + } + } + + return false +} + +const ( + lowerhex = "0123456789abcdef" +) + +var bufPool = sync.Pool{ + New: func() interface{} { + return new(bytes.Buffer) + }, +} + +func writeEscapedForOutput(w io.Writer, str string, escapeQuotes bool) { + if !needsEscaping(str) { + w.Write([]byte(str)) + return + } + + bb := bufPool.Get().(*bytes.Buffer) + bb.Reset() + + defer bufPool.Put(bb) + + for _, r := range str { + if escapeQuotes && r == '"' { + bb.WriteString(`\"`) + } else if unicode.IsPrint(r) { + bb.WriteRune(r) + } else { + switch r { + case '\a': + bb.WriteString(`\a`) + case '\b': + bb.WriteString(`\b`) + case '\f': + bb.WriteString(`\f`) + case '\n': + bb.WriteString(`\n`) + case '\r': + bb.WriteString(`\r`) + case '\t': + bb.WriteString(`\t`) + case '\v': + bb.WriteString(`\v`) + default: + switch { + case r < ' ': + bb.WriteString(`\x`) + bb.WriteByte(lowerhex[byte(r)>>4]) + bb.WriteByte(lowerhex[byte(r)&0xF]) + case !utf8.ValidRune(r): + r = 0xFFFD + fallthrough + case r < 0x10000: + bb.WriteString(`\u`) + for s := 12; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + default: + bb.WriteString(`\U`) + for s := 28; s >= 0; s -= 4 { + bb.WriteByte(lowerhex[r>>uint(s)&0xF]) + } + } + } + } + } + + w.Write(bb.Bytes()) +} + func (l *intLogger) renderSlice(v reflect.Value) string { var buf bytes.Buffer @@ -334,22 +572,19 @@ func (l *intLogger) renderSlice(v reflect.Value) string { switch sv.Kind() { case reflect.String: - val = sv.String() + val = strconv.Quote(sv.String()) case reflect.Int, reflect.Int16, reflect.Int32, reflect.Int64: val = strconv.FormatInt(sv.Int(), 10) case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64: val = strconv.FormatUint(sv.Uint(), 10) default: val = fmt.Sprintf("%v", sv.Interface()) + if strings.ContainsAny(val, " \t\n\r") { + val = strconv.Quote(val) + } } - if strings.ContainsAny(val, " \t\n\r") { - buf.WriteByte('"') - buf.WriteString(val) - buf.WriteByte('"') - } else { - buf.WriteString(val) - } + buf.WriteString(val) } buf.WriteRune(']') @@ -415,8 +650,10 @@ func (l *intLogger) logJSON(t time.Time, name string, level Level, msg string, a func (l intLogger) jsonMapEntry(t time.Time, name string, level Level, msg string) map[string]interface{} { vals := map[string]interface{}{ - "@message": msg, - "@timestamp": t.Format("2006-01-02T15:04:05.000000Z07:00"), + "@message": msg, + } + if !l.disableTime { + vals["@timestamp"] = t.Format(l.timeFormat) } var levelStr string @@ -441,8 +678,8 @@ func (l intLogger) jsonMapEntry(t time.Time, name string, level Level, msg strin vals["@module"] = name } - if l.caller { - if _, file, line, ok := runtime.Caller(4); ok { + if l.callerOffset > 0 { + if _, file, line, ok := runtime.Caller(l.callerOffset + 1); ok { vals["@caller"] = fmt.Sprintf("%s:%d", file, line) } } @@ -517,7 +754,7 @@ func (l *intLogger) With(args ...interface{}) Logger { args = args[:len(args)-1] } - sl := *l + sl := l.copy() result := make(map[string]interface{}, len(l.implied)+len(args)) keys := make([]string, 0, len(l.implied)+len(args)) @@ -551,13 +788,13 @@ func (l *intLogger) With(args ...interface{}) Logger { sl.implied = append(sl.implied, MissingKey, extra) } - return &sl + return l.subloggerHook(sl) } // Create a new sub-Logger that a name decending from the current name. // This is used to create a subsystem specific Logger. func (l *intLogger) Named(name string) Logger { - sl := *l + sl := l.copy() if sl.name != "" { sl.name = sl.name + "." + name @@ -565,18 +802,18 @@ func (l *intLogger) Named(name string) Logger { sl.name = name } - return &sl + return l.subloggerHook(sl) } // Create a new sub-Logger with an explicit name. This ignores the current // name. This is used to create a standalone logger that doesn't fall // within the normal hierarchy. func (l *intLogger) ResetNamed(name string) Logger { - sl := *l + sl := l.copy() sl.name = name - return &sl + return l.subloggerHook(sl) } func (l *intLogger) ResetOutput(opts *LoggerOptions) error { @@ -620,6 +857,11 @@ func (l *intLogger) SetLevel(level Level) { atomic.StoreInt32(l.level, int32(level)) } +// Returns the current level +func (l *intLogger) GetLevel() Level { + return Level(atomic.LoadInt32(l.level)) +} + // Create a *log.Logger that will send it's data through this Logger. This // allows packages that expect to be using the standard library log to actually // use this logger. @@ -632,21 +874,19 @@ func (l *intLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { } func (l *intLogger) StandardWriter(opts *StandardLoggerOptions) io.Writer { - return &stdlogAdapter{ - log: l, - inferLevels: opts.InferLevels, - forceLevel: opts.ForceLevel, + newLog := *l + if l.callerOffset > 0 { + // the stack is + // logger.printf() -> l.Output() ->l.out.writer(hclog:stdlogAdaptor.write) -> hclog:stdlogAdaptor.dispatch() + // So plus 4. + newLog.callerOffset = l.callerOffset + 4 } -} - -// checks if the underlying io.Writer is a file, and -// panics if not. For use by colorization. -func (l *intLogger) checkWriterIsFile() *os.File { - fi, ok := l.writer.w.(*os.File) - if !ok { - panic("Cannot enable coloring of non-file Writers") + return &stdlogAdapter{ + log: &newLog, + inferLevels: opts.InferLevels, + inferLevelsWithTimestamp: opts.InferLevelsWithTimestamp, + forceLevel: opts.ForceLevel, } - return fi } // Accept implements the SinkAdapter interface @@ -663,3 +903,16 @@ func (i *intLogger) ImpliedArgs() []interface{} { func (i *intLogger) Name() string { return i.name } + +// copy returns a shallow copy of the intLogger, replacing the level pointer +// when necessary +func (l *intLogger) copy() *intLogger { + sl := *l + + if l.independentLevels { + sl.level = new(int32) + *sl.level = *l.level + } + + return &sl +} diff --git a/vendor/github.com/hashicorp/go-hclog/logger.go b/vendor/github.com/hashicorp/go-hclog/logger.go index 8d5eed7..947ac0c 100644 --- a/vendor/github.com/hashicorp/go-hclog/logger.go +++ b/vendor/github.com/hashicorp/go-hclog/logger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -5,10 +8,11 @@ import ( "log" "os" "strings" + "time" ) var ( - //DefaultOutput is used as the default log output. + // DefaultOutput is used as the default log output. DefaultOutput io.Writer = os.Stderr // DefaultLevel is used as the default log level. @@ -27,7 +31,7 @@ const ( // of actions in code, such as function enters/exits, etc. Trace Level = 1 - // Debug information for programmer lowlevel analysis. + // Debug information for programmer low-level analysis. Debug Level = 2 // Info information about steady state operations. @@ -38,15 +42,18 @@ const ( // Error information about unrecoverable events. Error Level = 5 + + // Off disables all logging output. + Off Level = 6 ) -// Format is a simple convience type for when formatting is required. When +// Format is a simple convenience type for when formatting is required. When // processing a value of this type, the logger automatically treats the first // argument as a Printf formatting string and passes the rest as the values // to be formatted. For example: L.Info(Fmt{"%d beans/day", beans}). type Format []interface{} -// Fmt returns a Format type. This is a convience function for creating a Format +// Fmt returns a Format type. This is a convenience function for creating a Format // type. func Fmt(str string, args ...interface{}) Format { return append(Format{str}, args...) @@ -64,6 +71,12 @@ type Octal int // text output. For example: L.Info("bits", Binary(17)) type Binary int +// A simple shortcut to format strings with Go quoting. Control and +// non-printable characters will be escaped with their backslash equivalents in +// output. Intended for untrusted or multiline strings which should be logged +// as concisely as possible. +type Quote string + // ColorOption expresses how the output should be colored, if at all. type ColorOption uint8 @@ -79,6 +92,13 @@ const ( ForceColor ) +// SupportsColor is an optional interface that can be implemented by the output +// value. If implemented and SupportsColor() returns true, then AutoColor will +// enable colorization. +type SupportsColor interface { + SupportsColor() bool +} + // LevelFromString returns a Level type for the named log level, or "NoLevel" if // the level string is invalid. This facilitates setting the log level via // config or environment variable by name in a predictable way. @@ -96,6 +116,8 @@ func LevelFromString(levelStr string) Level { return Warn case "error": return Error + case "off": + return Off default: return NoLevel } @@ -115,12 +137,14 @@ func (l Level) String() string { return "error" case NoLevel: return "none" + case Off: + return "off" default: return "unknown" } } -// Logger describes the interface that must be implemeted by all loggers. +// Logger describes the interface that must be implemented by all loggers. type Logger interface { // Args are alternating key, val pairs // keys must be strings @@ -179,10 +203,14 @@ type Logger interface { // the current name as well. ResetNamed(name string) Logger - // Updates the level. This should affect all sub-loggers as well. If an + // Updates the level. This should affect all related loggers as well, + // unless they were created with IndependentLevels. If an // implementation cannot update the level on the fly, it should no-op. SetLevel(level Level) + // Returns the current level + GetLevel() Level + // Return a value that conforms to the stdlib log.Logger interface StandardLogger(opts *StandardLoggerOptions) *log.Logger @@ -198,6 +226,15 @@ type StandardLoggerOptions struct { // [DEBUG] and strip it off before reapplying it. InferLevels bool + // Indicate that some minimal parsing should be done on strings to try + // and detect their level and re-emit them while ignoring possible + // timestamp values in the beginning of the string. + // This supports the strings like [ERROR], [ERR] [TRACE], [WARN], [INFO], + // [DEBUG] and strip it off before reapplying it. + // The timestamp detection may result in false positives and incomplete + // string outputs. + InferLevelsWithTimestamp bool + // ForceLevel is used to force all output from the standard logger to be at // the specified level. Similar to InferLevels, this will strip any level // prefix contained in the logged string before applying the forced level. @@ -205,12 +242,14 @@ type StandardLoggerOptions struct { ForceLevel Level } +type TimeFunction = func() time.Time + // LoggerOptions can be used to configure a new logger. type LoggerOptions struct { // Name of the subsystem to prefix logs with Name string - // The threshold for the logger. Anything less severe is supressed + // The threshold for the logger. Anything less severe is suppressed Level Level // Where to write the logs to. Defaults to os.Stderr if nil @@ -227,22 +266,49 @@ type LoggerOptions struct { // Include file and line information in each log line IncludeLocation bool + // AdditionalLocationOffset is the number of additional stack levels to skip + // when finding the file and line information for the log line + AdditionalLocationOffset int + // The time format to use instead of the default TimeFormat string + // A function which is called to get the time object that is formatted using `TimeFormat` + TimeFn TimeFunction + // Control whether or not to display the time at all. This is required // because setting TimeFormat to empty assumes the default format. DisableTime bool - // Color the output. On Windows, colored logs are only avaiable for io.Writers that + // Color the output. On Windows, colored logs are only available for io.Writers that // are concretely instances of *os.File. Color ColorOption + // Only color the header, not the body. This can help with readability of long messages. + ColorHeaderOnly bool + + // Color the header and message body fields. This can help with readability + // of long messages with multiple fields. + ColorHeaderAndFields bool + // A function which is called with the log information and if it returns true the value // should not be logged. // This is useful when interacting with a system that you wish to suppress the log // message for (because it's too noisy, etc) Exclude func(level Level, msg string, args ...interface{}) bool + + // IndependentLevels causes subloggers to be created with an independent + // copy of this logger's level. This means that using SetLevel on this + // logger will not affect any subloggers, and SetLevel on any subloggers + // will not affect the parent or sibling loggers. + IndependentLevels bool + + // SubloggerHook registers a function that is called when a sublogger via + // Named, With, or ResetNamed is created. If defined, the function is passed + // the newly created Logger and the returned Logger is returned from the + // original function. This option allows customization via interception and + // wrapping of Logger instances. + SubloggerHook func(sub Logger) Logger } // InterceptLogger describes the interface for using a logger @@ -271,10 +337,10 @@ type InterceptLogger interface { // the current name as well. ResetNamedIntercept(name string) InterceptLogger - // Return a value that conforms to the stdlib log.Logger interface + // Deprecated: use StandardLogger StandardLoggerIntercept(opts *StandardLoggerOptions) *log.Logger - // Return a value that conforms to io.Writer, which can be passed into log.SetOutput() + // Deprecated: use StandardWriter StandardWriterIntercept(opts *StandardLoggerOptions) io.Writer } diff --git a/vendor/github.com/hashicorp/go-hclog/nulllogger.go b/vendor/github.com/hashicorp/go-hclog/nulllogger.go index bc14f77..d43da80 100644 --- a/vendor/github.com/hashicorp/go-hclog/nulllogger.go +++ b/vendor/github.com/hashicorp/go-hclog/nulllogger.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( @@ -49,6 +52,8 @@ func (l *nullLogger) ResetNamed(name string) Logger { return l } func (l *nullLogger) SetLevel(level Level) {} +func (l *nullLogger) GetLevel() Level { return NoLevel } + func (l *nullLogger) StandardLogger(opts *StandardLoggerOptions) *log.Logger { return log.New(l.StandardWriter(opts), "", log.LstdFlags) } diff --git a/vendor/github.com/hashicorp/go-hclog/stdlog.go b/vendor/github.com/hashicorp/go-hclog/stdlog.go index f35d875..03739b6 100644 --- a/vendor/github.com/hashicorp/go-hclog/stdlog.go +++ b/vendor/github.com/hashicorp/go-hclog/stdlog.go @@ -1,18 +1,27 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( "bytes" "log" + "regexp" "strings" ) +// Regex to ignore characters commonly found in timestamp formats from the +// beginning of inputs. +var logTimestampRegexp = regexp.MustCompile(`^[\d\s\:\/\.\+-TZ]*`) + // Provides a io.Writer to shim the data out of *log.Logger // and back into our Logger. This is basically the only way to // build upon *log.Logger. type stdlogAdapter struct { - log Logger - inferLevels bool - forceLevel Level + log Logger + inferLevels bool + inferLevelsWithTimestamp bool + forceLevel Level } // Take the data, infer the levels if configured, and send it through @@ -28,6 +37,10 @@ func (s *stdlogAdapter) Write(data []byte) (int, error) { // Log at the forced level s.dispatch(str, s.forceLevel) } else if s.inferLevels { + if s.inferLevelsWithTimestamp { + str = s.trimTimestamp(str) + } + level, str := s.pickLevel(str) s.dispatch(str, level) } else { @@ -64,7 +77,7 @@ func (s *stdlogAdapter) pickLevel(str string) (Level, string) { case strings.HasPrefix(str, "[INFO]"): return Info, strings.TrimSpace(str[6:]) case strings.HasPrefix(str, "[WARN]"): - return Warn, strings.TrimSpace(str[7:]) + return Warn, strings.TrimSpace(str[6:]) case strings.HasPrefix(str, "[ERROR]"): return Error, strings.TrimSpace(str[7:]) case strings.HasPrefix(str, "[ERR]"): @@ -74,6 +87,11 @@ func (s *stdlogAdapter) pickLevel(str string) (Level, string) { } } +func (s *stdlogAdapter) trimTimestamp(str string) string { + idx := logTimestampRegexp.FindStringIndex(str) + return str[idx[1]:] +} + type logWriter struct { l *log.Logger } diff --git a/vendor/github.com/hashicorp/go-hclog/writer.go b/vendor/github.com/hashicorp/go-hclog/writer.go index 421a1f0..4ee219b 100644 --- a/vendor/github.com/hashicorp/go-hclog/writer.go +++ b/vendor/github.com/hashicorp/go-hclog/writer.go @@ -1,3 +1,6 @@ +// Copyright (c) HashiCorp, Inc. +// SPDX-License-Identifier: MIT + package hclog import ( diff --git a/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md b/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md index 6331af9..86c6d03 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md +++ b/vendor/github.com/hashicorp/go-immutable-radix/CHANGELOG.md @@ -1,3 +1,5 @@ +# UNRELEASED + # 1.3.0 (September 17th, 2020) FEATURES diff --git a/vendor/github.com/hashicorp/go-immutable-radix/iter.go b/vendor/github.com/hashicorp/go-immutable-radix/iter.go index cd16d3b..f17d0a6 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/iter.go +++ b/vendor/github.com/hashicorp/go-immutable-radix/iter.go @@ -20,7 +20,7 @@ func (i *Iterator) SeekPrefixWatch(prefix []byte) (watch <-chan struct{}) { watch = n.mutateCh search := prefix for { - // Check for key exhaution + // Check for key exhaustion if len(search) == 0 { i.node = n return @@ -60,10 +60,13 @@ func (i *Iterator) recurseMin(n *Node) *Node { if n.leaf != nil { return n } - if len(n.edges) > 0 { + nEdges := len(n.edges) + if nEdges > 1 { // Add all the other edges to the stack (the min node will be added as // we recurse) i.stack = append(i.stack, n.edges[1:]) + } + if nEdges > 0 { return i.recurseMin(n.edges[0].node) } // Shouldn't be possible @@ -77,16 +80,32 @@ func (i *Iterator) recurseMin(n *Node) *Node { func (i *Iterator) SeekLowerBound(key []byte) { // Wipe the stack. Unlike Prefix iteration, we need to build the stack as we // go because we need only a subset of edges of many nodes in the path to the - // leaf with the lower bound. + // leaf with the lower bound. Note that the iterator will still recurse into + // children that we don't traverse on the way to the reverse lower bound as it + // walks the stack. i.stack = []edges{} + // i.node starts off in the common case as pointing to the root node of the + // tree. By the time we return we have either found a lower bound and setup + // the stack to traverse all larger keys, or we have not and the stack and + // node should both be nil to prevent the iterator from assuming it is just + // iterating the whole tree from the root node. Either way this needs to end + // up as nil so just set it here. n := i.node + i.node = nil search := key found := func(n *Node) { - i.node = n i.stack = append(i.stack, edges{edge{node: n}}) } + findMin := func(n *Node) { + n = i.recurseMin(n) + if n != nil { + found(n) + return + } + } + for { // Compare current prefix with the search key's same-length prefix. var prefixCmp int @@ -100,10 +119,7 @@ func (i *Iterator) SeekLowerBound(key []byte) { // Prefix is larger, that means the lower bound is greater than the search // and from now on we need to follow the minimum path to the smallest // leaf under this subtree. - n = i.recurseMin(n) - if n != nil { - found(n) - } + findMin(n) return } @@ -115,27 +131,29 @@ func (i *Iterator) SeekLowerBound(key []byte) { } // Prefix is equal, we are still heading for an exact match. If this is a - // leaf we're done. - if n.leaf != nil { - if bytes.Compare(n.leaf.key, key) < 0 { - i.node = nil - return - } + // leaf and an exact match we're done. + if n.leaf != nil && bytes.Equal(n.leaf.key, key) { found(n) return } - // Consume the search prefix - if len(n.prefix) > len(search) { - search = []byte{} - } else { - search = search[len(n.prefix):] + // Consume the search prefix if the current node has one. Note that this is + // safe because if n.prefix is longer than the search slice prefixCmp would + // have been > 0 above and the method would have already returned. + search = search[len(n.prefix):] + + if len(search) == 0 { + // We've exhausted the search key, but the current node is not an exact + // match or not a leaf. That means that the leaf value if it exists, and + // all child nodes must be strictly greater, the smallest key in this + // subtree must be the lower bound. + findMin(n) + return } // Otherwise, take the lower bound next edge. idx, lbNode := n.getLowerBoundEdge(search[0]) if lbNode == nil { - i.node = nil return } @@ -144,7 +162,6 @@ func (i *Iterator) SeekLowerBound(key []byte) { i.stack = append(i.stack, n.edges[idx+1:]) } - i.node = lbNode // Recurse n = lbNode } diff --git a/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go b/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go index 762471b..554fa71 100644 --- a/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go +++ b/vendor/github.com/hashicorp/go-immutable-radix/reverse_iter.go @@ -8,6 +8,16 @@ import ( // in reverse in-order type ReverseIterator struct { i *Iterator + + // expandedParents stores the set of parent nodes whose relevant children have + // already been pushed into the stack. This can happen during seek or during + // iteration. + // + // Unlike forward iteration we need to recurse into children before we can + // output the value stored in an internal leaf since all children are greater. + // We use this to track whether we have already ensured all the children are + // in the stack. + expandedParents map[*Node]struct{} } // NewReverseIterator returns a new ReverseIterator at a node @@ -28,22 +38,6 @@ func (ri *ReverseIterator) SeekPrefix(prefix []byte) { ri.i.SeekPrefixWatch(prefix) } -func (ri *ReverseIterator) recurseMax(n *Node) *Node { - // Traverse to the maximum child - if n.leaf != nil { - return n - } - if len(n.edges) > 0 { - // Add all the other edges to the stack (the max node will be added as - // we recurse) - m := len(n.edges) - ri.i.stack = append(ri.i.stack, n.edges[:m-1]) - return ri.recurseMax(n.edges[m-1].node) - } - // Shouldn't be possible - return nil -} - // SeekReverseLowerBound is used to seek the iterator to the largest key that is // lower or equal to the given key. There is no watch variant as it's hard to // predict based on the radix structure which node(s) changes might affect the @@ -51,14 +45,32 @@ func (ri *ReverseIterator) recurseMax(n *Node) *Node { func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { // Wipe the stack. Unlike Prefix iteration, we need to build the stack as we // go because we need only a subset of edges of many nodes in the path to the - // leaf with the lower bound. + // leaf with the lower bound. Note that the iterator will still recurse into + // children that we don't traverse on the way to the reverse lower bound as it + // walks the stack. ri.i.stack = []edges{} + // ri.i.node starts off in the common case as pointing to the root node of the + // tree. By the time we return we have either found a lower bound and setup + // the stack to traverse all larger keys, or we have not and the stack and + // node should both be nil to prevent the iterator from assuming it is just + // iterating the whole tree from the root node. Either way this needs to end + // up as nil so just set it here. n := ri.i.node + ri.i.node = nil search := key + if ri.expandedParents == nil { + ri.expandedParents = make(map[*Node]struct{}) + } + found := func(n *Node) { - ri.i.node = n ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) + // We need to mark this node as expanded in advance too otherwise the + // iterator will attempt to walk all of its children even though they are + // greater than the lower bound we have found. We've expanded it in the + // sense that all of its children that we want to walk are already in the + // stack (i.e. none of them). + ri.expandedParents[n] = struct{}{} } for { @@ -71,41 +83,73 @@ func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { } if prefixCmp < 0 { - // Prefix is smaller than search prefix, that means there is no lower bound. - // But we are looking in reverse, so the reverse lower bound will be the - // largest leaf under this subtree, since it is the value that would come - // right before the current search prefix if it were in the tree. So we need - // to follow the maximum path in this subtree to find it. - n = ri.recurseMax(n) - if n != nil { - found(n) - } + // Prefix is smaller than search prefix, that means there is no exact + // match for the search key. But we are looking in reverse, so the reverse + // lower bound will be the largest leaf under this subtree, since it is + // the value that would come right before the current search key if it + // were in the tree. So we need to follow the maximum path in this subtree + // to find it. Note that this is exactly what the iterator will already do + // if it finds a node in the stack that has _not_ been marked as expanded + // so in this one case we don't call `found` and instead let the iterator + // do the expansion and recursion through all the children. + ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) return } if prefixCmp > 0 { - // Prefix is larger than search prefix, that means there is no reverse lower - // bound since nothing comes before our current search prefix. - ri.i.node = nil + // Prefix is larger than search prefix, or there is no prefix but we've + // also exhausted the search key. Either way, that means there is no + // reverse lower bound since nothing comes before our current search + // prefix. return } - // Prefix is equal, we are still heading for an exact match. If this is a - // leaf we're done. - if n.leaf != nil { - if bytes.Compare(n.leaf.key, key) < 0 { - ri.i.node = nil + // If this is a leaf, something needs to happen! Note that if it's a leaf + // and prefixCmp was zero (which it must be to get here) then the leaf value + // is either an exact match for the search, or it's lower. It can't be + // greater. + if n.isLeaf() { + + // Firstly, if it's an exact match, we're done! + if bytes.Equal(n.leaf.key, key) { + found(n) return } - found(n) - return + + // It's not so this node's leaf value must be lower and could still be a + // valid contender for reverse lower bound. + + // If it has no children then we are also done. + if len(n.edges) == 0 { + // This leaf is the lower bound. + found(n) + return + } + + // Finally, this leaf is internal (has children) so we'll keep searching, + // but we need to add it to the iterator's stack since it has a leaf value + // that needs to be iterated over. It needs to be added to the stack + // before its children below as it comes first. + ri.i.stack = append(ri.i.stack, edges{edge{node: n}}) + // We also need to mark it as expanded since we'll be adding any of its + // relevant children below and so don't want the iterator to re-add them + // on its way back up the stack. + ri.expandedParents[n] = struct{}{} } - // Consume the search prefix - if len(n.prefix) > len(search) { - search = []byte{} - } else { - search = search[len(n.prefix):] + // Consume the search prefix. Note that this is safe because if n.prefix is + // longer than the search slice prefixCmp would have been > 0 above and the + // method would have already returned. + search = search[len(n.prefix):] + + if len(search) == 0 { + // We've exhausted the search key but we are not at a leaf. That means all + // children are greater than the search key so a reverse lower bound + // doesn't exist in this subtree. Note that there might still be one in + // the whole radix tree by following a different path somewhere further + // up. If that's the case then the iterator's stack will contain all the + // smaller nodes already and Previous will walk through them correctly. + return } // Otherwise, take the lower bound next edge. @@ -125,14 +169,12 @@ func (ri *ReverseIterator) SeekReverseLowerBound(key []byte) { ri.i.stack = append(ri.i.stack, n.edges[:idx]) } - // Exit if there's not lower bound edge. The stack will have the - // previous nodes already. + // Exit if there's no lower bound edge. The stack will have the previous + // nodes already. if lbNode == nil { - ri.i.node = nil return } - ri.i.node = lbNode // Recurse n = lbNode } @@ -149,6 +191,10 @@ func (ri *ReverseIterator) Previous() ([]byte, interface{}, bool) { } } + if ri.expandedParents == nil { + ri.expandedParents = make(map[*Node]struct{}) + } + for len(ri.i.stack) > 0 { // Inspect the last element of the stack n := len(ri.i.stack) @@ -156,22 +202,38 @@ func (ri *ReverseIterator) Previous() ([]byte, interface{}, bool) { m := len(last) elem := last[m-1].node - // Update the stack + _, alreadyExpanded := ri.expandedParents[elem] + + // If this is an internal node and we've not seen it already, we need to + // leave it in the stack so we can return its possible leaf value _after_ + // we've recursed through all its children. + if len(elem.edges) > 0 && !alreadyExpanded { + // record that we've seen this node! + ri.expandedParents[elem] = struct{}{} + // push child edges onto stack and skip the rest of the loop to recurse + // into the largest one. + ri.i.stack = append(ri.i.stack, elem.edges) + continue + } + + // Remove the node from the stack if m > 1 { ri.i.stack[n-1] = last[:m-1] } else { ri.i.stack = ri.i.stack[:n-1] } - - // Push the edges onto the frontier - if len(elem.edges) > 0 { - ri.i.stack = append(ri.i.stack, elem.edges) + // We don't need this state any more as it's no longer in the stack so we + // won't visit it again + if alreadyExpanded { + delete(ri.expandedParents, elem) } - // Return the leaf values if any + // If this is a leaf, return it if elem.leaf != nil { return elem.leaf.key, elem.leaf.val, true } + + // it's not a leaf so keep walking the stack to find the previous leaf } return nil, nil, false } diff --git a/vendor/github.com/mattn/go-colorable/.travis.yml b/vendor/github.com/mattn/go-colorable/.travis.yml deleted file mode 100644 index 7942c56..0000000 --- a/vendor/github.com/mattn/go-colorable/.travis.yml +++ /dev/null @@ -1,15 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) - diff --git a/vendor/github.com/mattn/go-colorable/README.md b/vendor/github.com/mattn/go-colorable/README.md index e055952..ca04837 100644 --- a/vendor/github.com/mattn/go-colorable/README.md +++ b/vendor/github.com/mattn/go-colorable/README.md @@ -1,6 +1,6 @@ # go-colorable -[![Build Status](https://travis-ci.org/mattn/go-colorable.svg?branch=master)](https://travis-ci.org/mattn/go-colorable) +[![Build Status](https://github.com/mattn/go-colorable/workflows/test/badge.svg)](https://github.com/mattn/go-colorable/actions?query=workflow%3Atest) [![Codecov](https://codecov.io/gh/mattn/go-colorable/branch/master/graph/badge.svg)](https://codecov.io/gh/mattn/go-colorable) [![GoDoc](https://godoc.org/github.com/mattn/go-colorable?status.svg)](http://godoc.org/github.com/mattn/go-colorable) [![Go Report Card](https://goreportcard.com/badge/mattn/go-colorable)](https://goreportcard.com/report/mattn/go-colorable) diff --git a/vendor/github.com/mattn/go-colorable/colorable_appengine.go b/vendor/github.com/mattn/go-colorable/colorable_appengine.go index 1f7806f..416d1bb 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_appengine.go +++ b/vendor/github.com/mattn/go-colorable/colorable_appengine.go @@ -1,3 +1,4 @@ +//go:build appengine // +build appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_others.go b/vendor/github.com/mattn/go-colorable/colorable_others.go index 08cbd1e..766d946 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_others.go +++ b/vendor/github.com/mattn/go-colorable/colorable_others.go @@ -1,5 +1,5 @@ -// +build !windows -// +build !appengine +//go:build !windows && !appengine +// +build !windows,!appengine package colorable diff --git a/vendor/github.com/mattn/go-colorable/colorable_windows.go b/vendor/github.com/mattn/go-colorable/colorable_windows.go index b9e9363..1846ad5 100644 --- a/vendor/github.com/mattn/go-colorable/colorable_windows.go +++ b/vendor/github.com/mattn/go-colorable/colorable_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package colorable @@ -10,6 +10,7 @@ import ( "os" "strconv" "strings" + "sync" "syscall" "unsafe" @@ -27,6 +28,7 @@ const ( backgroundRed = 0x40 backgroundIntensity = 0x80 backgroundMask = (backgroundRed | backgroundBlue | backgroundGreen | backgroundIntensity) + commonLvbUnderscore = 0x8000 cENABLE_VIRTUAL_TERMINAL_PROCESSING = 0x4 ) @@ -93,6 +95,7 @@ type Writer struct { oldattr word oldpos coord rest bytes.Buffer + mutex sync.Mutex } // NewColorable returns new instance of Writer which handles escape sequence from File. @@ -432,6 +435,8 @@ func atoiWithDefault(s string, def int) (int, error) { // Write writes data on console func (w *Writer) Write(data []byte) (n int, err error) { + w.mutex.Lock() + defer w.mutex.Unlock() var csbi consoleScreenBufferInfo procGetConsoleScreenBufferInfo.Call(uintptr(w.handle), uintptr(unsafe.Pointer(&csbi))) @@ -447,18 +452,22 @@ func (w *Writer) Write(data []byte) (n int, err error) { } else { er = bytes.NewReader(data) } - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop @@ -683,14 +692,19 @@ loop: switch { case n == 0 || n == 100: attr = w.oldattr - case 1 <= n && n <= 5: - attr |= foregroundIntensity - case n == 7: - attr = ((attr & foregroundMask) << 4) | ((attr & backgroundMask) >> 4) - case n == 22 || n == 25: + case n == 4: + attr |= commonLvbUnderscore + case (1 <= n && n <= 3) || n == 5: attr |= foregroundIntensity - case n == 27: - attr = ((attr & foregroundMask) << 4) | ((attr & backgroundMask) >> 4) + case n == 7 || n == 27: + attr = + (attr &^ (foregroundMask | backgroundMask)) | + ((attr & foregroundMask) << 4) | + ((attr & backgroundMask) >> 4) + case n == 22: + attr &^= foregroundIntensity + case n == 24: + attr &^= commonLvbUnderscore case 30 <= n && n <= 37: attr &= backgroundMask if (n-30)&1 != 0 { @@ -709,7 +723,7 @@ loop: n256setup() } attr &= backgroundMask - attr |= n256foreAttr[n256] + attr |= n256foreAttr[n256%len(n256foreAttr)] i += 2 } } else if len(token) == 5 && token[i+1] == "2" { @@ -751,7 +765,7 @@ loop: n256setup() } attr &= foregroundMask - attr |= n256backAttr[n256] + attr |= n256backAttr[n256%len(n256backAttr)] i += 2 } } else if len(token) == 5 && token[i+1] == "2" { diff --git a/vendor/github.com/mattn/go-colorable/noncolorable.go b/vendor/github.com/mattn/go-colorable/noncolorable.go index 95f2c6b..05d6f74 100644 --- a/vendor/github.com/mattn/go-colorable/noncolorable.go +++ b/vendor/github.com/mattn/go-colorable/noncolorable.go @@ -18,18 +18,22 @@ func NewNonColorable(w io.Writer) io.Writer { // Write writes data on console func (w *NonColorable) Write(data []byte) (n int, err error) { er := bytes.NewReader(data) - var bw [1]byte + var plaintext bytes.Buffer loop: for { c1, err := er.ReadByte() if err != nil { + plaintext.WriteTo(w.out) break loop } if c1 != 0x1b { - bw[0] = c1 - w.out.Write(bw[:]) + plaintext.WriteByte(c1) continue } + _, err = plaintext.WriteTo(w.out) + if err != nil { + break loop + } c2, err := er.ReadByte() if err != nil { break loop @@ -38,7 +42,6 @@ loop: continue } - var buf bytes.Buffer for { c, err := er.ReadByte() if err != nil { @@ -47,7 +50,6 @@ loop: if ('a' <= c && c <= 'z') || ('A' <= c && c <= 'Z') || c == '@' { break } - buf.Write([]byte(string(c))) } } diff --git a/vendor/github.com/mattn/go-isatty/.travis.yml b/vendor/github.com/mattn/go-isatty/.travis.yml deleted file mode 100644 index 604314d..0000000 --- a/vendor/github.com/mattn/go-isatty/.travis.yml +++ /dev/null @@ -1,14 +0,0 @@ -language: go -sudo: false -go: - - 1.13.x - - tip - -before_install: - - go get -t -v ./... - -script: - - ./go.test.sh - -after_success: - - bash <(curl -s https://codecov.io/bash) diff --git a/vendor/github.com/mattn/go-isatty/isatty_bsd.go b/vendor/github.com/mattn/go-isatty/isatty_bsd.go index 711f288..d569c0c 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_bsd.go +++ b/vendor/github.com/mattn/go-isatty/isatty_bsd.go @@ -1,4 +1,5 @@ -// +build darwin freebsd openbsd netbsd dragonfly +//go:build (darwin || freebsd || openbsd || netbsd || dragonfly || hurd) && !appengine +// +build darwin freebsd openbsd netbsd dragonfly hurd // +build !appengine package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_others.go b/vendor/github.com/mattn/go-isatty/isatty_others.go index ff714a3..3150322 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_others.go +++ b/vendor/github.com/mattn/go-isatty/isatty_others.go @@ -1,4 +1,5 @@ -// +build appengine js nacl +//go:build appengine || js || nacl || wasm +// +build appengine js nacl wasm package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_plan9.go b/vendor/github.com/mattn/go-isatty/isatty_plan9.go index c5b6e0c..bae7f9b 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_plan9.go +++ b/vendor/github.com/mattn/go-isatty/isatty_plan9.go @@ -1,3 +1,4 @@ +//go:build plan9 // +build plan9 package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_solaris.go b/vendor/github.com/mattn/go-isatty/isatty_solaris.go index bdd5c79..0c3acf2 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_solaris.go +++ b/vendor/github.com/mattn/go-isatty/isatty_solaris.go @@ -1,5 +1,5 @@ -// +build solaris -// +build !appengine +//go:build solaris && !appengine +// +build solaris,!appengine package isatty @@ -8,10 +8,9 @@ import ( ) // IsTerminal returns true if the given file descriptor is a terminal. -// see: http://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libbc/libc/gen/common/isatty.c +// see: https://src.illumos.org/source/xref/illumos-gate/usr/src/lib/libc/port/gen/isatty.c func IsTerminal(fd uintptr) bool { - var termio unix.Termio - err := unix.IoctlSetTermio(int(fd), unix.TCGETA, &termio) + _, err := unix.IoctlGetTermio(int(fd), unix.TCGETA) return err == nil } diff --git a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go index 31a1ca9..6778765 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_tcgets.go +++ b/vendor/github.com/mattn/go-isatty/isatty_tcgets.go @@ -1,4 +1,5 @@ -// +build linux aix +//go:build (linux || aix || zos) && !appengine +// +build linux aix zos // +build !appengine package isatty diff --git a/vendor/github.com/mattn/go-isatty/isatty_windows.go b/vendor/github.com/mattn/go-isatty/isatty_windows.go index 1fa8691..8e3c991 100644 --- a/vendor/github.com/mattn/go-isatty/isatty_windows.go +++ b/vendor/github.com/mattn/go-isatty/isatty_windows.go @@ -1,5 +1,5 @@ -// +build windows -// +build !appengine +//go:build windows && !appengine +// +build windows,!appengine package isatty @@ -76,7 +76,7 @@ func isCygwinPipeName(name string) bool { } // getFileNameByHandle use the undocomented ntdll NtQueryObject to get file full name from file handler -// since GetFileInformationByHandleEx is not avilable under windows Vista and still some old fashion +// since GetFileInformationByHandleEx is not available under windows Vista and still some old fashion // guys are using Windows XP, this is a workaround for those guys, it will also work on system from // Windows vista to 10 // see https://stackoverflow.com/a/18792477 for details diff --git a/vendor/github.com/mattn/go-isatty/renovate.json b/vendor/github.com/mattn/go-isatty/renovate.json deleted file mode 100644 index 5ae9d96..0000000 --- a/vendor/github.com/mattn/go-isatty/renovate.json +++ /dev/null @@ -1,8 +0,0 @@ -{ - "extends": [ - "config:base" - ], - "postUpdateOptions": [ - "gomodTidy" - ] -} diff --git a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md b/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md index 1955f28..c758234 100644 --- a/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md +++ b/vendor/github.com/mitchellh/mapstructure/CHANGELOG.md @@ -1,6 +1,29 @@ -## unreleased +## 1.5.0 -* Fix regression where `*time.Time` value would be set to empty and not be sent +* New option `IgnoreUntaggedFields` to ignore decoding to any fields + without `mapstructure` (or the configured tag name) set [GH-277] +* New option `ErrorUnset` which makes it an error if any fields + in a target struct are not set by the decoding process. [GH-225] +* New function `OrComposeDecodeHookFunc` to help compose decode hooks. [GH-240] +* Decoding to slice from array no longer crashes [GH-265] +* Decode nested struct pointers to map [GH-271] +* Fix issue where `,squash` was ignored if `Squash` option was set. [GH-280] +* Fix issue where fields with `,omitempty` would sometimes decode + into a map with an empty string key [GH-281] + +## 1.4.3 + +* Fix cases where `json.Number` didn't decode properly [GH-261] + +## 1.4.2 + +* Custom name matchers to support any sort of casing, formatting, etc. for + field names. [GH-250] +* Fix possible panic in ComposeDecodeHookFunc [GH-251] + +## 1.4.1 + +* Fix regression where `*time.Time` value would be set to empty and not be sent to decode hooks properly [GH-232] ## 1.4.0 diff --git a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go b/vendor/github.com/mitchellh/mapstructure/decode_hooks.go index 92e6f76..3a754ca 100644 --- a/vendor/github.com/mitchellh/mapstructure/decode_hooks.go +++ b/vendor/github.com/mitchellh/mapstructure/decode_hooks.go @@ -62,7 +62,8 @@ func DecodeHookExec( func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { return func(f reflect.Value, t reflect.Value) (interface{}, error) { var err error - var data interface{} + data := f.Interface() + newFrom := f for _, f1 := range fs { data, err = DecodeHookExec(f1, newFrom, t) @@ -76,6 +77,28 @@ func ComposeDecodeHookFunc(fs ...DecodeHookFunc) DecodeHookFunc { } } +// OrComposeDecodeHookFunc executes all input hook functions until one of them returns no error. In that case its value is returned. +// If all hooks return an error, OrComposeDecodeHookFunc returns an error concatenating all error messages. +func OrComposeDecodeHookFunc(ff ...DecodeHookFunc) DecodeHookFunc { + return func(a, b reflect.Value) (interface{}, error) { + var allErrs string + var out interface{} + var err error + + for _, f := range ff { + out, err = DecodeHookExec(f, a, b) + if err != nil { + allErrs += err.Error() + "\n" + continue + } + + return out, nil + } + + return nil, errors.New(allErrs) + } +} + // StringToSliceHookFunc returns a DecodeHookFunc that converts // string to []string by splitting on the given sep. func StringToSliceHookFunc(sep string) DecodeHookFunc { diff --git a/vendor/github.com/mitchellh/mapstructure/mapstructure.go b/vendor/github.com/mitchellh/mapstructure/mapstructure.go index 3643901..1efb22a 100644 --- a/vendor/github.com/mitchellh/mapstructure/mapstructure.go +++ b/vendor/github.com/mitchellh/mapstructure/mapstructure.go @@ -122,7 +122,7 @@ // field value is zero and a numeric type, the field is empty, and it won't // be encoded into the destination type. // -// type Source { +// type Source struct { // Age int `mapstructure:",omitempty"` // } // @@ -192,7 +192,7 @@ type DecodeHookFuncType func(reflect.Type, reflect.Type, interface{}) (interface // source and target types. type DecodeHookFuncKind func(reflect.Kind, reflect.Kind, interface{}) (interface{}, error) -// DecodeHookFuncRaw is a DecodeHookFunc which has complete access to both the source and target +// DecodeHookFuncValue is a DecodeHookFunc which has complete access to both the source and target // values. type DecodeHookFuncValue func(from reflect.Value, to reflect.Value) (interface{}, error) @@ -215,6 +215,12 @@ type DecoderConfig struct { // (extra keys). ErrorUnused bool + // If ErrorUnset is true, then it is an error for there to exist + // fields in the result that were not set in the decoding process + // (extra fields). This only applies to decoding to a struct. This + // will affect all nested structs as well. + ErrorUnset bool + // ZeroFields, if set to true, will zero fields before writing them. // For example, a map will be emptied before decoded values are put in // it. If this is false, a map will be merged. @@ -258,6 +264,15 @@ type DecoderConfig struct { // The tag name that mapstructure reads for field names. This // defaults to "mapstructure" TagName string + + // IgnoreUntaggedFields ignores all struct fields without explicit + // TagName, comparable to `mapstructure:"-"` as default behaviour. + IgnoreUntaggedFields bool + + // MatchName is the function used to match the map key to the struct + // field name or tag. Defaults to `strings.EqualFold`. This can be used + // to implement case-sensitive tag values, support snake casing, etc. + MatchName func(mapKey, fieldName string) bool } // A Decoder takes a raw interface value and turns it into structured @@ -279,6 +294,11 @@ type Metadata struct { // Unused is a slice of keys that were found in the raw value but // weren't decoded since there was no matching field in the result interface Unused []string + + // Unset is a slice of field names that were found in the result interface + // but weren't set in the decoding process since there was no matching value + // in the input + Unset []string } // Decode takes an input structure and uses reflection to translate it to @@ -370,12 +390,20 @@ func NewDecoder(config *DecoderConfig) (*Decoder, error) { if config.Metadata.Unused == nil { config.Metadata.Unused = make([]string, 0) } + + if config.Metadata.Unset == nil { + config.Metadata.Unset = make([]string, 0) + } } if config.TagName == "" { config.TagName = "mapstructure" } + if config.MatchName == nil { + config.MatchName = strings.EqualFold + } + result := &Decoder{ config: config, } @@ -675,16 +703,12 @@ func (d *Decoder) decodeUint(name string, data interface{}, val reflect.Value) e } case dataType.PkgPath() == "encoding/json" && dataType.Name() == "Number": jn := data.(json.Number) - i, err := jn.Int64() + i, err := strconv.ParseUint(string(jn), 0, 64) if err != nil { return fmt.Errorf( "error decoding json.Number into %s: %s", name, err) } - if i < 0 && !d.config.WeaklyTypedInput { - return fmt.Errorf("cannot parse '%s', %d overflows uint", - name, i) - } - val.SetUint(uint64(i)) + val.SetUint(i) default: return fmt.Errorf( "'%s' expected type '%s', got unconvertible type '%s', value: '%v'", @@ -901,9 +925,15 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re tagValue := f.Tag.Get(d.config.TagName) keyName := f.Name + if tagValue == "" && d.config.IgnoreUntaggedFields { + continue + } + // If Squash is set in the config, we squash the field down. squash := d.config.Squash && v.Kind() == reflect.Struct && f.Anonymous + v = dereferencePtrToStructIfNeeded(v, d.config.TagName) + // Determine the name of the key in the map if index := strings.Index(tagValue, ","); index != -1 { if tagValue[:index] == "-" { @@ -915,7 +945,7 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re } // If "squash" is specified in the tag, we squash the field down. - squash = !squash && strings.Index(tagValue[index+1:], "squash") != -1 + squash = squash || strings.Index(tagValue[index+1:], "squash") != -1 if squash { // When squashing, the embedded type can be a pointer to a struct. if v.Kind() == reflect.Ptr && v.Elem().Kind() == reflect.Struct { @@ -927,7 +957,9 @@ func (d *Decoder) decodeMapFromStruct(name string, dataVal reflect.Value, val re return fmt.Errorf("cannot squash non-struct type '%s'", v.Type()) } } - keyName = tagValue[:index] + if keyNameTagValue := tagValue[:index]; keyNameTagValue != "" { + keyName = keyNameTagValue + } } else if len(tagValue) > 0 { if tagValue == "-" { continue @@ -1083,7 +1115,7 @@ func (d *Decoder) decodeSlice(name string, data interface{}, val reflect.Value) } // If the input value is nil, then don't allocate since empty != nil - if dataVal.IsNil() { + if dataValKind != reflect.Array && dataVal.IsNil() { return nil } @@ -1245,6 +1277,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e dataValKeysUnused[dataValKey.Interface()] = struct{}{} } + targetValKeysUnused := make(map[interface{}]struct{}) errors := make([]string, 0) // This slice will keep track of all the structs we'll be decoding. @@ -1340,7 +1373,7 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e continue } - if strings.EqualFold(mK, fieldName) { + if d.config.MatchName(mK, fieldName) { rawMapKey = dataValKey rawMapVal = dataVal.MapIndex(dataValKey) break @@ -1349,7 +1382,8 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e if !rawMapVal.IsValid() { // There was no matching key in the map for the value in - // the struct. Just ignore. + // the struct. Remember it for potential errors and metadata. + targetValKeysUnused[fieldName] = struct{}{} continue } } @@ -1409,6 +1443,17 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e errors = appendErrors(errors, err) } + if d.config.ErrorUnset && len(targetValKeysUnused) > 0 { + keys := make([]string, 0, len(targetValKeysUnused)) + for rawKey := range targetValKeysUnused { + keys = append(keys, rawKey.(string)) + } + sort.Strings(keys) + + err := fmt.Errorf("'%s' has unset fields: %s", name, strings.Join(keys, ", ")) + errors = appendErrors(errors, err) + } + if len(errors) > 0 { return &Error{errors} } @@ -1423,6 +1468,14 @@ func (d *Decoder) decodeStructFromMap(name string, dataVal, val reflect.Value) e d.config.Metadata.Unused = append(d.config.Metadata.Unused, key) } + for rawKey := range targetValKeysUnused { + key := rawKey.(string) + if name != "" { + key = name + "." + key + } + + d.config.Metadata.Unset = append(d.config.Metadata.Unset, key) + } } return nil @@ -1460,3 +1513,28 @@ func getKind(val reflect.Value) reflect.Kind { return kind } } + +func isStructTypeConvertibleToMap(typ reflect.Type, checkMapstructureTags bool, tagName string) bool { + for i := 0; i < typ.NumField(); i++ { + f := typ.Field(i) + if f.PkgPath == "" && !checkMapstructureTags { // check for unexported fields + return true + } + if checkMapstructureTags && f.Tag.Get(tagName) != "" { // check for mapstructure tags inside + return true + } + } + return false +} + +func dereferencePtrToStructIfNeeded(v reflect.Value, tagName string) reflect.Value { + if v.Kind() != reflect.Ptr || v.Elem().Kind() != reflect.Struct { + return v + } + deref := v.Elem() + derefT := deref.Type() + if isStructTypeConvertibleToMap(derefT, true, tagName) { + return deref + } + return v +} diff --git a/vendor/golang.org/x/exp/LICENSE b/vendor/golang.org/x/exp/LICENSE new file mode 100644 index 0000000..6a66aea --- /dev/null +++ b/vendor/golang.org/x/exp/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2009 The Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/golang.org/x/exp/PATENTS b/vendor/golang.org/x/exp/PATENTS new file mode 100644 index 0000000..7330990 --- /dev/null +++ b/vendor/golang.org/x/exp/PATENTS @@ -0,0 +1,22 @@ +Additional IP Rights Grant (Patents) + +"This implementation" means the copyrightable works distributed by +Google as part of the Go project. + +Google hereby grants to You a perpetual, worldwide, non-exclusive, +no-charge, royalty-free, irrevocable (except as stated in this section) +patent license to make, have made, use, offer to sell, sell, import, +transfer and otherwise run, modify and propagate the contents of this +implementation of Go, where such license applies only to those patent +claims, both currently owned or controlled by Google and acquired in +the future, licensable by Google that are necessarily infringed by this +implementation of Go. This grant does not include claims that would be +infringed only as a consequence of further modification of this +implementation. If you or your agent or exclusive licensee institute or +order or agree to the institution of patent litigation against any +entity (including a cross-claim or counterclaim in a lawsuit) alleging +that this implementation of Go or any code incorporated within this +implementation of Go constitutes direct or contributory patent +infringement, or inducement of patent infringement, then any patent +rights granted to you under this License for this implementation of Go +shall terminate as of the date such litigation is filed. diff --git a/vendor/golang.org/x/exp/constraints/constraints.go b/vendor/golang.org/x/exp/constraints/constraints.go new file mode 100644 index 0000000..2c033df --- /dev/null +++ b/vendor/golang.org/x/exp/constraints/constraints.go @@ -0,0 +1,50 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package constraints defines a set of useful constraints to be used +// with type parameters. +package constraints + +// Signed is a constraint that permits any signed integer type. +// If future releases of Go add new predeclared signed integer types, +// this constraint will be modified to include them. +type Signed interface { + ~int | ~int8 | ~int16 | ~int32 | ~int64 +} + +// Unsigned is a constraint that permits any unsigned integer type. +// If future releases of Go add new predeclared unsigned integer types, +// this constraint will be modified to include them. +type Unsigned interface { + ~uint | ~uint8 | ~uint16 | ~uint32 | ~uint64 | ~uintptr +} + +// Integer is a constraint that permits any integer type. +// If future releases of Go add new predeclared integer types, +// this constraint will be modified to include them. +type Integer interface { + Signed | Unsigned +} + +// Float is a constraint that permits any floating-point type. +// If future releases of Go add new predeclared floating-point types, +// this constraint will be modified to include them. +type Float interface { + ~float32 | ~float64 +} + +// Complex is a constraint that permits any complex numeric type. +// If future releases of Go add new predeclared complex numeric types, +// this constraint will be modified to include them. +type Complex interface { + ~complex64 | ~complex128 +} + +// Ordered is a constraint that permits any ordered type: any type +// that supports the operators < <= >= >. +// If future releases of Go add new ordered types, +// this constraint will be modified to include them. +type Ordered interface { + Integer | Float | ~string +} diff --git a/vendor/golang.org/x/exp/slices/slices.go b/vendor/golang.org/x/exp/slices/slices.go new file mode 100644 index 0000000..cff0cd4 --- /dev/null +++ b/vendor/golang.org/x/exp/slices/slices.go @@ -0,0 +1,258 @@ +// Copyright 2021 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package slices defines various functions useful with slices of any type. +// Unless otherwise specified, these functions all apply to the elements +// of a slice at index 0 <= i < len(s). +// +// Note that the less function in IsSortedFunc, SortFunc, SortStableFunc requires a +// strict weak ordering (https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings), +// or the sorting may fail to sort correctly. A common case is when sorting slices of +// floating-point numbers containing NaN values. +package slices + +import "golang.org/x/exp/constraints" + +// Equal reports whether two slices are equal: the same length and all +// elements equal. If the lengths are different, Equal returns false. +// Otherwise, the elements are compared in increasing index order, and the +// comparison stops at the first unequal pair. +// Floating point NaNs are not considered equal. +func Equal[E comparable](s1, s2 []E) bool { + if len(s1) != len(s2) { + return false + } + for i := range s1 { + if s1[i] != s2[i] { + return false + } + } + return true +} + +// EqualFunc reports whether two slices are equal using a comparison +// function on each pair of elements. If the lengths are different, +// EqualFunc returns false. Otherwise, the elements are compared in +// increasing index order, and the comparison stops at the first index +// for which eq returns false. +func EqualFunc[E1, E2 any](s1 []E1, s2 []E2, eq func(E1, E2) bool) bool { + if len(s1) != len(s2) { + return false + } + for i, v1 := range s1 { + v2 := s2[i] + if !eq(v1, v2) { + return false + } + } + return true +} + +// Compare compares the elements of s1 and s2. +// The elements are compared sequentially, starting at index 0, +// until one element is not equal to the other. +// The result of comparing the first non-matching elements is returned. +// If both slices are equal until one of them ends, the shorter slice is +// considered less than the longer one. +// The result is 0 if s1 == s2, -1 if s1 < s2, and +1 if s1 > s2. +// Comparisons involving floating point NaNs are ignored. +func Compare[E constraints.Ordered](s1, s2 []E) int { + s2len := len(s2) + for i, v1 := range s1 { + if i >= s2len { + return +1 + } + v2 := s2[i] + switch { + case v1 < v2: + return -1 + case v1 > v2: + return +1 + } + } + if len(s1) < s2len { + return -1 + } + return 0 +} + +// CompareFunc is like Compare but uses a comparison function +// on each pair of elements. The elements are compared in increasing +// index order, and the comparisons stop after the first time cmp +// returns non-zero. +// The result is the first non-zero result of cmp; if cmp always +// returns 0 the result is 0 if len(s1) == len(s2), -1 if len(s1) < len(s2), +// and +1 if len(s1) > len(s2). +func CompareFunc[E1, E2 any](s1 []E1, s2 []E2, cmp func(E1, E2) int) int { + s2len := len(s2) + for i, v1 := range s1 { + if i >= s2len { + return +1 + } + v2 := s2[i] + if c := cmp(v1, v2); c != 0 { + return c + } + } + if len(s1) < s2len { + return -1 + } + return 0 +} + +// Index returns the index of the first occurrence of v in s, +// or -1 if not present. +func Index[E comparable](s []E, v E) int { + for i, vs := range s { + if v == vs { + return i + } + } + return -1 +} + +// IndexFunc returns the first index i satisfying f(s[i]), +// or -1 if none do. +func IndexFunc[E any](s []E, f func(E) bool) int { + for i, v := range s { + if f(v) { + return i + } + } + return -1 +} + +// Contains reports whether v is present in s. +func Contains[E comparable](s []E, v E) bool { + return Index(s, v) >= 0 +} + +// ContainsFunc reports whether at least one +// element e of s satisfies f(e). +func ContainsFunc[E any](s []E, f func(E) bool) bool { + return IndexFunc(s, f) >= 0 +} + +// Insert inserts the values v... into s at index i, +// returning the modified slice. +// In the returned slice r, r[i] == v[0]. +// Insert panics if i is out of range. +// This function is O(len(s) + len(v)). +func Insert[S ~[]E, E any](s S, i int, v ...E) S { + tot := len(s) + len(v) + if tot <= cap(s) { + s2 := s[:tot] + copy(s2[i+len(v):], s[i:]) + copy(s2[i:], v) + return s2 + } + s2 := make(S, tot) + copy(s2, s[:i]) + copy(s2[i:], v) + copy(s2[i+len(v):], s[i:]) + return s2 +} + +// Delete removes the elements s[i:j] from s, returning the modified slice. +// Delete panics if s[i:j] is not a valid slice of s. +// Delete modifies the contents of the slice s; it does not create a new slice. +// Delete is O(len(s)-j), so if many items must be deleted, it is better to +// make a single call deleting them all together than to delete one at a time. +// Delete might not modify the elements s[len(s)-(j-i):len(s)]. If those +// elements contain pointers you might consider zeroing those elements so that +// objects they reference can be garbage collected. +func Delete[S ~[]E, E any](s S, i, j int) S { + _ = s[i:j] // bounds check + + return append(s[:i], s[j:]...) +} + +// Replace replaces the elements s[i:j] by the given v, and returns the +// modified slice. Replace panics if s[i:j] is not a valid slice of s. +func Replace[S ~[]E, E any](s S, i, j int, v ...E) S { + _ = s[i:j] // verify that i:j is a valid subslice + tot := len(s[:i]) + len(v) + len(s[j:]) + if tot <= cap(s) { + s2 := s[:tot] + copy(s2[i+len(v):], s[j:]) + copy(s2[i:], v) + return s2 + } + s2 := make(S, tot) + copy(s2, s[:i]) + copy(s2[i:], v) + copy(s2[i+len(v):], s[j:]) + return s2 +} + +// Clone returns a copy of the slice. +// The elements are copied using assignment, so this is a shallow clone. +func Clone[S ~[]E, E any](s S) S { + // Preserve nil in case it matters. + if s == nil { + return nil + } + return append(S([]E{}), s...) +} + +// Compact replaces consecutive runs of equal elements with a single copy. +// This is like the uniq command found on Unix. +// Compact modifies the contents of the slice s; it does not create a new slice. +// When Compact discards m elements in total, it might not modify the elements +// s[len(s)-m:len(s)]. If those elements contain pointers you might consider +// zeroing those elements so that objects they reference can be garbage collected. +func Compact[S ~[]E, E comparable](s S) S { + if len(s) < 2 { + return s + } + i := 1 + last := s[0] + for _, v := range s[1:] { + if v != last { + s[i] = v + i++ + last = v + } + } + return s[:i] +} + +// CompactFunc is like Compact but uses a comparison function. +func CompactFunc[S ~[]E, E any](s S, eq func(E, E) bool) S { + if len(s) < 2 { + return s + } + i := 1 + last := s[0] + for _, v := range s[1:] { + if !eq(v, last) { + s[i] = v + i++ + last = v + } + } + return s[:i] +} + +// Grow increases the slice's capacity, if necessary, to guarantee space for +// another n elements. After Grow(n), at least n elements can be appended +// to the slice without another allocation. If n is negative or too large to +// allocate the memory, Grow panics. +func Grow[S ~[]E, E any](s S, n int) S { + if n < 0 { + panic("cannot be negative") + } + if n -= cap(s) - len(s); n > 0 { + // TODO(https://go.dev/issue/53888): Make using []E instead of S + // to workaround a compiler bug where the runtime.growslice optimization + // does not take effect. Revert when the compiler is fixed. + s = append([]E(s)[:cap(s)], make([]E, n)...)[:len(s)] + } + return s +} + +// Clip removes unused capacity from the slice, returning s[:len(s):len(s)]. +func Clip[S ~[]E, E any](s S) S { + return s[:len(s):len(s)] +} diff --git a/vendor/golang.org/x/exp/slices/sort.go b/vendor/golang.org/x/exp/slices/sort.go new file mode 100644 index 0000000..f14f40d --- /dev/null +++ b/vendor/golang.org/x/exp/slices/sort.go @@ -0,0 +1,126 @@ +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +import ( + "math/bits" + + "golang.org/x/exp/constraints" +) + +// Sort sorts a slice of any ordered type in ascending order. +// Sort may fail to sort correctly when sorting slices of floating-point +// numbers containing Not-a-number (NaN) values. +// Use slices.SortFunc(x, func(a, b float64) bool {return a < b || (math.IsNaN(a) && !math.IsNaN(b))}) +// instead if the input may contain NaNs. +func Sort[E constraints.Ordered](x []E) { + n := len(x) + pdqsortOrdered(x, 0, n, bits.Len(uint(n))) +} + +// SortFunc sorts the slice x in ascending order as determined by the less function. +// This sort is not guaranteed to be stable. +// +// SortFunc requires that less is a strict weak ordering. +// See https://en.wikipedia.org/wiki/Weak_ordering#Strict_weak_orderings. +func SortFunc[E any](x []E, less func(a, b E) bool) { + n := len(x) + pdqsortLessFunc(x, 0, n, bits.Len(uint(n)), less) +} + +// SortStableFunc sorts the slice x while keeping the original order of equal +// elements, using less to compare elements. +func SortStableFunc[E any](x []E, less func(a, b E) bool) { + stableLessFunc(x, len(x), less) +} + +// IsSorted reports whether x is sorted in ascending order. +func IsSorted[E constraints.Ordered](x []E) bool { + for i := len(x) - 1; i > 0; i-- { + if x[i] < x[i-1] { + return false + } + } + return true +} + +// IsSortedFunc reports whether x is sorted in ascending order, with less as the +// comparison function. +func IsSortedFunc[E any](x []E, less func(a, b E) bool) bool { + for i := len(x) - 1; i > 0; i-- { + if less(x[i], x[i-1]) { + return false + } + } + return true +} + +// BinarySearch searches for target in a sorted slice and returns the position +// where target is found, or the position where target would appear in the +// sort order; it also returns a bool saying whether the target is really found +// in the slice. The slice must be sorted in increasing order. +func BinarySearch[E constraints.Ordered](x []E, target E) (int, bool) { + // Inlining is faster than calling BinarySearchFunc with a lambda. + n := len(x) + // Define x[-1] < target and x[n] >= target. + // Invariant: x[i-1] < target, x[j] >= target. + i, j := 0, n + for i < j { + h := int(uint(i+j) >> 1) // avoid overflow when computing h + // i ≤ h < j + if x[h] < target { + i = h + 1 // preserves x[i-1] < target + } else { + j = h // preserves x[j] >= target + } + } + // i == j, x[i-1] < target, and x[j] (= x[i]) >= target => answer is i. + return i, i < n && x[i] == target +} + +// BinarySearchFunc works like BinarySearch, but uses a custom comparison +// function. The slice must be sorted in increasing order, where "increasing" is +// defined by cmp. cmp(a, b) is expected to return an integer comparing the two +// parameters: 0 if a == b, a negative number if a < b and a positive number if +// a > b. +func BinarySearchFunc[E, T any](x []E, target T, cmp func(E, T) int) (int, bool) { + n := len(x) + // Define cmp(x[-1], target) < 0 and cmp(x[n], target) >= 0 . + // Invariant: cmp(x[i - 1], target) < 0, cmp(x[j], target) >= 0. + i, j := 0, n + for i < j { + h := int(uint(i+j) >> 1) // avoid overflow when computing h + // i ≤ h < j + if cmp(x[h], target) < 0 { + i = h + 1 // preserves cmp(x[i - 1], target) < 0 + } else { + j = h // preserves cmp(x[j], target) >= 0 + } + } + // i == j, cmp(x[i-1], target) < 0, and cmp(x[j], target) (= cmp(x[i], target)) >= 0 => answer is i. + return i, i < n && cmp(x[i], target) == 0 +} + +type sortedHint int // hint for pdqsort when choosing the pivot + +const ( + unknownHint sortedHint = iota + increasingHint + decreasingHint +) + +// xorshift paper: https://www.jstatsoft.org/article/view/v008i14/xorshift.pdf +type xorshift uint64 + +func (r *xorshift) Next() uint64 { + *r ^= *r << 13 + *r ^= *r >> 17 + *r ^= *r << 5 + return uint64(*r) +} + +func nextPowerOfTwo(length int) uint { + return 1 << bits.Len(uint(length)) +} diff --git a/vendor/golang.org/x/exp/slices/zsortfunc.go b/vendor/golang.org/x/exp/slices/zsortfunc.go new file mode 100644 index 0000000..2a63247 --- /dev/null +++ b/vendor/golang.org/x/exp/slices/zsortfunc.go @@ -0,0 +1,479 @@ +// Code generated by gen_sort_variants.go; DO NOT EDIT. + +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +// insertionSortLessFunc sorts data[a:b] using insertion sort. +func insertionSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) { + for i := a + 1; i < b; i++ { + for j := i; j > a && less(data[j], data[j-1]); j-- { + data[j], data[j-1] = data[j-1], data[j] + } + } +} + +// siftDownLessFunc implements the heap property on data[lo:hi]. +// first is an offset into the array where the root of the heap lies. +func siftDownLessFunc[E any](data []E, lo, hi, first int, less func(a, b E) bool) { + root := lo + for { + child := 2*root + 1 + if child >= hi { + break + } + if child+1 < hi && less(data[first+child], data[first+child+1]) { + child++ + } + if !less(data[first+root], data[first+child]) { + return + } + data[first+root], data[first+child] = data[first+child], data[first+root] + root = child + } +} + +func heapSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) { + first := a + lo := 0 + hi := b - a + + // Build heap with greatest element at top. + for i := (hi - 1) / 2; i >= 0; i-- { + siftDownLessFunc(data, i, hi, first, less) + } + + // Pop elements, largest first, into end of data. + for i := hi - 1; i >= 0; i-- { + data[first], data[first+i] = data[first+i], data[first] + siftDownLessFunc(data, lo, i, first, less) + } +} + +// pdqsortLessFunc sorts data[a:b]. +// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. +// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf +// C++ implementation: https://github.com/orlp/pdqsort +// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ +// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. +func pdqsortLessFunc[E any](data []E, a, b, limit int, less func(a, b E) bool) { + const maxInsertion = 12 + + var ( + wasBalanced = true // whether the last partitioning was reasonably balanced + wasPartitioned = true // whether the slice was already partitioned + ) + + for { + length := b - a + + if length <= maxInsertion { + insertionSortLessFunc(data, a, b, less) + return + } + + // Fall back to heapsort if too many bad choices were made. + if limit == 0 { + heapSortLessFunc(data, a, b, less) + return + } + + // If the last partitioning was imbalanced, we need to breaking patterns. + if !wasBalanced { + breakPatternsLessFunc(data, a, b, less) + limit-- + } + + pivot, hint := choosePivotLessFunc(data, a, b, less) + if hint == decreasingHint { + reverseRangeLessFunc(data, a, b, less) + // The chosen pivot was pivot-a elements after the start of the array. + // After reversing it is pivot-a elements before the end of the array. + // The idea came from Rust's implementation. + pivot = (b - 1) - (pivot - a) + hint = increasingHint + } + + // The slice is likely already sorted. + if wasBalanced && wasPartitioned && hint == increasingHint { + if partialInsertionSortLessFunc(data, a, b, less) { + return + } + } + + // Probably the slice contains many duplicate elements, partition the slice into + // elements equal to and elements greater than the pivot. + if a > 0 && !less(data[a-1], data[pivot]) { + mid := partitionEqualLessFunc(data, a, b, pivot, less) + a = mid + continue + } + + mid, alreadyPartitioned := partitionLessFunc(data, a, b, pivot, less) + wasPartitioned = alreadyPartitioned + + leftLen, rightLen := mid-a, b-mid + balanceThreshold := length / 8 + if leftLen < rightLen { + wasBalanced = leftLen >= balanceThreshold + pdqsortLessFunc(data, a, mid, limit, less) + a = mid + 1 + } else { + wasBalanced = rightLen >= balanceThreshold + pdqsortLessFunc(data, mid+1, b, limit, less) + b = mid + } + } +} + +// partitionLessFunc does one quicksort partition. +// Let p = data[pivot] +// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. +// On return, data[newpivot] = p +func partitionLessFunc[E any](data []E, a, b, pivot int, less func(a, b E) bool) (newpivot int, alreadyPartitioned bool) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for i <= j && less(data[i], data[a]) { + i++ + } + for i <= j && !less(data[j], data[a]) { + j-- + } + if i > j { + data[j], data[a] = data[a], data[j] + return j, true + } + data[i], data[j] = data[j], data[i] + i++ + j-- + + for { + for i <= j && less(data[i], data[a]) { + i++ + } + for i <= j && !less(data[j], data[a]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + data[j], data[a] = data[a], data[j] + return j, false +} + +// partitionEqualLessFunc partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. +// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. +func partitionEqualLessFunc[E any](data []E, a, b, pivot int, less func(a, b E) bool) (newpivot int) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for { + for i <= j && !less(data[a], data[i]) { + i++ + } + for i <= j && less(data[a], data[j]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + return i +} + +// partialInsertionSortLessFunc partially sorts a slice, returns true if the slice is sorted at the end. +func partialInsertionSortLessFunc[E any](data []E, a, b int, less func(a, b E) bool) bool { + const ( + maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted + shortestShifting = 50 // don't shift any elements on short arrays + ) + i := a + 1 + for j := 0; j < maxSteps; j++ { + for i < b && !less(data[i], data[i-1]) { + i++ + } + + if i == b { + return true + } + + if b-a < shortestShifting { + return false + } + + data[i], data[i-1] = data[i-1], data[i] + + // Shift the smaller one to the left. + if i-a >= 2 { + for j := i - 1; j >= 1; j-- { + if !less(data[j], data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + // Shift the greater one to the right. + if b-i >= 2 { + for j := i + 1; j < b; j++ { + if !less(data[j], data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + } + return false +} + +// breakPatternsLessFunc scatters some elements around in an attempt to break some patterns +// that might cause imbalanced partitions in quicksort. +func breakPatternsLessFunc[E any](data []E, a, b int, less func(a, b E) bool) { + length := b - a + if length >= 8 { + random := xorshift(length) + modulus := nextPowerOfTwo(length) + + for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { + other := int(uint(random.Next()) & (modulus - 1)) + if other >= length { + other -= length + } + data[idx], data[a+other] = data[a+other], data[idx] + } + } +} + +// choosePivotLessFunc chooses a pivot in data[a:b]. +// +// [0,8): chooses a static pivot. +// [8,shortestNinther): uses the simple median-of-three method. +// [shortestNinther,∞): uses the Tukey ninther method. +func choosePivotLessFunc[E any](data []E, a, b int, less func(a, b E) bool) (pivot int, hint sortedHint) { + const ( + shortestNinther = 50 + maxSwaps = 4 * 3 + ) + + l := b - a + + var ( + swaps int + i = a + l/4*1 + j = a + l/4*2 + k = a + l/4*3 + ) + + if l >= 8 { + if l >= shortestNinther { + // Tukey ninther method, the idea came from Rust's implementation. + i = medianAdjacentLessFunc(data, i, &swaps, less) + j = medianAdjacentLessFunc(data, j, &swaps, less) + k = medianAdjacentLessFunc(data, k, &swaps, less) + } + // Find the median among i, j, k and stores it into j. + j = medianLessFunc(data, i, j, k, &swaps, less) + } + + switch swaps { + case 0: + return j, increasingHint + case maxSwaps: + return j, decreasingHint + default: + return j, unknownHint + } +} + +// order2LessFunc returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. +func order2LessFunc[E any](data []E, a, b int, swaps *int, less func(a, b E) bool) (int, int) { + if less(data[b], data[a]) { + *swaps++ + return b, a + } + return a, b +} + +// medianLessFunc returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. +func medianLessFunc[E any](data []E, a, b, c int, swaps *int, less func(a, b E) bool) int { + a, b = order2LessFunc(data, a, b, swaps, less) + b, c = order2LessFunc(data, b, c, swaps, less) + a, b = order2LessFunc(data, a, b, swaps, less) + return b +} + +// medianAdjacentLessFunc finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. +func medianAdjacentLessFunc[E any](data []E, a int, swaps *int, less func(a, b E) bool) int { + return medianLessFunc(data, a-1, a, a+1, swaps, less) +} + +func reverseRangeLessFunc[E any](data []E, a, b int, less func(a, b E) bool) { + i := a + j := b - 1 + for i < j { + data[i], data[j] = data[j], data[i] + i++ + j-- + } +} + +func swapRangeLessFunc[E any](data []E, a, b, n int, less func(a, b E) bool) { + for i := 0; i < n; i++ { + data[a+i], data[b+i] = data[b+i], data[a+i] + } +} + +func stableLessFunc[E any](data []E, n int, less func(a, b E) bool) { + blockSize := 20 // must be > 0 + a, b := 0, blockSize + for b <= n { + insertionSortLessFunc(data, a, b, less) + a = b + b += blockSize + } + insertionSortLessFunc(data, a, n, less) + + for blockSize < n { + a, b = 0, 2*blockSize + for b <= n { + symMergeLessFunc(data, a, a+blockSize, b, less) + a = b + b += 2 * blockSize + } + if m := a + blockSize; m < n { + symMergeLessFunc(data, a, m, n, less) + } + blockSize *= 2 + } +} + +// symMergeLessFunc merges the two sorted subsequences data[a:m] and data[m:b] using +// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum +// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz +// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in +// Computer Science, pages 714-723. Springer, 2004. +// +// Let M = m-a and N = b-n. Wolog M < N. +// The recursion depth is bound by ceil(log(N+M)). +// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. +// The algorithm needs O((M+N)*log(M)) calls to data.Swap. +// +// The paper gives O((M+N)*log(M)) as the number of assignments assuming a +// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation +// in the paper carries through for Swap operations, especially as the block +// swapping rotate uses only O(M+N) Swaps. +// +// symMerge assumes non-degenerate arguments: a < m && m < b. +// Having the caller check this condition eliminates many leaf recursion calls, +// which improves performance. +func symMergeLessFunc[E any](data []E, a, m, b int, less func(a, b E) bool) { + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[a] into data[m:b] + // if data[a:m] only contains one element. + if m-a == 1 { + // Use binary search to find the lowest index i + // such that data[i] >= data[a] for m <= i < b. + // Exit the search loop with i == b in case no such index exists. + i := m + j := b + for i < j { + h := int(uint(i+j) >> 1) + if less(data[h], data[a]) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[a] reaches the position before i. + for k := a; k < i-1; k++ { + data[k], data[k+1] = data[k+1], data[k] + } + return + } + + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[m] into data[a:m] + // if data[m:b] only contains one element. + if b-m == 1 { + // Use binary search to find the lowest index i + // such that data[i] > data[m] for a <= i < m. + // Exit the search loop with i == m in case no such index exists. + i := a + j := m + for i < j { + h := int(uint(i+j) >> 1) + if !less(data[m], data[h]) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[m] reaches the position i. + for k := m; k > i; k-- { + data[k], data[k-1] = data[k-1], data[k] + } + return + } + + mid := int(uint(a+b) >> 1) + n := mid + m + var start, r int + if m > mid { + start = n - b + r = mid + } else { + start = a + r = m + } + p := n - 1 + + for start < r { + c := int(uint(start+r) >> 1) + if !less(data[p-c], data[c]) { + start = c + 1 + } else { + r = c + } + } + + end := n - start + if start < m && m < end { + rotateLessFunc(data, start, m, end, less) + } + if a < start && start < mid { + symMergeLessFunc(data, a, start, mid, less) + } + if mid < end && end < b { + symMergeLessFunc(data, mid, end, b, less) + } +} + +// rotateLessFunc rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: +// Data of the form 'x u v y' is changed to 'x v u y'. +// rotate performs at most b-a many calls to data.Swap, +// and it assumes non-degenerate arguments: a < m && m < b. +func rotateLessFunc[E any](data []E, a, m, b int, less func(a, b E) bool) { + i := m - a + j := b - m + + for i != j { + if i > j { + swapRangeLessFunc(data, m-i, m, j, less) + i -= j + } else { + swapRangeLessFunc(data, m-i, m+j-i, i, less) + j -= i + } + } + // i == j + swapRangeLessFunc(data, m-i, m, i, less) +} diff --git a/vendor/golang.org/x/exp/slices/zsortordered.go b/vendor/golang.org/x/exp/slices/zsortordered.go new file mode 100644 index 0000000..efaa1c8 --- /dev/null +++ b/vendor/golang.org/x/exp/slices/zsortordered.go @@ -0,0 +1,481 @@ +// Code generated by gen_sort_variants.go; DO NOT EDIT. + +// Copyright 2022 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package slices + +import "golang.org/x/exp/constraints" + +// insertionSortOrdered sorts data[a:b] using insertion sort. +func insertionSortOrdered[E constraints.Ordered](data []E, a, b int) { + for i := a + 1; i < b; i++ { + for j := i; j > a && (data[j] < data[j-1]); j-- { + data[j], data[j-1] = data[j-1], data[j] + } + } +} + +// siftDownOrdered implements the heap property on data[lo:hi]. +// first is an offset into the array where the root of the heap lies. +func siftDownOrdered[E constraints.Ordered](data []E, lo, hi, first int) { + root := lo + for { + child := 2*root + 1 + if child >= hi { + break + } + if child+1 < hi && (data[first+child] < data[first+child+1]) { + child++ + } + if !(data[first+root] < data[first+child]) { + return + } + data[first+root], data[first+child] = data[first+child], data[first+root] + root = child + } +} + +func heapSortOrdered[E constraints.Ordered](data []E, a, b int) { + first := a + lo := 0 + hi := b - a + + // Build heap with greatest element at top. + for i := (hi - 1) / 2; i >= 0; i-- { + siftDownOrdered(data, i, hi, first) + } + + // Pop elements, largest first, into end of data. + for i := hi - 1; i >= 0; i-- { + data[first], data[first+i] = data[first+i], data[first] + siftDownOrdered(data, lo, i, first) + } +} + +// pdqsortOrdered sorts data[a:b]. +// The algorithm based on pattern-defeating quicksort(pdqsort), but without the optimizations from BlockQuicksort. +// pdqsort paper: https://arxiv.org/pdf/2106.05123.pdf +// C++ implementation: https://github.com/orlp/pdqsort +// Rust implementation: https://docs.rs/pdqsort/latest/pdqsort/ +// limit is the number of allowed bad (very unbalanced) pivots before falling back to heapsort. +func pdqsortOrdered[E constraints.Ordered](data []E, a, b, limit int) { + const maxInsertion = 12 + + var ( + wasBalanced = true // whether the last partitioning was reasonably balanced + wasPartitioned = true // whether the slice was already partitioned + ) + + for { + length := b - a + + if length <= maxInsertion { + insertionSortOrdered(data, a, b) + return + } + + // Fall back to heapsort if too many bad choices were made. + if limit == 0 { + heapSortOrdered(data, a, b) + return + } + + // If the last partitioning was imbalanced, we need to breaking patterns. + if !wasBalanced { + breakPatternsOrdered(data, a, b) + limit-- + } + + pivot, hint := choosePivotOrdered(data, a, b) + if hint == decreasingHint { + reverseRangeOrdered(data, a, b) + // The chosen pivot was pivot-a elements after the start of the array. + // After reversing it is pivot-a elements before the end of the array. + // The idea came from Rust's implementation. + pivot = (b - 1) - (pivot - a) + hint = increasingHint + } + + // The slice is likely already sorted. + if wasBalanced && wasPartitioned && hint == increasingHint { + if partialInsertionSortOrdered(data, a, b) { + return + } + } + + // Probably the slice contains many duplicate elements, partition the slice into + // elements equal to and elements greater than the pivot. + if a > 0 && !(data[a-1] < data[pivot]) { + mid := partitionEqualOrdered(data, a, b, pivot) + a = mid + continue + } + + mid, alreadyPartitioned := partitionOrdered(data, a, b, pivot) + wasPartitioned = alreadyPartitioned + + leftLen, rightLen := mid-a, b-mid + balanceThreshold := length / 8 + if leftLen < rightLen { + wasBalanced = leftLen >= balanceThreshold + pdqsortOrdered(data, a, mid, limit) + a = mid + 1 + } else { + wasBalanced = rightLen >= balanceThreshold + pdqsortOrdered(data, mid+1, b, limit) + b = mid + } + } +} + +// partitionOrdered does one quicksort partition. +// Let p = data[pivot] +// Moves elements in data[a:b] around, so that data[i]

=p for inewpivot. +// On return, data[newpivot] = p +func partitionOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int, alreadyPartitioned bool) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for i <= j && (data[i] < data[a]) { + i++ + } + for i <= j && !(data[j] < data[a]) { + j-- + } + if i > j { + data[j], data[a] = data[a], data[j] + return j, true + } + data[i], data[j] = data[j], data[i] + i++ + j-- + + for { + for i <= j && (data[i] < data[a]) { + i++ + } + for i <= j && !(data[j] < data[a]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + data[j], data[a] = data[a], data[j] + return j, false +} + +// partitionEqualOrdered partitions data[a:b] into elements equal to data[pivot] followed by elements greater than data[pivot]. +// It assumed that data[a:b] does not contain elements smaller than the data[pivot]. +func partitionEqualOrdered[E constraints.Ordered](data []E, a, b, pivot int) (newpivot int) { + data[a], data[pivot] = data[pivot], data[a] + i, j := a+1, b-1 // i and j are inclusive of the elements remaining to be partitioned + + for { + for i <= j && !(data[a] < data[i]) { + i++ + } + for i <= j && (data[a] < data[j]) { + j-- + } + if i > j { + break + } + data[i], data[j] = data[j], data[i] + i++ + j-- + } + return i +} + +// partialInsertionSortOrdered partially sorts a slice, returns true if the slice is sorted at the end. +func partialInsertionSortOrdered[E constraints.Ordered](data []E, a, b int) bool { + const ( + maxSteps = 5 // maximum number of adjacent out-of-order pairs that will get shifted + shortestShifting = 50 // don't shift any elements on short arrays + ) + i := a + 1 + for j := 0; j < maxSteps; j++ { + for i < b && !(data[i] < data[i-1]) { + i++ + } + + if i == b { + return true + } + + if b-a < shortestShifting { + return false + } + + data[i], data[i-1] = data[i-1], data[i] + + // Shift the smaller one to the left. + if i-a >= 2 { + for j := i - 1; j >= 1; j-- { + if !(data[j] < data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + // Shift the greater one to the right. + if b-i >= 2 { + for j := i + 1; j < b; j++ { + if !(data[j] < data[j-1]) { + break + } + data[j], data[j-1] = data[j-1], data[j] + } + } + } + return false +} + +// breakPatternsOrdered scatters some elements around in an attempt to break some patterns +// that might cause imbalanced partitions in quicksort. +func breakPatternsOrdered[E constraints.Ordered](data []E, a, b int) { + length := b - a + if length >= 8 { + random := xorshift(length) + modulus := nextPowerOfTwo(length) + + for idx := a + (length/4)*2 - 1; idx <= a+(length/4)*2+1; idx++ { + other := int(uint(random.Next()) & (modulus - 1)) + if other >= length { + other -= length + } + data[idx], data[a+other] = data[a+other], data[idx] + } + } +} + +// choosePivotOrdered chooses a pivot in data[a:b]. +// +// [0,8): chooses a static pivot. +// [8,shortestNinther): uses the simple median-of-three method. +// [shortestNinther,∞): uses the Tukey ninther method. +func choosePivotOrdered[E constraints.Ordered](data []E, a, b int) (pivot int, hint sortedHint) { + const ( + shortestNinther = 50 + maxSwaps = 4 * 3 + ) + + l := b - a + + var ( + swaps int + i = a + l/4*1 + j = a + l/4*2 + k = a + l/4*3 + ) + + if l >= 8 { + if l >= shortestNinther { + // Tukey ninther method, the idea came from Rust's implementation. + i = medianAdjacentOrdered(data, i, &swaps) + j = medianAdjacentOrdered(data, j, &swaps) + k = medianAdjacentOrdered(data, k, &swaps) + } + // Find the median among i, j, k and stores it into j. + j = medianOrdered(data, i, j, k, &swaps) + } + + switch swaps { + case 0: + return j, increasingHint + case maxSwaps: + return j, decreasingHint + default: + return j, unknownHint + } +} + +// order2Ordered returns x,y where data[x] <= data[y], where x,y=a,b or x,y=b,a. +func order2Ordered[E constraints.Ordered](data []E, a, b int, swaps *int) (int, int) { + if data[b] < data[a] { + *swaps++ + return b, a + } + return a, b +} + +// medianOrdered returns x where data[x] is the median of data[a],data[b],data[c], where x is a, b, or c. +func medianOrdered[E constraints.Ordered](data []E, a, b, c int, swaps *int) int { + a, b = order2Ordered(data, a, b, swaps) + b, c = order2Ordered(data, b, c, swaps) + a, b = order2Ordered(data, a, b, swaps) + return b +} + +// medianAdjacentOrdered finds the median of data[a - 1], data[a], data[a + 1] and stores the index into a. +func medianAdjacentOrdered[E constraints.Ordered](data []E, a int, swaps *int) int { + return medianOrdered(data, a-1, a, a+1, swaps) +} + +func reverseRangeOrdered[E constraints.Ordered](data []E, a, b int) { + i := a + j := b - 1 + for i < j { + data[i], data[j] = data[j], data[i] + i++ + j-- + } +} + +func swapRangeOrdered[E constraints.Ordered](data []E, a, b, n int) { + for i := 0; i < n; i++ { + data[a+i], data[b+i] = data[b+i], data[a+i] + } +} + +func stableOrdered[E constraints.Ordered](data []E, n int) { + blockSize := 20 // must be > 0 + a, b := 0, blockSize + for b <= n { + insertionSortOrdered(data, a, b) + a = b + b += blockSize + } + insertionSortOrdered(data, a, n) + + for blockSize < n { + a, b = 0, 2*blockSize + for b <= n { + symMergeOrdered(data, a, a+blockSize, b) + a = b + b += 2 * blockSize + } + if m := a + blockSize; m < n { + symMergeOrdered(data, a, m, n) + } + blockSize *= 2 + } +} + +// symMergeOrdered merges the two sorted subsequences data[a:m] and data[m:b] using +// the SymMerge algorithm from Pok-Son Kim and Arne Kutzner, "Stable Minimum +// Storage Merging by Symmetric Comparisons", in Susanne Albers and Tomasz +// Radzik, editors, Algorithms - ESA 2004, volume 3221 of Lecture Notes in +// Computer Science, pages 714-723. Springer, 2004. +// +// Let M = m-a and N = b-n. Wolog M < N. +// The recursion depth is bound by ceil(log(N+M)). +// The algorithm needs O(M*log(N/M + 1)) calls to data.Less. +// The algorithm needs O((M+N)*log(M)) calls to data.Swap. +// +// The paper gives O((M+N)*log(M)) as the number of assignments assuming a +// rotation algorithm which uses O(M+N+gcd(M+N)) assignments. The argumentation +// in the paper carries through for Swap operations, especially as the block +// swapping rotate uses only O(M+N) Swaps. +// +// symMerge assumes non-degenerate arguments: a < m && m < b. +// Having the caller check this condition eliminates many leaf recursion calls, +// which improves performance. +func symMergeOrdered[E constraints.Ordered](data []E, a, m, b int) { + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[a] into data[m:b] + // if data[a:m] only contains one element. + if m-a == 1 { + // Use binary search to find the lowest index i + // such that data[i] >= data[a] for m <= i < b. + // Exit the search loop with i == b in case no such index exists. + i := m + j := b + for i < j { + h := int(uint(i+j) >> 1) + if data[h] < data[a] { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[a] reaches the position before i. + for k := a; k < i-1; k++ { + data[k], data[k+1] = data[k+1], data[k] + } + return + } + + // Avoid unnecessary recursions of symMerge + // by direct insertion of data[m] into data[a:m] + // if data[m:b] only contains one element. + if b-m == 1 { + // Use binary search to find the lowest index i + // such that data[i] > data[m] for a <= i < m. + // Exit the search loop with i == m in case no such index exists. + i := a + j := m + for i < j { + h := int(uint(i+j) >> 1) + if !(data[m] < data[h]) { + i = h + 1 + } else { + j = h + } + } + // Swap values until data[m] reaches the position i. + for k := m; k > i; k-- { + data[k], data[k-1] = data[k-1], data[k] + } + return + } + + mid := int(uint(a+b) >> 1) + n := mid + m + var start, r int + if m > mid { + start = n - b + r = mid + } else { + start = a + r = m + } + p := n - 1 + + for start < r { + c := int(uint(start+r) >> 1) + if !(data[p-c] < data[c]) { + start = c + 1 + } else { + r = c + } + } + + end := n - start + if start < m && m < end { + rotateOrdered(data, start, m, end) + } + if a < start && start < mid { + symMergeOrdered(data, a, start, mid) + } + if mid < end && end < b { + symMergeOrdered(data, mid, end, b) + } +} + +// rotateOrdered rotates two consecutive blocks u = data[a:m] and v = data[m:b] in data: +// Data of the form 'x u v y' is changed to 'x v u y'. +// rotate performs at most b-a many calls to data.Swap, +// and it assumes non-degenerate arguments: a < m && m < b. +func rotateOrdered[E constraints.Ordered](data []E, a, m, b int) { + i := m - a + j := b - m + + for i != j { + if i > j { + swapRangeOrdered(data, m-i, m, j) + i -= j + } else { + swapRangeOrdered(data, m-i, m+j-i, i) + j -= i + } + } + // i == j + swapRangeOrdered(data, m-i, m, i) +} diff --git a/vendor/golang.org/x/net/html/render.go b/vendor/golang.org/x/net/html/render.go index 8b28031..e8c1233 100644 --- a/vendor/golang.org/x/net/html/render.go +++ b/vendor/golang.org/x/net/html/render.go @@ -194,9 +194,8 @@ func render1(w writer, n *Node) error { } } - // Render any child nodes. - switch n.Data { - case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + // Render any child nodes + if childTextNodesAreLiteral(n) { for c := n.FirstChild; c != nil; c = c.NextSibling { if c.Type == TextNode { if _, err := w.WriteString(c.Data); err != nil { @@ -213,7 +212,7 @@ func render1(w writer, n *Node) error { // last element in the file, with no closing tag. return plaintextAbort } - default: + } else { for c := n.FirstChild; c != nil; c = c.NextSibling { if err := render1(w, c); err != nil { return err @@ -231,6 +230,27 @@ func render1(w writer, n *Node) error { return w.WriteByte('>') } +func childTextNodesAreLiteral(n *Node) bool { + // Per WHATWG HTML 13.3, if the parent of the current node is a style, + // script, xmp, iframe, noembed, noframes, or plaintext element, and the + // current node is a text node, append the value of the node's data + // literally. The specification is not explicit about it, but we only + // enforce this if we are in the HTML namespace (i.e. when the namespace is + // ""). + // NOTE: we also always include noscript elements, although the + // specification states that they should only be rendered as such if + // scripting is enabled for the node (which is not something we track). + if n.Namespace != "" { + return false + } + switch n.Data { + case "iframe", "noembed", "noframes", "noscript", "plaintext", "script", "style", "xmp": + return true + default: + return false + } +} + // writeQuoted writes s to w surrounded by quotes. Normally it will use double // quotes, but if s contains a double quote, it will use single quotes. // It is used for writing the identifiers in a doctype declaration. diff --git a/vendor/golang.org/x/net/html/token.go b/vendor/golang.org/x/net/html/token.go index 5c2a1f4..de67f93 100644 --- a/vendor/golang.org/x/net/html/token.go +++ b/vendor/golang.org/x/net/html/token.go @@ -913,7 +913,14 @@ func (z *Tokenizer) readTagAttrKey() { case ' ', '\n', '\r', '\t', '\f', '/': z.pendingAttr[0].end = z.raw.end - 1 return - case '=', '>': + case '=': + if z.pendingAttr[0].start+1 == z.raw.end { + // WHATWG 13.2.5.32, if we see an equals sign before the attribute name + // begins, we treat it as a character in the attribute name and continue. + continue + } + fallthrough + case '>': z.raw.end-- z.pendingAttr[0].end = z.raw.end return diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go index 32af9de..a09ed19 100644 --- a/vendor/golang.org/x/text/internal/language/compact/tables.go +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -790,226 +790,226 @@ const ( var coreTags = []language.CompactCoreInfo{ // 773 elements // Entry 0 - 1F - 0x00000000, 0x01600000, 0x016000d2, 0x01600161, - 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, - 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, - 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, - 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, - 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, - 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, - 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + 0x00000000, 0x01600000, 0x016000d3, 0x01600162, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100081, + 0x02700000, 0x02700070, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00063, 0x03a00068, + 0x03a0006c, 0x03a0006d, 0x03a0006e, 0x03a00098, + 0x03a0009c, 0x03a000a2, 0x03a000a9, 0x03a000ad, + 0x03a000b1, 0x03a000ba, 0x03a000bb, 0x03a000ca, + 0x03a000e2, 0x03a000ee, 0x03a000f4, 0x03a00109, // Entry 20 - 3F - 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, - 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, - 0x04300000, 0x04300099, 0x04400000, 0x0440012f, - 0x04800000, 0x0480006e, 0x05800000, 0x05820000, - 0x05820032, 0x0585a000, 0x0585a032, 0x05e00000, + 0x03a0010c, 0x03a00116, 0x03a00118, 0x03a0011d, + 0x03a00121, 0x03a00129, 0x03a0015f, 0x04000000, + 0x04300000, 0x0430009a, 0x04400000, 0x04400130, + 0x04800000, 0x0480006f, 0x05800000, 0x05820000, + 0x05820032, 0x0585b000, 0x0585b032, 0x05e00000, 0x05e00052, 0x07100000, 0x07100047, 0x07500000, - 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, - 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + 0x07500163, 0x07900000, 0x07900130, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c4, // Entry 40 - 5F - 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, - 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, - 0x0b500000, 0x0b500099, 0x0b700000, 0x0b720000, - 0x0b720033, 0x0b75a000, 0x0b75a033, 0x0d700000, - 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, - 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, - 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, - 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + 0x0a500000, 0x0a500035, 0x0a50009a, 0x0a900000, + 0x0a900053, 0x0a90009a, 0x0b200000, 0x0b200079, + 0x0b500000, 0x0b50009a, 0x0b700000, 0x0b720000, + 0x0b720033, 0x0b75b000, 0x0b75b033, 0x0d700000, + 0x0d700022, 0x0d70006f, 0x0d700079, 0x0d70009f, + 0x0db00000, 0x0db00035, 0x0db0009a, 0x0dc00000, + 0x0dc00107, 0x0df00000, 0x0df00132, 0x0e500000, + 0x0e500136, 0x0e900000, 0x0e90009c, 0x0e90009d, // Entry 60 - 7F - 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, - 0x10000000, 0x1000007b, 0x10100000, 0x10100063, - 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, - 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, - 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, - 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, - 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, - 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + 0x0fa00000, 0x0fa0005f, 0x0fe00000, 0x0fe00107, + 0x10000000, 0x1000007c, 0x10100000, 0x10100064, + 0x10100083, 0x10800000, 0x108000a5, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00061, + 0x10d0009f, 0x10d000b3, 0x10d000b8, 0x11700000, + 0x117000d5, 0x11f00000, 0x11f00061, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00115, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a5, // Entry 80 - 9F - 0x13000000, 0x13000080, 0x13000122, 0x13600000, - 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x13000000, 0x13000081, 0x13000123, 0x13600000, + 0x1360005e, 0x13600088, 0x13900000, 0x13900001, 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, - 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, - 0x13900060, 0x13900061, 0x13900063, 0x13900064, + 0x13900050, 0x13900052, 0x1390005d, 0x1390005e, + 0x13900061, 0x13900062, 0x13900064, 0x13900065, // Entry A0 - BF - 0x1390006d, 0x13900072, 0x13900073, 0x13900074, - 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, - 0x13900080, 0x13900081, 0x13900083, 0x1390008a, - 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, - 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, - 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, - 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, - 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + 0x1390006e, 0x13900073, 0x13900074, 0x13900075, + 0x13900076, 0x1390007c, 0x1390007d, 0x13900080, + 0x13900081, 0x13900082, 0x13900084, 0x1390008b, + 0x1390008d, 0x1390008e, 0x13900097, 0x13900098, + 0x13900099, 0x1390009a, 0x1390009b, 0x139000a0, + 0x139000a1, 0x139000a5, 0x139000a8, 0x139000aa, + 0x139000ae, 0x139000b2, 0x139000b5, 0x139000b6, + 0x139000c0, 0x139000c1, 0x139000c7, 0x139000c8, // Entry C0 - DF - 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, - 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, - 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, - 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, - 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, - 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, - 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, - 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + 0x139000cb, 0x139000cc, 0x139000cd, 0x139000cf, + 0x139000d1, 0x139000d3, 0x139000d6, 0x139000d7, + 0x139000da, 0x139000de, 0x139000e0, 0x139000e1, + 0x139000e7, 0x139000e8, 0x139000e9, 0x139000ec, + 0x139000ed, 0x139000f1, 0x13900108, 0x1390010a, + 0x1390010b, 0x1390010c, 0x1390010d, 0x1390010e, + 0x1390010f, 0x13900110, 0x13900113, 0x13900118, + 0x1390011c, 0x1390011e, 0x13900120, 0x13900126, // Entry E0 - FF - 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, - 0x13900131, 0x13900133, 0x13900135, 0x13900139, - 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, - 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x1390012a, 0x1390012d, 0x1390012e, 0x13900130, + 0x13900132, 0x13900134, 0x13900136, 0x1390013a, + 0x1390013d, 0x1390013e, 0x13900140, 0x13900143, + 0x13900162, 0x13900163, 0x13900165, 0x13c00000, 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, - 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, - 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + 0x13e00054, 0x13e00057, 0x13e0005a, 0x13e00066, + 0x13e00069, 0x13e0006a, 0x13e0006f, 0x13e00087, // Entry 100 - 11F - 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, - 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, - 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, - 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, - 0x14500000, 0x1450006e, 0x14600000, 0x14600052, - 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, - 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, - 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + 0x13e0008a, 0x13e00090, 0x13e00095, 0x13e000d0, + 0x13e000d9, 0x13e000e3, 0x13e000e5, 0x13e000e8, + 0x13e000ed, 0x13e000f2, 0x13e0011b, 0x13e00136, + 0x13e00137, 0x13e0013c, 0x14000000, 0x1400006b, + 0x14500000, 0x1450006f, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009d, 0x14e00000, + 0x14e00052, 0x14e00085, 0x14e000ca, 0x14e00115, + 0x15100000, 0x15100073, 0x15300000, 0x153000e8, // Entry 120 - 13F - 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15800000, 0x15800064, 0x15800077, 0x15e00000, 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, - 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, - 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, - 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, - 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + 0x15e00063, 0x15e00068, 0x15e00079, 0x15e0007b, + 0x15e0007f, 0x15e00085, 0x15e00086, 0x15e00087, + 0x15e00092, 0x15e000a9, 0x15e000b8, 0x15e000bb, + 0x15e000bc, 0x15e000bf, 0x15e000c0, 0x15e000c4, // Entry 140 - 15F - 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, - 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, - 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, - 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, - 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, - 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, - 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, - 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + 0x15e000c9, 0x15e000ca, 0x15e000cd, 0x15e000d4, + 0x15e000d5, 0x15e000e6, 0x15e000eb, 0x15e00103, + 0x15e00108, 0x15e0010b, 0x15e00115, 0x15e0011d, + 0x15e00121, 0x15e00123, 0x15e00129, 0x15e00140, + 0x15e00141, 0x15e00160, 0x16900000, 0x1690009f, + 0x16d00000, 0x16d000da, 0x16e00000, 0x16e00097, + 0x17e00000, 0x17e0007c, 0x19000000, 0x1900006f, + 0x1a300000, 0x1a30004e, 0x1a300079, 0x1a3000b3, // Entry 160 - 17F - 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, - 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, - 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, - 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, - 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, - 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, - 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, - 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + 0x1a400000, 0x1a40009a, 0x1a900000, 0x1ab00000, + 0x1ab000a5, 0x1ac00000, 0x1ac00099, 0x1b400000, + 0x1b400081, 0x1b4000d5, 0x1b4000d7, 0x1b800000, + 0x1b800136, 0x1bc00000, 0x1bc00098, 0x1be00000, + 0x1be0009a, 0x1d100000, 0x1d100033, 0x1d100091, + 0x1d200000, 0x1d200061, 0x1d500000, 0x1d500093, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100096, + 0x1e700000, 0x1e7000d7, 0x1ea00000, 0x1ea00053, // Entry 180 - 19F - 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, - 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, - 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, - 0x200000a2, 0x20300000, 0x20700000, 0x20700052, - 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, - 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, - 0x21200067, 0x21600000, 0x21700000, 0x217000a4, - 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009e, + 0x1f900000, 0x1f90004e, 0x1f90009f, 0x1f900114, + 0x1f900139, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a3, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a00130, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007e, 0x21200000, + 0x21200068, 0x21600000, 0x21700000, 0x217000a5, + 0x21f00000, 0x22300000, 0x22300130, 0x22700000, // Entry 1A0 - 1BF - 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, - 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, - 0x24400052, 0x24500000, 0x24500082, 0x24600000, - 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, - 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, - 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, - 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, - 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + 0x2270005b, 0x23400000, 0x234000c4, 0x23900000, + 0x239000a5, 0x24200000, 0x242000af, 0x24400000, + 0x24400052, 0x24500000, 0x24500083, 0x24600000, + 0x246000a5, 0x24a00000, 0x24a000a7, 0x25100000, + 0x2510009a, 0x25400000, 0x254000ab, 0x254000ac, + 0x25600000, 0x2560009a, 0x26a00000, 0x26a0009a, + 0x26b00000, 0x26b00130, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00061, 0x27400000, 0x28100000, // Entry 1C0 - 1DF - 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, - 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, - 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2810007c, 0x28a00000, 0x28a000a6, 0x29100000, + 0x29100130, 0x29500000, 0x295000b8, 0x2a300000, + 0x2a300132, 0x2af00000, 0x2af00136, 0x2b500000, 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, - 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, - 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, - 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, - 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + 0x2b800000, 0x2b8000b0, 0x2bf00000, 0x2bf0009c, + 0x2bf0009d, 0x2c000000, 0x2c0000b7, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a5, 0x2c500000, + 0x2c5000a5, 0x2c700000, 0x2c7000b9, 0x2d100000, // Entry 1E0 - 1FF - 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, - 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, - 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, - 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, - 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, - 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, - 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, - 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + 0x2d1000a5, 0x2d100130, 0x2e900000, 0x2e9000a5, + 0x2ed00000, 0x2ed000cd, 0x2f100000, 0x2f1000c0, + 0x2f200000, 0x2f2000d2, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c3, 0x30400000, 0x3040009a, + 0x30b00000, 0x30b000c6, 0x31000000, 0x31b00000, + 0x31b0009a, 0x31f00000, 0x31f0003e, 0x31f000d1, + 0x31f0010e, 0x32000000, 0x320000cc, 0x32500000, + 0x32500052, 0x33100000, 0x331000c5, 0x33a00000, // Entry 200 - 21F - 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, - 0x34700000, 0x347000da, 0x34700110, 0x34e00000, - 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, - 0x35100000, 0x35100099, 0x351000db, 0x36700000, - 0x36700030, 0x36700036, 0x36700040, 0x3670005b, - 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, - 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x33a0009d, 0x34100000, 0x34500000, 0x345000d3, + 0x34700000, 0x347000db, 0x34700111, 0x34e00000, + 0x34e00165, 0x35000000, 0x35000061, 0x350000da, + 0x35100000, 0x3510009a, 0x351000dc, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005c, + 0x367000da, 0x36700117, 0x3670011c, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000db, 0x36c00000, 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, // Entry 220 - 23F - 0x37a00000, 0x38000000, 0x38000117, 0x38700000, - 0x38900000, 0x38900131, 0x39000000, 0x3900006f, - 0x390000a4, 0x39500000, 0x39500099, 0x39800000, - 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, - 0x39d050e8, 0x39d36000, 0x39d36099, 0x3a100000, - 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x37a00000, 0x38000000, 0x38000118, 0x38700000, + 0x38900000, 0x38900132, 0x39000000, 0x39000070, + 0x390000a5, 0x39500000, 0x3950009a, 0x39800000, + 0x3980007e, 0x39800107, 0x39d00000, 0x39d05000, + 0x39d050e9, 0x39d36000, 0x39d3609a, 0x3a100000, + 0x3b300000, 0x3b3000ea, 0x3bd00000, 0x3bd00001, 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, - 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + 0x3c000041, 0x3c00004e, 0x3c00005b, 0x3c000087, // Entry 240 - 25F - 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, - 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, - 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3c00008c, 0x3c0000b8, 0x3c0000c7, 0x3c0000d2, + 0x3c0000ef, 0x3c000119, 0x3c000127, 0x3c400000, + 0x3c40003f, 0x3c40006a, 0x3c4000e5, 0x3d400000, 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, - 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, - 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, - 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, - 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + 0x3dc000bd, 0x3dc00105, 0x3de00000, 0x3de00130, + 0x3e200000, 0x3e200047, 0x3e2000a6, 0x3e2000af, + 0x3e2000bd, 0x3e200107, 0x3e200131, 0x3e500000, + 0x3e500108, 0x3e600000, 0x3e600130, 0x3eb00000, // Entry 260 - 27F - 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, - 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, - 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, - 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x3eb00107, 0x3ec00000, 0x3ec000a5, 0x3f300000, + 0x3f300130, 0x3fa00000, 0x3fa000e9, 0x3fc00000, + 0x3fd00000, 0x3fd00073, 0x3fd000db, 0x3fd0010d, + 0x3ff00000, 0x3ff000d2, 0x40100000, 0x401000c4, 0x40200000, 0x4020004c, 0x40700000, 0x40800000, - 0x4085a000, 0x4085a0ba, 0x408e8000, 0x408e80ba, - 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, - 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + 0x4085b000, 0x4085b0bb, 0x408eb000, 0x408eb0bb, + 0x40c00000, 0x40c000b4, 0x41200000, 0x41200112, + 0x41600000, 0x41600110, 0x41c00000, 0x41d00000, // Entry 280 - 29F - 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, - 0x42300000, 0x42300164, 0x42900000, 0x42900062, - 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, - 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, - 0x43220000, 0x43220033, 0x432200bd, 0x43220105, - 0x4322014d, 0x4325a000, 0x4325a033, 0x4325a0bd, - 0x4325a105, 0x4325a14d, 0x43700000, 0x43a00000, - 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + 0x41e00000, 0x41f00000, 0x41f00073, 0x42200000, + 0x42300000, 0x42300165, 0x42900000, 0x42900063, + 0x42900070, 0x429000a5, 0x42900116, 0x43100000, + 0x43100027, 0x431000c3, 0x4310014e, 0x43200000, + 0x43220000, 0x43220033, 0x432200be, 0x43220106, + 0x4322014e, 0x4325b000, 0x4325b033, 0x4325b0be, + 0x4325b106, 0x4325b14e, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400073, // Entry 2A0 - 2BF - 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, - 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, - 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, - 0x46100000, 0x46100099, 0x46400000, 0x464000a4, - 0x46400131, 0x46700000, 0x46700124, 0x46b00000, - 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, - 0x47100000, 0x47600000, 0x47600127, 0x47a00000, - 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + 0x4440010d, 0x44500000, 0x4450004b, 0x445000a5, + 0x44500130, 0x44500132, 0x44e00000, 0x45000000, + 0x4500009a, 0x450000b4, 0x450000d1, 0x4500010e, + 0x46100000, 0x4610009a, 0x46400000, 0x464000a5, + 0x46400132, 0x46700000, 0x46700125, 0x46b00000, + 0x46b00124, 0x46f00000, 0x46f0006e, 0x46f00070, + 0x47100000, 0x47600000, 0x47600128, 0x47a00000, + 0x48000000, 0x48200000, 0x4820012a, 0x48a00000, // Entry 2C0 - 2DF - 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, - 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, - 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, - 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x48a0005e, 0x48a0012c, 0x48e00000, 0x49400000, + 0x49400107, 0x4a400000, 0x4a4000d5, 0x4a900000, + 0x4a9000bb, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00131, 0x4b400000, 0x4b40009a, 0x4b4000e9, 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc20000, - 0x4bc20137, 0x4bc5a000, 0x4bc5a137, 0x4be00000, - 0x4be5a000, 0x4be5a0b4, 0x4bef1000, 0x4bef10b4, - 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + 0x4bc20138, 0x4bc5b000, 0x4bc5b138, 0x4be00000, + 0x4be5b000, 0x4be5b0b5, 0x4bef4000, 0x4bef40b5, + 0x4c000000, 0x4c300000, 0x4c30013f, 0x4c900000, // Entry 2E0 - 2FF - 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, - 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, - 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x4c900001, 0x4cc00000, 0x4cc00130, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500115, + 0x4f200000, 0x4fb00000, 0x4fb00132, 0x50900000, 0x50900052, 0x51200000, 0x51200001, 0x51800000, - 0x5180003b, 0x518000d6, 0x51f00000, 0x51f3b000, - 0x51f3b053, 0x51f3c000, 0x51f3c08d, 0x52800000, - 0x528000ba, 0x52900000, 0x5293b000, 0x5293b053, - 0x5293b08d, 0x5293b0c6, 0x5293b10d, 0x5293c000, + 0x5180003b, 0x518000d7, 0x51f00000, 0x51f3b000, + 0x51f3b053, 0x51f3c000, 0x51f3c08e, 0x52800000, + 0x528000bb, 0x52900000, 0x5293b000, 0x5293b053, + 0x5293b08e, 0x5293b0c7, 0x5293b10e, 0x5293c000, // Entry 300 - 31F - 0x5293c08d, 0x5293c0c6, 0x5293c12e, 0x52f00000, - 0x52f00161, + 0x5293c08e, 0x5293c0c7, 0x5293c12f, 0x52f00000, + 0x52f00162, } // Size: 3116 bytes const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" -// Total table size 3147 bytes (3KiB); checksum: 6772C83C +// Total table size 3147 bytes (3KiB); checksum: 5A8FFFA5 diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go index fb6b583..14167e7 100644 --- a/vendor/golang.org/x/text/internal/language/tables.go +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -7,11 +7,11 @@ import "golang.org/x/text/internal/tag" // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const NumLanguages = 8752 +const NumLanguages = 8798 -const NumScripts = 258 +const NumScripts = 261 -const NumRegions = 357 +const NumRegions = 358 type FromTo struct { From uint16 @@ -263,7 +263,7 @@ var langNoIndex = [2197]uint8{ 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x72, 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xbc, 0x0a, 0x6a, @@ -278,7 +278,7 @@ var langNoIndex = [2197]uint8{ 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x6f, 0xff, 0xff, + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x7f, 0xff, 0xff, 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, @@ -289,11 +289,11 @@ var langNoIndex = [2197]uint8{ // Entry C0 - FF 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, 0x1b, 0x14, 0x08, 0xf3, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7b, 0xf3, 0xef, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x7f, 0xf3, 0xef, 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xff, 0x7b, 0x35, 0x3e, 0xc7, 0xc7, 0xdf, 0xff, 0x01, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0xb0, 0x05, 0x80, 0x00, 0x20, 0x00, 0x00, 0x03, 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, // Entry 100 - 13F 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, @@ -303,20 +303,20 @@ var langNoIndex = [2197]uint8{ 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc7, 0x67, 0x5f, 0x56, 0x99, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + 0x90, 0x6d, 0x01, 0x2e, 0x96, 0x69, 0x20, 0xfb, // Entry 140 - 17F 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x0c, 0x16, - 0x03, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x03, 0x00, 0x00, 0xb0, 0x14, 0x23, 0x50, 0x06, 0x0a, 0x00, 0x01, 0x00, 0x00, 0x10, 0x11, 0x09, 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x05, 0x08, 0x00, 0x00, 0x05, 0x00, 0x80, 0x28, 0x04, 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, 0x24, 0x52, 0xf4, 0xd5, 0xbf, 0x62, 0xc9, 0x03, // Entry 180 - 1BF 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x21, 0x18, 0x81, 0x08, 0x00, 0x01, 0x40, 0x82, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, @@ -337,7 +337,7 @@ var langNoIndex = [2197]uint8{ 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe1, 0xdf, 0x03, 0x44, 0x08, 0x90, 0x01, 0x04, 0x81, 0xe3, 0x92, 0x54, 0xdb, 0x28, 0xd3, 0x5f, 0xfe, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x79, 0xed, 0x1c, 0x7f, 0x04, 0x08, 0x00, 0x01, 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, // Entry 240 - 27F @@ -359,13 +359,13 @@ var langNoIndex = [2197]uint8{ 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x02, 0x50, 0x80, 0x11, 0x00, 0x99, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x0e, 0x59, 0xe9, 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x40, 0x08, 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x8d, 0x12, 0x00, // Entry 300 - 33F 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, @@ -392,14 +392,14 @@ var langNoIndex = [2197]uint8{ 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x7d, 0x1f, 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, // Entry 3C0 - 3FF 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xdb, 0xf9, 0x2e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x01, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x20, + 0x40, 0x54, 0x9f, 0x8a, 0xdf, 0xf9, 0x6e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x40, 0x03, 0x05, 0xd1, 0x50, 0x5c, 0x00, 0x40, 0x00, 0x10, 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, @@ -424,12 +424,12 @@ var langNoIndex = [2197]uint8{ // Entry 480 - 4BF 0x93, 0x50, 0x5d, 0xaf, 0xa6, 0xff, 0x99, 0xfb, 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x05, 0xc5, 0x05, + 0x14, 0x00, 0x55, 0x51, 0xc2, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x02, 0x85, 0xc5, 0x05, 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x05, 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, + 0x06, 0x11, 0x20, 0x00, 0x18, 0x01, 0x92, 0xf1, // Entry 4C0 - 4FF 0xfd, 0x47, 0x69, 0x06, 0x95, 0x06, 0x57, 0xed, 0xfb, 0x4d, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, @@ -441,7 +441,7 @@ var langNoIndex = [2197]uint8{ 0xbe, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, // Entry 500 - 53F 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x2d, 0x14, 0x27, 0x5f, 0xed, 0xf1, 0x3f, 0xe7, 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe7, 0xf7, 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, @@ -449,7 +449,7 @@ var langNoIndex = [2197]uint8{ 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0x00, 0x00, 0x01, 0x43, 0x19, 0x24, 0x08, 0x00, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, @@ -464,13 +464,13 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x20, 0x81, 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0xbe, 0x02, 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x3d, 0x40, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, 0x31, 0x00, 0x00, 0x00, 0x01, 0x18, 0x02, 0x20, 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, @@ -491,20 +491,20 @@ var langNoIndex = [2197]uint8{ 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, 0xb9, 0xda, 0x7d, 0xd0, 0x3e, 0x15, 0x7b, 0xb4, 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0x5f, 0xff, 0xff, 0x9e, 0xdf, 0xf6, 0xd7, 0xb9, 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, // Entry 680 - 6BF 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x73, 0x7f, 0xf8, 0xda, + 0xce, 0x7f, 0x44, 0x1d, 0x73, 0x7f, 0xf8, 0xda, 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x79, 0xa0, 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x09, 0x06, 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, 0x04, 0x00, 0x10, 0xdc, 0x58, 0xd7, 0x0d, 0x0f, // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x54, 0x4d, 0xf1, 0x16, 0x44, 0xd5, 0x42, 0x08, + 0x40, 0x02, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x48, 0x41, 0x24, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -513,7 +513,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, // Entry 700 - 73F 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x01, 0x00, 0x01, 0xff, 0x18, 0x02, 0x00, 0x02, 0xf0, 0xfd, 0x79, 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, @@ -522,7 +522,7 @@ var langNoIndex = [2197]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 740 - 77F 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x46, 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, 0x01, 0x00, 0x00, 0xb0, 0x80, 0x20, 0x55, 0x75, @@ -530,12 +530,12 @@ var langNoIndex = [2197]uint8{ 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x83, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0x10, 0x03, 0x31, 0x02, 0x01, 0x00, 0x00, 0xf0, 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0x78, 0x15, 0x50, 0x05, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x40, 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, // Entry 7C0 - 7FF @@ -545,11 +545,11 @@ var langNoIndex = [2197]uint8{ 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0xfe, 0x01, 0x02, 0x88, 0x2a, 0x40, 0x16, 0x01, 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, // Entry 800 - 83F 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xdc, 0xa3, 0xd1, 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, @@ -557,11 +557,11 @@ var langNoIndex = [2197]uint8{ 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0xf0, 0xfb, 0xfd, 0x7f, 0x05, 0x00, 0x16, 0x89, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x03, 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x14, 0xf1, + 0x00, 0xcb, 0xe4, 0x3a, 0x46, 0x88, 0x54, 0xf1, 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, @@ -583,8 +583,8 @@ var altLangIndex = [6]uint16{ } // AliasMap maps langIDs to their suggested replacements. -// Size: 716 bytes, 179 elements -var AliasMap = [179]FromTo{ +// Size: 772 bytes, 193 elements +var AliasMap = [193]FromTo{ 0: {From: 0x82, To: 0x88}, 1: {From: 0x187, To: 0x1ae}, 2: {From: 0x1f3, To: 0x1e1}, @@ -599,223 +599,239 @@ var AliasMap = [179]FromTo{ 11: {From: 0x4a2, To: 0x21}, 12: {From: 0x53e, To: 0x544}, 13: {From: 0x58f, To: 0x12d}, - 14: {From: 0x630, To: 0x1eb1}, - 15: {From: 0x651, To: 0x431}, - 16: {From: 0x662, To: 0x431}, - 17: {From: 0x6ed, To: 0x3a}, - 18: {From: 0x6f8, To: 0x1d7}, - 19: {From: 0x709, To: 0x3625}, - 20: {From: 0x73e, To: 0x21a1}, - 21: {From: 0x7b3, To: 0x56}, - 22: {From: 0x7b9, To: 0x299b}, - 23: {From: 0x7c5, To: 0x58}, - 24: {From: 0x7e6, To: 0x145}, - 25: {From: 0x80c, To: 0x5a}, - 26: {From: 0x815, To: 0x8d}, - 27: {From: 0x87e, To: 0x810}, - 28: {From: 0x8a8, To: 0x8b7}, - 29: {From: 0x8c3, To: 0xee3}, - 30: {From: 0x8fa, To: 0x1dc}, - 31: {From: 0x9ef, To: 0x331}, - 32: {From: 0xa36, To: 0x2c5}, - 33: {From: 0xa3d, To: 0xbf}, - 34: {From: 0xabe, To: 0x3322}, - 35: {From: 0xb38, To: 0x529}, - 36: {From: 0xb75, To: 0x265a}, - 37: {From: 0xb7e, To: 0xbc3}, - 38: {From: 0xb9b, To: 0x44e}, - 39: {From: 0xbbc, To: 0x4229}, - 40: {From: 0xbbf, To: 0x529}, - 41: {From: 0xbfe, To: 0x2da7}, - 42: {From: 0xc2e, To: 0x3181}, - 43: {From: 0xcb9, To: 0xf3}, - 44: {From: 0xd08, To: 0xfa}, - 45: {From: 0xdc8, To: 0x11a}, - 46: {From: 0xdd7, To: 0x32d}, - 47: {From: 0xdf8, To: 0xdfb}, - 48: {From: 0xdfe, To: 0x531}, - 49: {From: 0xe01, To: 0xdf3}, - 50: {From: 0xedf, To: 0x205a}, - 51: {From: 0xee9, To: 0x222e}, - 52: {From: 0xeee, To: 0x2e9a}, - 53: {From: 0xf39, To: 0x367}, - 54: {From: 0x10d0, To: 0x140}, - 55: {From: 0x1104, To: 0x2d0}, - 56: {From: 0x11a0, To: 0x1ec}, - 57: {From: 0x1279, To: 0x21}, - 58: {From: 0x1424, To: 0x15e}, - 59: {From: 0x1470, To: 0x14e}, - 60: {From: 0x151f, To: 0xd9b}, - 61: {From: 0x1523, To: 0x390}, - 62: {From: 0x1532, To: 0x19f}, - 63: {From: 0x1580, To: 0x210}, - 64: {From: 0x1583, To: 0x10d}, - 65: {From: 0x15a3, To: 0x3caf}, - 66: {From: 0x1630, To: 0x222e}, - 67: {From: 0x166a, To: 0x19b}, - 68: {From: 0x16c8, To: 0x136}, - 69: {From: 0x1700, To: 0x29f8}, - 70: {From: 0x1718, To: 0x194}, - 71: {From: 0x1727, To: 0xf3f}, - 72: {From: 0x177a, To: 0x178}, - 73: {From: 0x1809, To: 0x17b6}, - 74: {From: 0x1816, To: 0x18f3}, - 75: {From: 0x188a, To: 0x436}, - 76: {From: 0x1979, To: 0x1d01}, - 77: {From: 0x1a74, To: 0x2bb0}, - 78: {From: 0x1a8a, To: 0x1f8}, - 79: {From: 0x1b5a, To: 0x1fa}, - 80: {From: 0x1b86, To: 0x1515}, - 81: {From: 0x1d64, To: 0x2c9b}, - 82: {From: 0x2038, To: 0x37b1}, - 83: {From: 0x203d, To: 0x20dd}, - 84: {From: 0x205a, To: 0x30b}, - 85: {From: 0x20e3, To: 0x274}, - 86: {From: 0x20ee, To: 0x263}, - 87: {From: 0x20f2, To: 0x22d}, - 88: {From: 0x20f9, To: 0x256}, - 89: {From: 0x210f, To: 0x21eb}, - 90: {From: 0x2135, To: 0x27d}, - 91: {From: 0x2160, To: 0x913}, - 92: {From: 0x2199, To: 0x121}, - 93: {From: 0x21ce, To: 0x1561}, - 94: {From: 0x21e6, To: 0x504}, - 95: {From: 0x21f4, To: 0x49f}, - 96: {From: 0x21fb, To: 0x269}, - 97: {From: 0x222d, To: 0x121}, - 98: {From: 0x2237, To: 0x121}, - 99: {From: 0x2262, To: 0x92a}, - 100: {From: 0x2316, To: 0x3226}, - 101: {From: 0x236a, To: 0x2835}, - 102: {From: 0x2382, To: 0x3365}, - 103: {From: 0x2472, To: 0x2c7}, - 104: {From: 0x24e4, To: 0x2ff}, - 105: {From: 0x24f0, To: 0x2fa}, - 106: {From: 0x24fa, To: 0x31f}, - 107: {From: 0x2550, To: 0xb5b}, - 108: {From: 0x25a9, To: 0xe2}, - 109: {From: 0x263e, To: 0x2d0}, - 110: {From: 0x26c9, To: 0x26b4}, - 111: {From: 0x26f9, To: 0x3c8}, - 112: {From: 0x2727, To: 0x3caf}, - 113: {From: 0x2755, To: 0x6a4}, - 114: {From: 0x2765, To: 0x26b4}, - 115: {From: 0x2789, To: 0x4358}, - 116: {From: 0x27c9, To: 0x2001}, - 117: {From: 0x28ea, To: 0x27b1}, - 118: {From: 0x28ef, To: 0x2837}, - 119: {From: 0x2914, To: 0x351}, - 120: {From: 0x2986, To: 0x2da7}, - 121: {From: 0x29f0, To: 0x96b}, - 122: {From: 0x2b1a, To: 0x38d}, - 123: {From: 0x2bfc, To: 0x395}, - 124: {From: 0x2c3f, To: 0x3caf}, - 125: {From: 0x2ce1, To: 0x2201}, - 126: {From: 0x2cfc, To: 0x3be}, - 127: {From: 0x2d13, To: 0x597}, - 128: {From: 0x2d47, To: 0x148}, - 129: {From: 0x2d48, To: 0x148}, - 130: {From: 0x2dff, To: 0x2f1}, - 131: {From: 0x2e08, To: 0x19cc}, - 132: {From: 0x2e1a, To: 0x2d95}, - 133: {From: 0x2e21, To: 0x292}, - 134: {From: 0x2e54, To: 0x7d}, - 135: {From: 0x2e65, To: 0x2282}, - 136: {From: 0x2ea0, To: 0x2e9b}, - 137: {From: 0x2eef, To: 0x2ed7}, - 138: {From: 0x3193, To: 0x3c4}, - 139: {From: 0x3366, To: 0x338e}, - 140: {From: 0x342a, To: 0x3dc}, - 141: {From: 0x34ee, To: 0x18d0}, - 142: {From: 0x35c8, To: 0x2c9b}, - 143: {From: 0x35e6, To: 0x412}, - 144: {From: 0x3658, To: 0x246}, - 145: {From: 0x3676, To: 0x3f4}, - 146: {From: 0x36fd, To: 0x445}, - 147: {From: 0x37c0, To: 0x121}, - 148: {From: 0x3816, To: 0x38f2}, - 149: {From: 0x382a, To: 0x2b48}, - 150: {From: 0x382b, To: 0x2c9b}, - 151: {From: 0x382f, To: 0xa9}, - 152: {From: 0x3832, To: 0x3228}, - 153: {From: 0x386c, To: 0x39a6}, - 154: {From: 0x3892, To: 0x3fc0}, - 155: {From: 0x38a5, To: 0x39d7}, - 156: {From: 0x38b4, To: 0x1fa4}, - 157: {From: 0x38b5, To: 0x2e9a}, - 158: {From: 0x395c, To: 0x47e}, - 159: {From: 0x3b4e, To: 0xd91}, - 160: {From: 0x3b78, To: 0x137}, - 161: {From: 0x3c99, To: 0x4bc}, - 162: {From: 0x3fbd, To: 0x100}, - 163: {From: 0x4208, To: 0xa91}, - 164: {From: 0x42be, To: 0x573}, - 165: {From: 0x42f9, To: 0x3f60}, - 166: {From: 0x4378, To: 0x25a}, - 167: {From: 0x43b8, To: 0xe6c}, - 168: {From: 0x43cd, To: 0x10f}, - 169: {From: 0x44af, To: 0x3322}, - 170: {From: 0x44e3, To: 0x512}, - 171: {From: 0x45ca, To: 0x2409}, - 172: {From: 0x45dd, To: 0x26dc}, - 173: {From: 0x4610, To: 0x48ae}, - 174: {From: 0x46ae, To: 0x46a0}, - 175: {From: 0x473e, To: 0x4745}, - 176: {From: 0x4817, To: 0x3503}, - 177: {From: 0x4916, To: 0x31f}, - 178: {From: 0x49a7, To: 0x523}, + 14: {From: 0x62b, To: 0x34}, + 15: {From: 0x62f, To: 0x14}, + 16: {From: 0x630, To: 0x1eb1}, + 17: {From: 0x651, To: 0x431}, + 18: {From: 0x662, To: 0x431}, + 19: {From: 0x6ed, To: 0x3a}, + 20: {From: 0x6f8, To: 0x1d7}, + 21: {From: 0x709, To: 0x3625}, + 22: {From: 0x73e, To: 0x21a1}, + 23: {From: 0x7b3, To: 0x56}, + 24: {From: 0x7b9, To: 0x299b}, + 25: {From: 0x7c5, To: 0x58}, + 26: {From: 0x7e6, To: 0x145}, + 27: {From: 0x80c, To: 0x5a}, + 28: {From: 0x815, To: 0x8d}, + 29: {From: 0x87e, To: 0x810}, + 30: {From: 0x8a8, To: 0x8b7}, + 31: {From: 0x8c3, To: 0xee3}, + 32: {From: 0x8fa, To: 0x1dc}, + 33: {From: 0x9ef, To: 0x331}, + 34: {From: 0xa36, To: 0x2c5}, + 35: {From: 0xa3d, To: 0xbf}, + 36: {From: 0xabe, To: 0x3322}, + 37: {From: 0xb38, To: 0x529}, + 38: {From: 0xb75, To: 0x265a}, + 39: {From: 0xb7e, To: 0xbc3}, + 40: {From: 0xb9b, To: 0x44e}, + 41: {From: 0xbbc, To: 0x4229}, + 42: {From: 0xbbf, To: 0x529}, + 43: {From: 0xbfe, To: 0x2da7}, + 44: {From: 0xc2e, To: 0x3181}, + 45: {From: 0xcb9, To: 0xf3}, + 46: {From: 0xd08, To: 0xfa}, + 47: {From: 0xdc8, To: 0x11a}, + 48: {From: 0xdd7, To: 0x32d}, + 49: {From: 0xdf8, To: 0xdfb}, + 50: {From: 0xdfe, To: 0x531}, + 51: {From: 0xe01, To: 0xdf3}, + 52: {From: 0xedf, To: 0x205a}, + 53: {From: 0xee9, To: 0x222e}, + 54: {From: 0xeee, To: 0x2e9a}, + 55: {From: 0xf39, To: 0x367}, + 56: {From: 0x10d0, To: 0x140}, + 57: {From: 0x1104, To: 0x2d0}, + 58: {From: 0x11a0, To: 0x1ec}, + 59: {From: 0x1279, To: 0x21}, + 60: {From: 0x1424, To: 0x15e}, + 61: {From: 0x1470, To: 0x14e}, + 62: {From: 0x151f, To: 0xd9b}, + 63: {From: 0x1523, To: 0x390}, + 64: {From: 0x1532, To: 0x19f}, + 65: {From: 0x1580, To: 0x210}, + 66: {From: 0x1583, To: 0x10d}, + 67: {From: 0x15a3, To: 0x3caf}, + 68: {From: 0x1630, To: 0x222e}, + 69: {From: 0x166a, To: 0x19b}, + 70: {From: 0x16c8, To: 0x136}, + 71: {From: 0x1700, To: 0x29f8}, + 72: {From: 0x1718, To: 0x194}, + 73: {From: 0x1727, To: 0xf3f}, + 74: {From: 0x177a, To: 0x178}, + 75: {From: 0x1809, To: 0x17b6}, + 76: {From: 0x1816, To: 0x18f3}, + 77: {From: 0x188a, To: 0x436}, + 78: {From: 0x1979, To: 0x1d01}, + 79: {From: 0x1a74, To: 0x2bb0}, + 80: {From: 0x1a8a, To: 0x1f8}, + 81: {From: 0x1b5a, To: 0x1fa}, + 82: {From: 0x1b86, To: 0x1515}, + 83: {From: 0x1d64, To: 0x2c9b}, + 84: {From: 0x2038, To: 0x37b1}, + 85: {From: 0x203d, To: 0x20dd}, + 86: {From: 0x2042, To: 0x2e00}, + 87: {From: 0x205a, To: 0x30b}, + 88: {From: 0x20e3, To: 0x274}, + 89: {From: 0x20ee, To: 0x263}, + 90: {From: 0x20f2, To: 0x22d}, + 91: {From: 0x20f9, To: 0x256}, + 92: {From: 0x210f, To: 0x21eb}, + 93: {From: 0x2135, To: 0x27d}, + 94: {From: 0x2160, To: 0x913}, + 95: {From: 0x2199, To: 0x121}, + 96: {From: 0x21ce, To: 0x1561}, + 97: {From: 0x21e6, To: 0x504}, + 98: {From: 0x21f4, To: 0x49f}, + 99: {From: 0x21fb, To: 0x269}, + 100: {From: 0x222d, To: 0x121}, + 101: {From: 0x2237, To: 0x121}, + 102: {From: 0x2248, To: 0x217d}, + 103: {From: 0x2262, To: 0x92a}, + 104: {From: 0x2316, To: 0x3226}, + 105: {From: 0x236a, To: 0x2835}, + 106: {From: 0x2382, To: 0x3365}, + 107: {From: 0x2472, To: 0x2c7}, + 108: {From: 0x24e4, To: 0x2ff}, + 109: {From: 0x24f0, To: 0x2fa}, + 110: {From: 0x24fa, To: 0x31f}, + 111: {From: 0x2550, To: 0xb5b}, + 112: {From: 0x25a9, To: 0xe2}, + 113: {From: 0x263e, To: 0x2d0}, + 114: {From: 0x26c9, To: 0x26b4}, + 115: {From: 0x26f9, To: 0x3c8}, + 116: {From: 0x2727, To: 0x3caf}, + 117: {From: 0x2755, To: 0x6a4}, + 118: {From: 0x2765, To: 0x26b4}, + 119: {From: 0x2789, To: 0x4358}, + 120: {From: 0x27c9, To: 0x2001}, + 121: {From: 0x28ea, To: 0x27b1}, + 122: {From: 0x28ef, To: 0x2837}, + 123: {From: 0x28fe, To: 0xaa5}, + 124: {From: 0x2914, To: 0x351}, + 125: {From: 0x2986, To: 0x2da7}, + 126: {From: 0x29f0, To: 0x96b}, + 127: {From: 0x2b1a, To: 0x38d}, + 128: {From: 0x2bfc, To: 0x395}, + 129: {From: 0x2c3f, To: 0x3caf}, + 130: {From: 0x2ce1, To: 0x2201}, + 131: {From: 0x2cfc, To: 0x3be}, + 132: {From: 0x2d13, To: 0x597}, + 133: {From: 0x2d47, To: 0x148}, + 134: {From: 0x2d48, To: 0x148}, + 135: {From: 0x2dff, To: 0x2f1}, + 136: {From: 0x2e08, To: 0x19cc}, + 137: {From: 0x2e10, To: 0xc45}, + 138: {From: 0x2e1a, To: 0x2d95}, + 139: {From: 0x2e21, To: 0x292}, + 140: {From: 0x2e54, To: 0x7d}, + 141: {From: 0x2e65, To: 0x2282}, + 142: {From: 0x2e97, To: 0x1a4}, + 143: {From: 0x2ea0, To: 0x2e9b}, + 144: {From: 0x2eef, To: 0x2ed7}, + 145: {From: 0x3193, To: 0x3c4}, + 146: {From: 0x3366, To: 0x338e}, + 147: {From: 0x342a, To: 0x3dc}, + 148: {From: 0x34ee, To: 0x18d0}, + 149: {From: 0x35c8, To: 0x2c9b}, + 150: {From: 0x35e6, To: 0x412}, + 151: {From: 0x35f5, To: 0x24b}, + 152: {From: 0x360d, To: 0x1dc}, + 153: {From: 0x3658, To: 0x246}, + 154: {From: 0x3676, To: 0x3f4}, + 155: {From: 0x36fd, To: 0x445}, + 156: {From: 0x3747, To: 0x3b42}, + 157: {From: 0x37c0, To: 0x121}, + 158: {From: 0x3816, To: 0x38f2}, + 159: {From: 0x382a, To: 0x2b48}, + 160: {From: 0x382b, To: 0x2c9b}, + 161: {From: 0x382f, To: 0xa9}, + 162: {From: 0x3832, To: 0x3228}, + 163: {From: 0x386c, To: 0x39a6}, + 164: {From: 0x3892, To: 0x3fc0}, + 165: {From: 0x38a0, To: 0x45f}, + 166: {From: 0x38a5, To: 0x39d7}, + 167: {From: 0x38b4, To: 0x1fa4}, + 168: {From: 0x38b5, To: 0x2e9a}, + 169: {From: 0x38fa, To: 0x38f1}, + 170: {From: 0x395c, To: 0x47e}, + 171: {From: 0x3b4e, To: 0xd91}, + 172: {From: 0x3b78, To: 0x137}, + 173: {From: 0x3c99, To: 0x4bc}, + 174: {From: 0x3fbd, To: 0x100}, + 175: {From: 0x4208, To: 0xa91}, + 176: {From: 0x42be, To: 0x573}, + 177: {From: 0x42f9, To: 0x3f60}, + 178: {From: 0x4378, To: 0x25a}, + 179: {From: 0x43b8, To: 0xe6c}, + 180: {From: 0x43cd, To: 0x10f}, + 181: {From: 0x43d4, To: 0x4848}, + 182: {From: 0x44af, To: 0x3322}, + 183: {From: 0x44e3, To: 0x512}, + 184: {From: 0x45ca, To: 0x2409}, + 185: {From: 0x45dd, To: 0x26dc}, + 186: {From: 0x4610, To: 0x48ae}, + 187: {From: 0x46ae, To: 0x46a0}, + 188: {From: 0x473e, To: 0x4745}, + 189: {From: 0x4817, To: 0x3503}, + 190: {From: 0x483b, To: 0x208b}, + 191: {From: 0x4916, To: 0x31f}, + 192: {From: 0x49a7, To: 0x523}, } -// Size: 179 bytes, 179 elements -var AliasTypes = [179]AliasType{ +// Size: 193 bytes, 193 elements +var AliasTypes = [193]AliasType{ // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, 0, 2, - 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, - 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 0, 0, + 1, 2, 1, 1, 2, 0, 0, 1, 0, 1, 2, 1, 1, 0, 0, 0, + 0, 2, 1, 1, 0, 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, + 1, 1, 1, 0, 0, 0, 0, 2, 1, 1, 1, 1, 2, 1, 0, 1, // Entry 40 - 7F - 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, - 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, - 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, 1, 1, 0, 1, - 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 1, 0, 0, 1, 0, + 1, 2, 2, 0, 0, 1, 2, 0, 1, 0, 1, 1, 1, 1, 0, 0, + 2, 1, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 0, 1, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 1, 2, 2, 2, 0, + 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, // Entry 80 - BF - 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 0, 2, - 1, 1, 1, 0, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, - 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, - 0, 1, 1, + 1, 0, 0, 1, 0, 2, 1, 1, 0, 0, 0, 1, 0, 0, 0, 0, + 0, 1, 1, 2, 0, 0, 2, 0, 0, 1, 1, 1, 0, 0, 0, 0, + 0, 2, 0, 0, 0, 0, 0, 0, 0, 0, 1, 1, 0, 1, 2, 0, + 0, 0, 1, 0, 1, 0, 0, 1, 0, 0, 0, 0, 1, 0, 0, 1, + // Entry C0 - FF + 1, } const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) // script is an alphabetically sorted list of ISO 15924 codes. The index // of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 1040 bytes +const script tag.Index = "" + // Size: 1052 bytes "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + "BrahBraiBugiBuhdCakmCansCariChamCherChrsCirtCoptCpmnCprtCyrlCyrsDevaDiak" + "DogrDsrtDuplEgydEgyhEgypElbaElymEthiGeokGeorGlagGongGonmGothGranGrekGujr" + "GuruHanbHangHaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamo" + - "JavaJpanJurcKaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatg" + - "LatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMend" + - "MercMeroMlymModiMongMoonMrooMteiMultMymrNandNarbNbatNewaNkdbNkgbNkooNshu" + - "OgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlvPhnxPiqd" + - "PlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaamQaanQaao" + - "QaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabeQabfQabg" + - "QabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabwQabxRanj" + - "RjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogdSogoSora" + - "SoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglg" + - "ThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsuxYeziYiiiZanb" + - "ZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + "JavaJpanJurcKaliKanaKawiKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatf" + + "LatgLatnLekeLepcLimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedf" + + "MendMercMeroMlymModiMongMoonMrooMteiMultMymrNagmNandNarbNbatNewaNkdbNkgb" + + "NkooNshuOgamOlckOrkhOryaOsgeOsmaOugrPalmPaucPcunPelmPermPhagPhliPhlpPhlv" + + "PhnxPiqdPlrdPrtiPsinQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + + "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + + "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + + "QabxRanjRjngRohgRoroRunrSamrSaraSarbSaurSgnwShawShrdShuiSiddSindSinhSogd" + + "SogoSoraSoyoSundSunuSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTelu" + + "TengTfngTglgThaaThaiTibtTirhTnsaTotoUgarVaiiVispVithWaraWchoWoleXpeoXsux" + + "YeziYiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" // suppressScript is an index from langID to the dominant script for that language, // if it exists. If a script is given, it should be suppressed from the language tag. @@ -824,7 +840,7 @@ var suppressScript = [1330]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x2c, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -833,7 +849,7 @@ var suppressScript = [1330]uint8{ // Entry 40 - 7F 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -846,53 +862,53 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry C0 - FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F - 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xea, 0x00, 0x00, 0x00, 0x00, 0xec, 0x00, 0x00, + 0xed, 0x00, 0x00, 0x00, 0x00, 0xef, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x34, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x5b, 0x00, // Entry 140 - 17F - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 180 - 1BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x35, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x35, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x3e, 0x00, 0x22, 0x00, // Entry 1C0 - 1FF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x5a, 0x00, 0x5a, 0x5a, 0x00, 0x08, + 0x00, 0x5b, 0x5b, 0x00, 0x5b, 0x5b, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x5a, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x5b, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, // Entry 200 - 23F 0x49, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -903,9 +919,9 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 240 - 27F - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x00, 0x00, 0x4e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x53, 0x00, 0x22, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x00, 0x00, 0x4f, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x53, 0x00, 0x00, 0x54, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -913,93 +929,93 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 280 - 2BF 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, + 0x58, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 2C0 - 2FF - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6e, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x6f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5a, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x22, 0x00, 0x00, 0x00, 0x5b, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0x76, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x5a, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x7c, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x5b, 0x22, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x7e, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x83, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x36, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, // Entry 3C0 - 3FF - 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x20, 0x00, 0x00, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x20, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 400 - 43F - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xd4, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x5a, 0x5a, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x5b, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xe3, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xe6, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xe6, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xeb, 0x00, 0x00, 0x00, 0x2c, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x00, 0xe9, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xee, 0x00, 0x00, 0x00, 0x2c, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, // Entry 480 - 4BF - 0x5a, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x5a, 0x00, + 0x5b, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 4C0 - 4FF - 0x5a, 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, + 0x5b, 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x5a, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x5b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 500 - 53F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1007,7 +1023,7 @@ var suppressScript = [1330]uint8{ 0x00, 0x00, 0x3e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5a, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x5b, 0x00, 0x00, } @@ -1016,16 +1032,16 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) // isoRegionOffset needs to be added to the index of regionISO to obtain the regionID @@ -1034,8 +1050,8 @@ const ( const isoRegionOffset = 32 // regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionTypes = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, @@ -1048,45 +1064,45 @@ var regionTypes = [358]uint8{ // Entry 40 - 7F 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x04, 0x06, + 0x04, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x04, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry 80 - BF 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x00, 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x05, 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, } // regionISO holds a list of alphabetically sorted 2-letter ISO region codes. @@ -1094,27 +1110,27 @@ var regionTypes = [358]uint8{ // - [A-Z}{2}: the first letter of the 2-letter code plus these two // letters form the 3-letter ISO code. // - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes +const regionISO tag.Index = "" + // Size: 1312 bytes "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + "CQ CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADO" + + "OMDYHYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSM" + + "FOROFQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQ" + + "NQGRRCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERL" + + "ILSRIMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM" + + "\x00\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSO" + + "LTTULUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNP" + + "MQTQMRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLD" + + "NOORNPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM" + + "\x00\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSS" + + "QTTTQU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLB" + + "SCYCSDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXM" + + "SYYRSZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTT" + + "TOTVUVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVN" + + "NMVUUTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXN" + + "NNXOOOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUG" + + "ZAAFZMMBZRARZWWEZZZZ\xff\xff\xff\xff" // altRegionISO3 holds a list of 3-letter region codes that cannot be // mapped to 2-letter codes using the default algorithm. This is a short list. @@ -1124,38 +1140,38 @@ const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" // of the 3-letter ISO codes in altRegionISO3. // Size: 22 bytes, 11 elements var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, + 0x0058, 0x0071, 0x0089, 0x00a9, 0x00ab, 0x00ae, 0x00eb, 0x0106, + 0x0122, 0x0160, 0x00dd, } // Size: 80 bytes, 20 elements var regionOldMap = [20]FromTo{ - 0: {From: 0x44, To: 0xc4}, - 1: {From: 0x58, To: 0xa7}, - 2: {From: 0x5f, To: 0x60}, - 3: {From: 0x66, To: 0x3b}, - 4: {From: 0x79, To: 0x78}, - 5: {From: 0x93, To: 0x37}, - 6: {From: 0xa3, To: 0x133}, - 7: {From: 0xc1, To: 0x133}, - 8: {From: 0xd7, To: 0x13f}, - 9: {From: 0xdc, To: 0x2b}, - 10: {From: 0xef, To: 0x133}, - 11: {From: 0xf2, To: 0xe2}, - 12: {From: 0xfc, To: 0x70}, - 13: {From: 0x103, To: 0x164}, - 14: {From: 0x12a, To: 0x126}, - 15: {From: 0x132, To: 0x7b}, - 16: {From: 0x13a, To: 0x13e}, - 17: {From: 0x141, To: 0x133}, - 18: {From: 0x15d, To: 0x15e}, - 19: {From: 0x163, To: 0x4b}, + 0: {From: 0x44, To: 0xc5}, + 1: {From: 0x59, To: 0xa8}, + 2: {From: 0x60, To: 0x61}, + 3: {From: 0x67, To: 0x3b}, + 4: {From: 0x7a, To: 0x79}, + 5: {From: 0x94, To: 0x37}, + 6: {From: 0xa4, To: 0x134}, + 7: {From: 0xc2, To: 0x134}, + 8: {From: 0xd8, To: 0x140}, + 9: {From: 0xdd, To: 0x2b}, + 10: {From: 0xf0, To: 0x134}, + 11: {From: 0xf3, To: 0xe3}, + 12: {From: 0xfd, To: 0x71}, + 13: {From: 0x104, To: 0x165}, + 14: {From: 0x12b, To: 0x127}, + 15: {From: 0x133, To: 0x7c}, + 16: {From: 0x13b, To: 0x13f}, + 17: {From: 0x142, To: 0x134}, + 18: {From: 0x15e, To: 0x15f}, + 19: {From: 0x164, To: 0x4b}, } // m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are // codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ +// Size: 718 bytes, 359 elements +var m49 = [359]int16{ // Entry 0 - 3F 0, 1, 2, 3, 5, 9, 11, 13, 14, 15, 17, 18, 19, 21, 29, 30, @@ -1168,45 +1184,45 @@ var m49 = [358]int16{ // Entry 40 - 7F 535, 76, 44, 64, 104, 74, 72, 112, 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, + 184, 152, 120, 156, 170, 0, 0, 188, + 891, 296, 192, 132, 531, 162, 196, 203, + 278, 276, 0, 262, 208, 212, 214, 204, + 12, 0, 218, 233, 818, 732, 232, 724, + 231, 967, 0, 246, 242, 238, 583, 234, + 0, 250, 249, 266, 826, 308, 268, 254, // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, + 831, 288, 292, 304, 270, 324, 312, 226, + 300, 239, 320, 316, 624, 328, 344, 334, + 340, 191, 332, 348, 854, 0, 360, 372, + 376, 833, 356, 86, 368, 364, 352, 380, + 832, 388, 400, 392, 581, 404, 417, 116, + 296, 174, 659, 408, 410, 414, 136, 398, + 418, 422, 662, 438, 144, 430, 426, 440, + 442, 428, 434, 504, 492, 498, 499, 663, // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, + 450, 584, 581, 807, 466, 104, 496, 446, + 580, 474, 478, 500, 470, 480, 462, 454, + 484, 458, 508, 516, 540, 562, 574, 566, + 548, 558, 528, 578, 524, 10, 520, 536, + 570, 554, 512, 591, 0, 604, 258, 598, + 608, 586, 616, 666, 612, 630, 275, 620, + 581, 585, 600, 591, 634, 959, 960, 961, + 962, 963, 964, 965, 966, 967, 968, 969, // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, + 970, 971, 972, 638, 716, 642, 688, 643, + 646, 682, 90, 690, 729, 752, 702, 654, + 705, 744, 703, 694, 674, 686, 706, 740, + 728, 678, 810, 222, 534, 760, 748, 0, + 796, 148, 260, 768, 764, 762, 772, 626, + 795, 788, 776, 626, 792, 780, 798, 158, + 834, 804, 800, 826, 581, 0, 840, 858, + 860, 336, 670, 704, 862, 92, 850, 704, // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, + 548, 876, 581, 882, 973, 974, 975, 976, + 977, 978, 979, 980, 981, 982, 983, 984, + 985, 986, 987, 988, 989, 990, 991, 992, + 993, 994, 995, 996, 997, 998, 720, 887, + 175, 891, 710, 894, 180, 716, 999, } // m49Index gives indexes into fromM49 based on the three most significant bits @@ -1227,65 +1243,65 @@ var m49Index = [9]int16{ var fromM49 = [333]uint16{ // Entry 0 - 3F 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x1606, 0x1868, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + 0xac9b, 0xb50a, 0xb93d, 0xc03e, 0xc838, 0xd0c5, 0xd83a, 0xe047, + 0xe8a7, 0xf052, 0xf849, 0x085b, 0x10ae, 0x184c, 0x1c17, 0x1e18, // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + 0x20b4, 0x2219, 0x2921, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2f, 0x445d, 0x4c4a, 0x5454, 0x5ca9, 0x5f60, 0x644d, + 0x684b, 0x7050, 0x7857, 0x7e91, 0x805a, 0x885e, 0x941e, 0x965f, + 0x983b, 0xa064, 0xa865, 0xac66, 0xb46a, 0xbd1b, 0xc487, 0xcc70, + 0xce70, 0xd06e, 0xd26b, 0xd477, 0xdc75, 0xde89, 0xe474, 0xec73, + 0xf031, 0xf27a, 0xf479, 0xfc7f, 0x04e6, 0x0922, 0x0c63, 0x147b, + 0x187e, 0x1c84, 0x26ee, 0x2861, 0x2c60, 0x3061, 0x4081, 0x4882, + 0x50a8, 0x5888, 0x6083, 0x687d, 0x7086, 0x788b, 0x808a, 0x8885, // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + 0x908d, 0x9892, 0x9c8f, 0xa139, 0xa890, 0xb08e, 0xb893, 0xc09e, + 0xc89a, 0xd096, 0xd89d, 0xe09c, 0xe897, 0xf098, 0xf89f, 0x004f, + 0x08a1, 0x10a3, 0x1caf, 0x20a2, 0x28a5, 0x30ab, 0x34ac, 0x3cad, + 0x42a6, 0x44b0, 0x461f, 0x4cb1, 0x54b6, 0x58b9, 0x5cb5, 0x64ba, + 0x6cb3, 0x70b7, 0x74b8, 0x7cc7, 0x84c0, 0x8ccf, 0x94d1, 0x9cce, + 0xa4c4, 0xaccc, 0xb4c9, 0xbcca, 0xc0cd, 0xc8d0, 0xd8bc, 0xe0c6, + 0xe4bd, 0xe6be, 0xe8cb, 0xf0bb, 0xf8d2, 0x00e2, 0x08d3, 0x10de, + 0x18dc, 0x20da, 0x2429, 0x265c, 0x2a30, 0x2d1c, 0x2e40, 0x30df, // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + 0x38d4, 0x4940, 0x54e1, 0x5cd9, 0x64d5, 0x6cd7, 0x74e0, 0x7cd6, + 0x84db, 0x88c8, 0x8b34, 0x8e76, 0x90c1, 0x92f1, 0x94e9, 0x9ee3, + 0xace7, 0xb0f2, 0xb8e5, 0xc0e8, 0xc8ec, 0xd0ea, 0xd8ef, 0xe08c, + 0xe527, 0xeced, 0xf4f4, 0xfd03, 0x0505, 0x0707, 0x0d08, 0x183c, + 0x1d0f, 0x26aa, 0x2826, 0x2cb2, 0x2ebf, 0x34eb, 0x3d3a, 0x4514, + 0x4d19, 0x5509, 0x5d15, 0x6106, 0x650b, 0x6d13, 0x7d0e, 0x7f12, + 0x813f, 0x8310, 0x8516, 0x8d62, 0x9965, 0xa15e, 0xa86f, 0xb118, + 0xb30c, 0xb86d, 0xc10c, 0xc917, 0xd111, 0xd91e, 0xe10d, 0xe84e, // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + 0xf11d, 0xf525, 0xf924, 0x0123, 0x0926, 0x112a, 0x192d, 0x2023, + 0x2929, 0x312c, 0x3728, 0x3920, 0x3d2e, 0x4132, 0x4931, 0x4ec3, + 0x551a, 0x646c, 0x747c, 0x7e80, 0x80a0, 0x8299, 0x8530, 0x9136, + 0xa53e, 0xac37, 0xb537, 0xb938, 0xbd3c, 0xd941, 0xe543, 0xed5f, + 0xef5f, 0xf658, 0xfd63, 0x7c20, 0x7ef5, 0x80f6, 0x82f7, 0x84f8, + 0x86f9, 0x88fa, 0x8afb, 0x8cfc, 0x8e71, 0x90fe, 0x92ff, 0x9500, + 0x9701, 0x9902, 0x9b44, 0x9d45, 0x9f46, 0xa147, 0xa348, 0xa549, + 0xa74a, 0xa94b, 0xab4c, 0xad4d, 0xaf4e, 0xb14f, 0xb350, 0xb551, // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, + 0xb752, 0xb953, 0xbb54, 0xbd55, 0xbf56, 0xc157, 0xc358, 0xc559, + 0xc75a, 0xc95b, 0xcb5c, 0xcd5d, 0xcf66, } -// Size: 2014 bytes +// Size: 2128 bytes var variantIndex = map[string]uint8{ "1606nict": 0x0, "1694acad": 0x1, "1901": 0x2, "1959acad": 0x3, - "1994": 0x61, + "1994": 0x67, "1996": 0x4, "abl1943": 0x5, "akuapem": 0x6, - "alalc97": 0x63, + "alalc97": 0x69, "aluku": 0x7, "ao1990": 0x8, "aranes": 0x9, @@ -1299,94 +1315,100 @@ var variantIndex = map[string]uint8{ "barla": 0x11, "basiceng": 0x12, "bauddha": 0x13, - "biscayan": 0x14, - "biske": 0x5c, - "bohoric": 0x15, - "boont": 0x16, - "bornholm": 0x17, - "cisaup": 0x18, - "colb1945": 0x19, - "cornu": 0x1a, - "creiss": 0x1b, - "dajnko": 0x1c, - "ekavsk": 0x1d, - "emodeng": 0x1e, - "fonipa": 0x64, - "fonkirsh": 0x65, - "fonnapa": 0x66, - "fonupa": 0x67, - "fonxsamp": 0x68, - "gascon": 0x1f, - "grclass": 0x20, - "grital": 0x21, - "grmistr": 0x22, - "hepburn": 0x23, - "heploc": 0x62, - "hognorsk": 0x24, - "hsistemo": 0x25, - "ijekavsk": 0x26, - "itihasa": 0x27, - "ivanchov": 0x28, - "jauer": 0x29, - "jyutping": 0x2a, - "kkcor": 0x2b, - "kociewie": 0x2c, - "kscor": 0x2d, - "laukika": 0x2e, - "lemosin": 0x2f, - "lengadoc": 0x30, - "lipaw": 0x5d, - "luna1918": 0x31, - "metelko": 0x32, - "monoton": 0x33, - "ndyuka": 0x34, - "nedis": 0x35, - "newfound": 0x36, - "nicard": 0x37, - "njiva": 0x5e, - "nulik": 0x38, - "osojs": 0x5f, - "oxendict": 0x39, - "pahawh2": 0x3a, - "pahawh3": 0x3b, - "pahawh4": 0x3c, - "pamaka": 0x3d, - "peano": 0x3e, - "petr1708": 0x3f, - "pinyin": 0x40, - "polyton": 0x41, - "provenc": 0x42, - "puter": 0x43, - "rigik": 0x44, - "rozaj": 0x45, - "rumgr": 0x46, - "scotland": 0x47, - "scouse": 0x48, - "simple": 0x69, - "solba": 0x60, - "sotav": 0x49, - "spanglis": 0x4a, - "surmiran": 0x4b, - "sursilv": 0x4c, - "sutsilv": 0x4d, - "tarask": 0x4e, - "tongyong": 0x4f, - "tunumiit": 0x50, - "uccor": 0x51, - "ucrcor": 0x52, - "ulster": 0x53, - "unifon": 0x54, - "vaidika": 0x55, - "valencia": 0x56, - "vallader": 0x57, - "vecdruka": 0x58, - "vivaraup": 0x59, - "wadegile": 0x5a, - "xsistemo": 0x5b, + "bciav": 0x14, + "bcizbl": 0x15, + "biscayan": 0x16, + "biske": 0x62, + "bohoric": 0x17, + "boont": 0x18, + "bornholm": 0x19, + "cisaup": 0x1a, + "colb1945": 0x1b, + "cornu": 0x1c, + "creiss": 0x1d, + "dajnko": 0x1e, + "ekavsk": 0x1f, + "emodeng": 0x20, + "fonipa": 0x6a, + "fonkirsh": 0x6b, + "fonnapa": 0x6c, + "fonupa": 0x6d, + "fonxsamp": 0x6e, + "gallo": 0x21, + "gascon": 0x22, + "grclass": 0x23, + "grital": 0x24, + "grmistr": 0x25, + "hepburn": 0x26, + "heploc": 0x68, + "hognorsk": 0x27, + "hsistemo": 0x28, + "ijekavsk": 0x29, + "itihasa": 0x2a, + "ivanchov": 0x2b, + "jauer": 0x2c, + "jyutping": 0x2d, + "kkcor": 0x2e, + "kociewie": 0x2f, + "kscor": 0x30, + "laukika": 0x31, + "lemosin": 0x32, + "lengadoc": 0x33, + "lipaw": 0x63, + "ltg1929": 0x34, + "ltg2007": 0x35, + "luna1918": 0x36, + "metelko": 0x37, + "monoton": 0x38, + "ndyuka": 0x39, + "nedis": 0x3a, + "newfound": 0x3b, + "nicard": 0x3c, + "njiva": 0x64, + "nulik": 0x3d, + "osojs": 0x65, + "oxendict": 0x3e, + "pahawh2": 0x3f, + "pahawh3": 0x40, + "pahawh4": 0x41, + "pamaka": 0x42, + "peano": 0x43, + "petr1708": 0x44, + "pinyin": 0x45, + "polyton": 0x46, + "provenc": 0x47, + "puter": 0x48, + "rigik": 0x49, + "rozaj": 0x4a, + "rumgr": 0x4b, + "scotland": 0x4c, + "scouse": 0x4d, + "simple": 0x6f, + "solba": 0x66, + "sotav": 0x4e, + "spanglis": 0x4f, + "surmiran": 0x50, + "sursilv": 0x51, + "sutsilv": 0x52, + "synnejyl": 0x53, + "tarask": 0x54, + "tongyong": 0x55, + "tunumiit": 0x56, + "uccor": 0x57, + "ucrcor": 0x58, + "ulster": 0x59, + "unifon": 0x5a, + "vaidika": 0x5b, + "valencia": 0x5c, + "vallader": 0x5d, + "vecdruka": 0x5e, + "vivaraup": 0x5f, + "wadegile": 0x60, + "xsistemo": 0x61, } // variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 99 +const variantNumSpecialized = 105 // nRegionGroups is the number of region groups. const nRegionGroups = 33 @@ -1398,151 +1420,151 @@ type likelyLangRegion struct { // likelyScript is a lookup table, indexed by scriptID, for the most likely // languages and regions given a script. -// Size: 1040 bytes, 260 elements -var likelyScript = [260]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, +// Size: 1052 bytes, 263 elements +var likelyScript = [263]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x85}, + 3: {lang: 0x2a2, region: 0x107}, + 4: {lang: 0x1f, region: 0x9a}, + 5: {lang: 0x3a, region: 0x6c}, + 7: {lang: 0x3b, region: 0x9d}, 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, + 9: {lang: 0x13, region: 0x9d}, + 10: {lang: 0x5b, region: 0x96}, 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, + 12: {lang: 0xb9, region: 0xb5}, + 13: {lang: 0x63, region: 0x96}, 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, + 15: {lang: 0x3e9, region: 0x9a}, + 17: {lang: 0x529, region: 0x12f}, + 18: {lang: 0x3b1, region: 0x9a}, + 19: {lang: 0x15e, region: 0x79}, + 20: {lang: 0xc2, region: 0x96}, + 21: {lang: 0x9d, region: 0xe8}, 22: {lang: 0xdb, region: 0x35}, 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 29: {lang: 0xf1, region: 0x6b}, - 31: {lang: 0x1a0, region: 0x5d}, - 32: {lang: 0x3e2, region: 0x106}, - 34: {lang: 0x1be, region: 0x99}, - 38: {lang: 0x15e, region: 0x78}, - 41: {lang: 0x133, region: 0x6b}, + 24: {lang: 0x4f0, region: 0x12c}, + 25: {lang: 0xe7, region: 0x13f}, + 26: {lang: 0xe5, region: 0x136}, + 29: {lang: 0xf1, region: 0x6c}, + 31: {lang: 0x1a0, region: 0x5e}, + 32: {lang: 0x3e2, region: 0x107}, + 34: {lang: 0x1be, region: 0x9a}, + 38: {lang: 0x15e, region: 0x79}, + 41: {lang: 0x133, region: 0x6c}, 42: {lang: 0x431, region: 0x27}, - 44: {lang: 0x27, region: 0x6f}, - 46: {lang: 0x210, region: 0x7d}, + 44: {lang: 0x27, region: 0x70}, + 46: {lang: 0x210, region: 0x7e}, 47: {lang: 0xfe, region: 0x38}, - 49: {lang: 0x19b, region: 0x99}, - 50: {lang: 0x19e, region: 0x130}, - 51: {lang: 0x3e9, region: 0x99}, - 52: {lang: 0x136, region: 0x87}, - 53: {lang: 0x1a4, region: 0x99}, - 54: {lang: 0x39d, region: 0x99}, - 55: {lang: 0x529, region: 0x12e}, - 56: {lang: 0x254, region: 0xab}, + 49: {lang: 0x19b, region: 0x9a}, + 50: {lang: 0x19e, region: 0x131}, + 51: {lang: 0x3e9, region: 0x9a}, + 52: {lang: 0x136, region: 0x88}, + 53: {lang: 0x1a4, region: 0x9a}, + 54: {lang: 0x39d, region: 0x9a}, + 55: {lang: 0x529, region: 0x12f}, + 56: {lang: 0x254, region: 0xac}, 57: {lang: 0x529, region: 0x53}, - 58: {lang: 0x1cb, region: 0xe7}, + 58: {lang: 0x1cb, region: 0xe8}, 59: {lang: 0x529, region: 0x53}, - 60: {lang: 0x529, region: 0x12e}, - 61: {lang: 0x2fd, region: 0x9b}, - 62: {lang: 0x1bc, region: 0x97}, - 63: {lang: 0x200, region: 0xa2}, - 64: {lang: 0x1c5, region: 0x12b}, - 65: {lang: 0x1ca, region: 0xaf}, - 68: {lang: 0x1d5, region: 0x92}, - 70: {lang: 0x142, region: 0x9e}, - 71: {lang: 0x254, region: 0xab}, - 72: {lang: 0x20e, region: 0x95}, - 73: {lang: 0x200, region: 0xa2}, - 75: {lang: 0x135, region: 0xc4}, - 76: {lang: 0x200, region: 0xa2}, - 77: {lang: 0x3bb, region: 0xe8}, - 78: {lang: 0x24a, region: 0xa6}, - 79: {lang: 0x3fa, region: 0x99}, - 82: {lang: 0x251, region: 0x99}, - 83: {lang: 0x254, region: 0xab}, - 85: {lang: 0x88, region: 0x99}, - 86: {lang: 0x370, region: 0x123}, - 87: {lang: 0x2b8, region: 0xaf}, - 92: {lang: 0x29f, region: 0x99}, - 93: {lang: 0x2a8, region: 0x99}, - 94: {lang: 0x28f, region: 0x87}, - 95: {lang: 0x1a0, region: 0x87}, - 96: {lang: 0x2ac, region: 0x53}, - 98: {lang: 0x4f4, region: 0x12b}, - 99: {lang: 0x4f5, region: 0x12b}, - 100: {lang: 0x1be, region: 0x99}, - 102: {lang: 0x337, region: 0x9c}, - 103: {lang: 0x4f7, region: 0x53}, - 104: {lang: 0xa9, region: 0x53}, - 107: {lang: 0x2e8, region: 0x112}, - 108: {lang: 0x4f8, region: 0x10b}, - 109: {lang: 0x4f8, region: 0x10b}, - 110: {lang: 0x304, region: 0x99}, - 111: {lang: 0x31b, region: 0x99}, - 112: {lang: 0x30b, region: 0x53}, - 114: {lang: 0x31e, region: 0x35}, - 115: {lang: 0x30e, region: 0x99}, - 116: {lang: 0x414, region: 0xe8}, - 117: {lang: 0x331, region: 0xc4}, - 119: {lang: 0x4f9, region: 0x108}, - 120: {lang: 0x3b, region: 0xa1}, - 121: {lang: 0x353, region: 0xdb}, - 124: {lang: 0x2d0, region: 0x84}, - 125: {lang: 0x52a, region: 0x53}, - 126: {lang: 0x403, region: 0x96}, - 127: {lang: 0x3ee, region: 0x99}, - 128: {lang: 0x39b, region: 0xc5}, - 129: {lang: 0x395, region: 0x99}, - 130: {lang: 0x399, region: 0x135}, - 131: {lang: 0x429, region: 0x115}, - 133: {lang: 0x3b, region: 0x11c}, - 134: {lang: 0xfd, region: 0xc4}, - 137: {lang: 0x27d, region: 0x106}, - 138: {lang: 0x2c9, region: 0x53}, - 139: {lang: 0x39f, region: 0x9c}, - 140: {lang: 0x39f, region: 0x53}, - 142: {lang: 0x3ad, region: 0xb0}, - 144: {lang: 0x1c6, region: 0x53}, - 145: {lang: 0x4fd, region: 0x9c}, - 198: {lang: 0x3cb, region: 0x95}, - 201: {lang: 0x372, region: 0x10c}, - 202: {lang: 0x420, region: 0x97}, - 204: {lang: 0x4ff, region: 0x15e}, - 205: {lang: 0x3f0, region: 0x99}, - 206: {lang: 0x45, region: 0x135}, - 207: {lang: 0x139, region: 0x7b}, - 208: {lang: 0x3e9, region: 0x99}, - 210: {lang: 0x3e9, region: 0x99}, - 211: {lang: 0x3fa, region: 0x99}, - 212: {lang: 0x40c, region: 0xb3}, - 215: {lang: 0x433, region: 0x99}, - 216: {lang: 0xef, region: 0xc5}, - 217: {lang: 0x43e, region: 0x95}, - 218: {lang: 0x44d, region: 0x35}, - 219: {lang: 0x44e, region: 0x9b}, - 223: {lang: 0x45a, region: 0xe7}, - 224: {lang: 0x11a, region: 0x99}, - 225: {lang: 0x45e, region: 0x53}, - 226: {lang: 0x232, region: 0x53}, - 227: {lang: 0x450, region: 0x99}, - 228: {lang: 0x4a5, region: 0x53}, - 229: {lang: 0x9f, region: 0x13e}, - 230: {lang: 0x461, region: 0x99}, - 232: {lang: 0x528, region: 0xba}, - 233: {lang: 0x153, region: 0xe7}, - 234: {lang: 0x128, region: 0xcd}, - 235: {lang: 0x46b, region: 0x123}, - 236: {lang: 0xa9, region: 0x53}, - 237: {lang: 0x2ce, region: 0x99}, - 240: {lang: 0x4ad, region: 0x11c}, - 241: {lang: 0x4be, region: 0xb4}, - 244: {lang: 0x1ce, region: 0x99}, - 247: {lang: 0x3a9, region: 0x9c}, - 248: {lang: 0x22, region: 0x9b}, - 250: {lang: 0x1ea, region: 0x53}, - 251: {lang: 0xef, region: 0xc5}, + 60: {lang: 0x529, region: 0x12f}, + 61: {lang: 0x2fd, region: 0x9c}, + 62: {lang: 0x1bc, region: 0x98}, + 63: {lang: 0x200, region: 0xa3}, + 64: {lang: 0x1c5, region: 0x12c}, + 65: {lang: 0x1ca, region: 0xb0}, + 68: {lang: 0x1d5, region: 0x93}, + 70: {lang: 0x142, region: 0x9f}, + 71: {lang: 0x254, region: 0xac}, + 72: {lang: 0x20e, region: 0x96}, + 73: {lang: 0x200, region: 0xa3}, + 75: {lang: 0x135, region: 0xc5}, + 76: {lang: 0x200, region: 0xa3}, + 78: {lang: 0x3bb, region: 0xe9}, + 79: {lang: 0x24a, region: 0xa7}, + 80: {lang: 0x3fa, region: 0x9a}, + 83: {lang: 0x251, region: 0x9a}, + 84: {lang: 0x254, region: 0xac}, + 86: {lang: 0x88, region: 0x9a}, + 87: {lang: 0x370, region: 0x124}, + 88: {lang: 0x2b8, region: 0xb0}, + 93: {lang: 0x29f, region: 0x9a}, + 94: {lang: 0x2a8, region: 0x9a}, + 95: {lang: 0x28f, region: 0x88}, + 96: {lang: 0x1a0, region: 0x88}, + 97: {lang: 0x2ac, region: 0x53}, + 99: {lang: 0x4f4, region: 0x12c}, + 100: {lang: 0x4f5, region: 0x12c}, + 101: {lang: 0x1be, region: 0x9a}, + 103: {lang: 0x337, region: 0x9d}, + 104: {lang: 0x4f7, region: 0x53}, + 105: {lang: 0xa9, region: 0x53}, + 108: {lang: 0x2e8, region: 0x113}, + 109: {lang: 0x4f8, region: 0x10c}, + 110: {lang: 0x4f8, region: 0x10c}, + 111: {lang: 0x304, region: 0x9a}, + 112: {lang: 0x31b, region: 0x9a}, + 113: {lang: 0x30b, region: 0x53}, + 115: {lang: 0x31e, region: 0x35}, + 116: {lang: 0x30e, region: 0x9a}, + 117: {lang: 0x414, region: 0xe9}, + 118: {lang: 0x331, region: 0xc5}, + 121: {lang: 0x4f9, region: 0x109}, + 122: {lang: 0x3b, region: 0xa2}, + 123: {lang: 0x353, region: 0xdc}, + 126: {lang: 0x2d0, region: 0x85}, + 127: {lang: 0x52a, region: 0x53}, + 128: {lang: 0x403, region: 0x97}, + 129: {lang: 0x3ee, region: 0x9a}, + 130: {lang: 0x39b, region: 0xc6}, + 131: {lang: 0x395, region: 0x9a}, + 132: {lang: 0x399, region: 0x136}, + 133: {lang: 0x429, region: 0x116}, + 135: {lang: 0x3b, region: 0x11d}, + 136: {lang: 0xfd, region: 0xc5}, + 139: {lang: 0x27d, region: 0x107}, + 140: {lang: 0x2c9, region: 0x53}, + 141: {lang: 0x39f, region: 0x9d}, + 142: {lang: 0x39f, region: 0x53}, + 144: {lang: 0x3ad, region: 0xb1}, + 146: {lang: 0x1c6, region: 0x53}, + 147: {lang: 0x4fd, region: 0x9d}, + 200: {lang: 0x3cb, region: 0x96}, + 203: {lang: 0x372, region: 0x10d}, + 204: {lang: 0x420, region: 0x98}, + 206: {lang: 0x4ff, region: 0x15f}, + 207: {lang: 0x3f0, region: 0x9a}, + 208: {lang: 0x45, region: 0x136}, + 209: {lang: 0x139, region: 0x7c}, + 210: {lang: 0x3e9, region: 0x9a}, + 212: {lang: 0x3e9, region: 0x9a}, + 213: {lang: 0x3fa, region: 0x9a}, + 214: {lang: 0x40c, region: 0xb4}, + 217: {lang: 0x433, region: 0x9a}, + 218: {lang: 0xef, region: 0xc6}, + 219: {lang: 0x43e, region: 0x96}, + 221: {lang: 0x44d, region: 0x35}, + 222: {lang: 0x44e, region: 0x9c}, + 226: {lang: 0x45a, region: 0xe8}, + 227: {lang: 0x11a, region: 0x9a}, + 228: {lang: 0x45e, region: 0x53}, + 229: {lang: 0x232, region: 0x53}, + 230: {lang: 0x450, region: 0x9a}, + 231: {lang: 0x4a5, region: 0x53}, + 232: {lang: 0x9f, region: 0x13f}, + 233: {lang: 0x461, region: 0x9a}, + 235: {lang: 0x528, region: 0xbb}, + 236: {lang: 0x153, region: 0xe8}, + 237: {lang: 0x128, region: 0xce}, + 238: {lang: 0x46b, region: 0x124}, + 239: {lang: 0xa9, region: 0x53}, + 240: {lang: 0x2ce, region: 0x9a}, + 243: {lang: 0x4ad, region: 0x11d}, + 244: {lang: 0x4be, region: 0xb5}, + 247: {lang: 0x1ce, region: 0x9a}, + 250: {lang: 0x3a9, region: 0x9d}, + 251: {lang: 0x22, region: 0x9c}, + 253: {lang: 0x1ea, region: 0x53}, + 254: {lang: 0xef, region: 0xc6}, } type likelyScriptRegion struct { @@ -1557,1423 +1579,1423 @@ type likelyScriptRegion struct { // of the list in likelyLangList. // Size: 7980 bytes, 1330 elements var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x5a, flags: 0x0}, - 1: {region: 0x6f, script: 0x5a, flags: 0x0}, - 2: {region: 0x165, script: 0x5a, flags: 0x0}, - 3: {region: 0x165, script: 0x5a, flags: 0x0}, - 4: {region: 0x165, script: 0x5a, flags: 0x0}, - 5: {region: 0x7d, script: 0x20, flags: 0x0}, - 6: {region: 0x165, script: 0x5a, flags: 0x0}, - 7: {region: 0x165, script: 0x20, flags: 0x0}, - 8: {region: 0x80, script: 0x5a, flags: 0x0}, - 9: {region: 0x165, script: 0x5a, flags: 0x0}, - 10: {region: 0x165, script: 0x5a, flags: 0x0}, - 11: {region: 0x165, script: 0x5a, flags: 0x0}, - 12: {region: 0x95, script: 0x5a, flags: 0x0}, - 13: {region: 0x131, script: 0x5a, flags: 0x0}, - 14: {region: 0x80, script: 0x5a, flags: 0x0}, - 15: {region: 0x165, script: 0x5a, flags: 0x0}, - 16: {region: 0x165, script: 0x5a, flags: 0x0}, - 17: {region: 0x106, script: 0x20, flags: 0x0}, - 18: {region: 0x165, script: 0x5a, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x5a, flags: 0x0}, - 22: {region: 0x161, script: 0x5a, flags: 0x0}, - 23: {region: 0x165, script: 0x5a, flags: 0x0}, - 24: {region: 0x165, script: 0x5a, flags: 0x0}, - 25: {region: 0x165, script: 0x5a, flags: 0x0}, - 26: {region: 0x165, script: 0x5a, flags: 0x0}, - 27: {region: 0x165, script: 0x5a, flags: 0x0}, - 28: {region: 0x52, script: 0x5a, flags: 0x0}, - 29: {region: 0x165, script: 0x5a, flags: 0x0}, - 30: {region: 0x165, script: 0x5a, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x5a, flags: 0x0}, - 33: {region: 0x80, script: 0x5a, flags: 0x0}, - 34: {region: 0x9b, script: 0xf8, flags: 0x0}, - 35: {region: 0x165, script: 0x5a, flags: 0x0}, - 36: {region: 0x165, script: 0x5a, flags: 0x0}, - 37: {region: 0x14d, script: 0x5a, flags: 0x0}, - 38: {region: 0x106, script: 0x20, flags: 0x0}, - 39: {region: 0x6f, script: 0x2c, flags: 0x0}, - 40: {region: 0x165, script: 0x5a, flags: 0x0}, - 41: {region: 0x165, script: 0x5a, flags: 0x0}, - 42: {region: 0xd6, script: 0x5a, flags: 0x0}, - 43: {region: 0x165, script: 0x5a, flags: 0x0}, - 45: {region: 0x165, script: 0x5a, flags: 0x0}, - 46: {region: 0x165, script: 0x5a, flags: 0x0}, - 47: {region: 0x165, script: 0x5a, flags: 0x0}, - 48: {region: 0x165, script: 0x5a, flags: 0x0}, - 49: {region: 0x165, script: 0x5a, flags: 0x0}, - 50: {region: 0x165, script: 0x5a, flags: 0x0}, - 51: {region: 0x95, script: 0x5a, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x5a, flags: 0x0}, - 55: {region: 0x165, script: 0x5a, flags: 0x0}, - 56: {region: 0x165, script: 0x5a, flags: 0x0}, - 57: {region: 0x165, script: 0x5a, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 0: {region: 0x136, script: 0x5b, flags: 0x0}, + 1: {region: 0x70, script: 0x5b, flags: 0x0}, + 2: {region: 0x166, script: 0x5b, flags: 0x0}, + 3: {region: 0x166, script: 0x5b, flags: 0x0}, + 4: {region: 0x166, script: 0x5b, flags: 0x0}, + 5: {region: 0x7e, script: 0x20, flags: 0x0}, + 6: {region: 0x166, script: 0x5b, flags: 0x0}, + 7: {region: 0x166, script: 0x20, flags: 0x0}, + 8: {region: 0x81, script: 0x5b, flags: 0x0}, + 9: {region: 0x166, script: 0x5b, flags: 0x0}, + 10: {region: 0x166, script: 0x5b, flags: 0x0}, + 11: {region: 0x166, script: 0x5b, flags: 0x0}, + 12: {region: 0x96, script: 0x5b, flags: 0x0}, + 13: {region: 0x132, script: 0x5b, flags: 0x0}, + 14: {region: 0x81, script: 0x5b, flags: 0x0}, + 15: {region: 0x166, script: 0x5b, flags: 0x0}, + 16: {region: 0x166, script: 0x5b, flags: 0x0}, + 17: {region: 0x107, script: 0x20, flags: 0x0}, + 18: {region: 0x166, script: 0x5b, flags: 0x0}, + 19: {region: 0x9d, script: 0x9, flags: 0x0}, + 20: {region: 0x129, script: 0x5, flags: 0x0}, + 21: {region: 0x166, script: 0x5b, flags: 0x0}, + 22: {region: 0x162, script: 0x5b, flags: 0x0}, + 23: {region: 0x166, script: 0x5b, flags: 0x0}, + 24: {region: 0x166, script: 0x5b, flags: 0x0}, + 25: {region: 0x166, script: 0x5b, flags: 0x0}, + 26: {region: 0x166, script: 0x5b, flags: 0x0}, + 27: {region: 0x166, script: 0x5b, flags: 0x0}, + 28: {region: 0x52, script: 0x5b, flags: 0x0}, + 29: {region: 0x166, script: 0x5b, flags: 0x0}, + 30: {region: 0x166, script: 0x5b, flags: 0x0}, + 31: {region: 0x9a, script: 0x4, flags: 0x0}, + 32: {region: 0x166, script: 0x5b, flags: 0x0}, + 33: {region: 0x81, script: 0x5b, flags: 0x0}, + 34: {region: 0x9c, script: 0xfb, flags: 0x0}, + 35: {region: 0x166, script: 0x5b, flags: 0x0}, + 36: {region: 0x166, script: 0x5b, flags: 0x0}, + 37: {region: 0x14e, script: 0x5b, flags: 0x0}, + 38: {region: 0x107, script: 0x20, flags: 0x0}, + 39: {region: 0x70, script: 0x2c, flags: 0x0}, + 40: {region: 0x166, script: 0x5b, flags: 0x0}, + 41: {region: 0x166, script: 0x5b, flags: 0x0}, + 42: {region: 0xd7, script: 0x5b, flags: 0x0}, + 43: {region: 0x166, script: 0x5b, flags: 0x0}, + 45: {region: 0x166, script: 0x5b, flags: 0x0}, + 46: {region: 0x166, script: 0x5b, flags: 0x0}, + 47: {region: 0x166, script: 0x5b, flags: 0x0}, + 48: {region: 0x166, script: 0x5b, flags: 0x0}, + 49: {region: 0x166, script: 0x5b, flags: 0x0}, + 50: {region: 0x166, script: 0x5b, flags: 0x0}, + 51: {region: 0x96, script: 0x5b, flags: 0x0}, + 52: {region: 0x166, script: 0x5, flags: 0x0}, + 53: {region: 0x123, script: 0x5, flags: 0x0}, + 54: {region: 0x166, script: 0x5b, flags: 0x0}, + 55: {region: 0x166, script: 0x5b, flags: 0x0}, + 56: {region: 0x166, script: 0x5b, flags: 0x0}, + 57: {region: 0x166, script: 0x5b, flags: 0x0}, + 58: {region: 0x6c, script: 0x5, flags: 0x0}, 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x5a, flags: 0x0}, - 61: {region: 0x51, script: 0x5a, flags: 0x0}, - 62: {region: 0x3f, script: 0x5a, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x5a, flags: 0x0}, - 69: {region: 0x135, script: 0xce, flags: 0x0}, - 70: {region: 0x165, script: 0x5a, flags: 0x0}, - 71: {region: 0x165, script: 0x5a, flags: 0x0}, - 72: {region: 0x6e, script: 0x5a, flags: 0x0}, - 73: {region: 0x165, script: 0x5a, flags: 0x0}, - 74: {region: 0x165, script: 0x5a, flags: 0x0}, - 75: {region: 0x49, script: 0x5a, flags: 0x0}, - 76: {region: 0x165, script: 0x5a, flags: 0x0}, - 77: {region: 0x106, script: 0x20, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x5a, flags: 0x0}, - 80: {region: 0x165, script: 0x5a, flags: 0x0}, - 81: {region: 0x165, script: 0x5a, flags: 0x0}, - 82: {region: 0x99, script: 0x22, flags: 0x0}, - 83: {region: 0x165, script: 0x5a, flags: 0x0}, - 84: {region: 0x165, script: 0x5a, flags: 0x0}, - 85: {region: 0x165, script: 0x5a, flags: 0x0}, - 86: {region: 0x3f, script: 0x5a, flags: 0x0}, - 87: {region: 0x165, script: 0x5a, flags: 0x0}, + 60: {region: 0x166, script: 0x5b, flags: 0x0}, + 61: {region: 0x51, script: 0x5b, flags: 0x0}, + 62: {region: 0x3f, script: 0x5b, flags: 0x0}, + 63: {region: 0x68, script: 0x5, flags: 0x0}, + 65: {region: 0xbb, script: 0x5, flags: 0x0}, + 66: {region: 0x6c, script: 0x5, flags: 0x0}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0x130, script: 0x5b, flags: 0x0}, + 69: {region: 0x136, script: 0xd0, flags: 0x0}, + 70: {region: 0x166, script: 0x5b, flags: 0x0}, + 71: {region: 0x166, script: 0x5b, flags: 0x0}, + 72: {region: 0x6f, script: 0x5b, flags: 0x0}, + 73: {region: 0x166, script: 0x5b, flags: 0x0}, + 74: {region: 0x166, script: 0x5b, flags: 0x0}, + 75: {region: 0x49, script: 0x5b, flags: 0x0}, + 76: {region: 0x166, script: 0x5b, flags: 0x0}, + 77: {region: 0x107, script: 0x20, flags: 0x0}, + 78: {region: 0x166, script: 0x5, flags: 0x0}, + 79: {region: 0x166, script: 0x5b, flags: 0x0}, + 80: {region: 0x166, script: 0x5b, flags: 0x0}, + 81: {region: 0x166, script: 0x5b, flags: 0x0}, + 82: {region: 0x9a, script: 0x22, flags: 0x0}, + 83: {region: 0x166, script: 0x5b, flags: 0x0}, + 84: {region: 0x166, script: 0x5b, flags: 0x0}, + 85: {region: 0x166, script: 0x5b, flags: 0x0}, + 86: {region: 0x3f, script: 0x5b, flags: 0x0}, + 87: {region: 0x166, script: 0x5b, flags: 0x0}, 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x20, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x5a, flags: 0x0}, - 92: {region: 0xdb, script: 0x22, flags: 0x0}, - 93: {region: 0x2e, script: 0x5a, flags: 0x0}, - 94: {region: 0x52, script: 0x5a, flags: 0x0}, - 95: {region: 0x165, script: 0x5a, flags: 0x0}, + 89: {region: 0x107, script: 0x20, flags: 0x0}, + 90: {region: 0xe9, script: 0x5, flags: 0x0}, + 91: {region: 0x96, script: 0x5b, flags: 0x0}, + 92: {region: 0xdc, script: 0x22, flags: 0x0}, + 93: {region: 0x2e, script: 0x5b, flags: 0x0}, + 94: {region: 0x52, script: 0x5b, flags: 0x0}, + 95: {region: 0x166, script: 0x5b, flags: 0x0}, 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x5a, flags: 0x0}, - 98: {region: 0x165, script: 0x5a, flags: 0x0}, - 99: {region: 0x95, script: 0x5a, flags: 0x0}, - 100: {region: 0x165, script: 0x5a, flags: 0x0}, - 101: {region: 0x52, script: 0x5a, flags: 0x0}, - 102: {region: 0x165, script: 0x5a, flags: 0x0}, - 103: {region: 0x165, script: 0x5a, flags: 0x0}, - 104: {region: 0x165, script: 0x5a, flags: 0x0}, - 105: {region: 0x165, script: 0x5a, flags: 0x0}, - 106: {region: 0x4f, script: 0x5a, flags: 0x0}, - 107: {region: 0x165, script: 0x5a, flags: 0x0}, - 108: {region: 0x165, script: 0x5a, flags: 0x0}, - 109: {region: 0x165, script: 0x5a, flags: 0x0}, - 110: {region: 0x165, script: 0x2c, flags: 0x0}, - 111: {region: 0x165, script: 0x5a, flags: 0x0}, - 112: {region: 0x165, script: 0x5a, flags: 0x0}, + 97: {region: 0x166, script: 0x5b, flags: 0x0}, + 98: {region: 0x166, script: 0x5b, flags: 0x0}, + 99: {region: 0x96, script: 0x5b, flags: 0x0}, + 100: {region: 0x166, script: 0x5b, flags: 0x0}, + 101: {region: 0x52, script: 0x5b, flags: 0x0}, + 102: {region: 0x166, script: 0x5b, flags: 0x0}, + 103: {region: 0x166, script: 0x5b, flags: 0x0}, + 104: {region: 0x166, script: 0x5b, flags: 0x0}, + 105: {region: 0x166, script: 0x5b, flags: 0x0}, + 106: {region: 0x4f, script: 0x5b, flags: 0x0}, + 107: {region: 0x166, script: 0x5b, flags: 0x0}, + 108: {region: 0x166, script: 0x5b, flags: 0x0}, + 109: {region: 0x166, script: 0x5b, flags: 0x0}, + 110: {region: 0x166, script: 0x2c, flags: 0x0}, + 111: {region: 0x166, script: 0x5b, flags: 0x0}, + 112: {region: 0x166, script: 0x5b, flags: 0x0}, 113: {region: 0x47, script: 0x20, flags: 0x0}, - 114: {region: 0x165, script: 0x5a, flags: 0x0}, - 115: {region: 0x165, script: 0x5a, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x5a, flags: 0x0}, - 118: {region: 0x165, script: 0x5a, flags: 0x0}, - 119: {region: 0x95, script: 0x5a, flags: 0x0}, - 120: {region: 0x165, script: 0x5a, flags: 0x0}, - 121: {region: 0x12f, script: 0x5a, flags: 0x0}, - 122: {region: 0x52, script: 0x5a, flags: 0x0}, - 123: {region: 0x99, script: 0xe3, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x22, flags: 0x0}, + 114: {region: 0x166, script: 0x5b, flags: 0x0}, + 115: {region: 0x166, script: 0x5b, flags: 0x0}, + 116: {region: 0x10c, script: 0x5, flags: 0x0}, + 117: {region: 0x163, script: 0x5b, flags: 0x0}, + 118: {region: 0x166, script: 0x5b, flags: 0x0}, + 119: {region: 0x96, script: 0x5b, flags: 0x0}, + 120: {region: 0x166, script: 0x5b, flags: 0x0}, + 121: {region: 0x130, script: 0x5b, flags: 0x0}, + 122: {region: 0x52, script: 0x5b, flags: 0x0}, + 123: {region: 0x9a, script: 0xe6, flags: 0x0}, + 124: {region: 0xe9, script: 0x5, flags: 0x0}, + 125: {region: 0x9a, script: 0x22, flags: 0x0}, 126: {region: 0x38, script: 0x20, flags: 0x0}, - 127: {region: 0x99, script: 0x22, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x34, flags: 0x0}, - 131: {region: 0x99, script: 0x22, flags: 0x0}, - 132: {region: 0x165, script: 0x5a, flags: 0x0}, - 133: {region: 0x99, script: 0x22, flags: 0x0}, - 134: {region: 0xe7, script: 0x5a, flags: 0x0}, - 135: {region: 0x165, script: 0x5a, flags: 0x0}, - 136: {region: 0x99, script: 0x22, flags: 0x0}, - 137: {region: 0x165, script: 0x5a, flags: 0x0}, - 138: {region: 0x13f, script: 0x5a, flags: 0x0}, - 139: {region: 0x165, script: 0x5a, flags: 0x0}, - 140: {region: 0x165, script: 0x5a, flags: 0x0}, - 141: {region: 0xe7, script: 0x5a, flags: 0x0}, - 142: {region: 0x165, script: 0x5a, flags: 0x0}, - 143: {region: 0xd6, script: 0x5a, flags: 0x0}, - 144: {region: 0x165, script: 0x5a, flags: 0x0}, - 145: {region: 0x165, script: 0x5a, flags: 0x0}, - 146: {region: 0x165, script: 0x5a, flags: 0x0}, - 147: {region: 0x165, script: 0x2c, flags: 0x0}, - 148: {region: 0x99, script: 0x22, flags: 0x0}, - 149: {region: 0x95, script: 0x5a, flags: 0x0}, - 150: {region: 0x165, script: 0x5a, flags: 0x0}, - 151: {region: 0x165, script: 0x5a, flags: 0x0}, - 152: {region: 0x114, script: 0x5a, flags: 0x0}, - 153: {region: 0x165, script: 0x5a, flags: 0x0}, - 154: {region: 0x165, script: 0x5a, flags: 0x0}, - 155: {region: 0x52, script: 0x5a, flags: 0x0}, - 156: {region: 0x165, script: 0x5a, flags: 0x0}, - 157: {region: 0xe7, script: 0x5a, flags: 0x0}, - 158: {region: 0x165, script: 0x5a, flags: 0x0}, - 159: {region: 0x13e, script: 0xe5, flags: 0x0}, - 160: {region: 0xc3, script: 0x5a, flags: 0x0}, - 161: {region: 0x165, script: 0x5a, flags: 0x0}, - 162: {region: 0x165, script: 0x5a, flags: 0x0}, - 163: {region: 0xc3, script: 0x5a, flags: 0x0}, - 164: {region: 0x165, script: 0x5a, flags: 0x0}, + 127: {region: 0x9a, script: 0x22, flags: 0x0}, + 128: {region: 0xe9, script: 0x5, flags: 0x0}, + 129: {region: 0x12c, script: 0x34, flags: 0x0}, + 131: {region: 0x9a, script: 0x22, flags: 0x0}, + 132: {region: 0x166, script: 0x5b, flags: 0x0}, + 133: {region: 0x9a, script: 0x22, flags: 0x0}, + 134: {region: 0xe8, script: 0x5b, flags: 0x0}, + 135: {region: 0x166, script: 0x5b, flags: 0x0}, + 136: {region: 0x9a, script: 0x22, flags: 0x0}, + 137: {region: 0x166, script: 0x5b, flags: 0x0}, + 138: {region: 0x140, script: 0x5b, flags: 0x0}, + 139: {region: 0x166, script: 0x5b, flags: 0x0}, + 140: {region: 0x166, script: 0x5b, flags: 0x0}, + 141: {region: 0xe8, script: 0x5b, flags: 0x0}, + 142: {region: 0x166, script: 0x5b, flags: 0x0}, + 143: {region: 0xd7, script: 0x5b, flags: 0x0}, + 144: {region: 0x166, script: 0x5b, flags: 0x0}, + 145: {region: 0x166, script: 0x5b, flags: 0x0}, + 146: {region: 0x166, script: 0x5b, flags: 0x0}, + 147: {region: 0x166, script: 0x2c, flags: 0x0}, + 148: {region: 0x9a, script: 0x22, flags: 0x0}, + 149: {region: 0x96, script: 0x5b, flags: 0x0}, + 150: {region: 0x166, script: 0x5b, flags: 0x0}, + 151: {region: 0x166, script: 0x5b, flags: 0x0}, + 152: {region: 0x115, script: 0x5b, flags: 0x0}, + 153: {region: 0x166, script: 0x5b, flags: 0x0}, + 154: {region: 0x166, script: 0x5b, flags: 0x0}, + 155: {region: 0x52, script: 0x5b, flags: 0x0}, + 156: {region: 0x166, script: 0x5b, flags: 0x0}, + 157: {region: 0xe8, script: 0x5b, flags: 0x0}, + 158: {region: 0x166, script: 0x5b, flags: 0x0}, + 159: {region: 0x13f, script: 0xe8, flags: 0x0}, + 160: {region: 0xc4, script: 0x5b, flags: 0x0}, + 161: {region: 0x166, script: 0x5b, flags: 0x0}, + 162: {region: 0x166, script: 0x5b, flags: 0x0}, + 163: {region: 0xc4, script: 0x5b, flags: 0x0}, + 164: {region: 0x166, script: 0x5b, flags: 0x0}, 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x5a, flags: 0x0}, - 167: {region: 0x165, script: 0x5a, flags: 0x0}, - 168: {region: 0x165, script: 0x5a, flags: 0x0}, - 169: {region: 0x53, script: 0xec, flags: 0x0}, - 170: {region: 0x165, script: 0x5a, flags: 0x0}, - 171: {region: 0x165, script: 0x5a, flags: 0x0}, - 172: {region: 0x165, script: 0x5a, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x5a, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x5a, flags: 0x0}, - 177: {region: 0x4f, script: 0x5a, flags: 0x0}, - 178: {region: 0x78, script: 0x5a, flags: 0x0}, - 179: {region: 0x99, script: 0x22, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x22, flags: 0x0}, - 182: {region: 0x165, script: 0x5a, flags: 0x0}, - 183: {region: 0x33, script: 0x5a, flags: 0x0}, - 184: {region: 0x165, script: 0x5a, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x5a, flags: 0x0}, - 187: {region: 0x165, script: 0x2c, flags: 0x0}, - 188: {region: 0xe7, script: 0x5a, flags: 0x0}, - 189: {region: 0x165, script: 0x5a, flags: 0x0}, - 190: {region: 0xe8, script: 0x22, flags: 0x0}, - 191: {region: 0x106, script: 0x20, flags: 0x0}, - 192: {region: 0x15f, script: 0x5a, flags: 0x0}, - 193: {region: 0x165, script: 0x5a, flags: 0x0}, - 194: {region: 0x95, script: 0x5a, flags: 0x0}, - 195: {region: 0x165, script: 0x5a, flags: 0x0}, - 196: {region: 0x52, script: 0x5a, flags: 0x0}, - 197: {region: 0x165, script: 0x5a, flags: 0x0}, - 198: {region: 0x165, script: 0x5a, flags: 0x0}, - 199: {region: 0x165, script: 0x5a, flags: 0x0}, - 200: {region: 0x86, script: 0x5a, flags: 0x0}, - 201: {region: 0x165, script: 0x5a, flags: 0x0}, - 202: {region: 0x165, script: 0x5a, flags: 0x0}, - 203: {region: 0x165, script: 0x5a, flags: 0x0}, - 204: {region: 0x165, script: 0x5a, flags: 0x0}, - 205: {region: 0x6d, script: 0x2c, flags: 0x0}, - 206: {region: 0x165, script: 0x5a, flags: 0x0}, - 207: {region: 0x165, script: 0x5a, flags: 0x0}, - 208: {region: 0x52, script: 0x5a, flags: 0x0}, - 209: {region: 0x165, script: 0x5a, flags: 0x0}, - 210: {region: 0x165, script: 0x5a, flags: 0x0}, - 211: {region: 0xc3, script: 0x5a, flags: 0x0}, - 212: {region: 0x165, script: 0x5a, flags: 0x0}, - 213: {region: 0x165, script: 0x5a, flags: 0x0}, - 214: {region: 0x165, script: 0x5a, flags: 0x0}, - 215: {region: 0x6e, script: 0x5a, flags: 0x0}, - 216: {region: 0x165, script: 0x5a, flags: 0x0}, - 217: {region: 0x165, script: 0x5a, flags: 0x0}, - 218: {region: 0xd6, script: 0x5a, flags: 0x0}, + 166: {region: 0x166, script: 0x5b, flags: 0x0}, + 167: {region: 0x166, script: 0x5b, flags: 0x0}, + 168: {region: 0x166, script: 0x5b, flags: 0x0}, + 169: {region: 0x53, script: 0xef, flags: 0x0}, + 170: {region: 0x166, script: 0x5b, flags: 0x0}, + 171: {region: 0x166, script: 0x5b, flags: 0x0}, + 172: {region: 0x166, script: 0x5b, flags: 0x0}, + 173: {region: 0x9a, script: 0xe, flags: 0x0}, + 174: {region: 0x166, script: 0x5b, flags: 0x0}, + 175: {region: 0x9d, script: 0x5, flags: 0x0}, + 176: {region: 0x166, script: 0x5b, flags: 0x0}, + 177: {region: 0x4f, script: 0x5b, flags: 0x0}, + 178: {region: 0x79, script: 0x5b, flags: 0x0}, + 179: {region: 0x9a, script: 0x22, flags: 0x0}, + 180: {region: 0xe9, script: 0x5, flags: 0x0}, + 181: {region: 0x9a, script: 0x22, flags: 0x0}, + 182: {region: 0x166, script: 0x5b, flags: 0x0}, + 183: {region: 0x33, script: 0x5b, flags: 0x0}, + 184: {region: 0x166, script: 0x5b, flags: 0x0}, + 185: {region: 0xb5, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x5b, flags: 0x0}, + 187: {region: 0x166, script: 0x2c, flags: 0x0}, + 188: {region: 0xe8, script: 0x5b, flags: 0x0}, + 189: {region: 0x166, script: 0x5b, flags: 0x0}, + 190: {region: 0xe9, script: 0x22, flags: 0x0}, + 191: {region: 0x107, script: 0x20, flags: 0x0}, + 192: {region: 0x160, script: 0x5b, flags: 0x0}, + 193: {region: 0x166, script: 0x5b, flags: 0x0}, + 194: {region: 0x96, script: 0x5b, flags: 0x0}, + 195: {region: 0x166, script: 0x5b, flags: 0x0}, + 196: {region: 0x52, script: 0x5b, flags: 0x0}, + 197: {region: 0x166, script: 0x5b, flags: 0x0}, + 198: {region: 0x166, script: 0x5b, flags: 0x0}, + 199: {region: 0x166, script: 0x5b, flags: 0x0}, + 200: {region: 0x87, script: 0x5b, flags: 0x0}, + 201: {region: 0x166, script: 0x5b, flags: 0x0}, + 202: {region: 0x166, script: 0x5b, flags: 0x0}, + 203: {region: 0x166, script: 0x5b, flags: 0x0}, + 204: {region: 0x166, script: 0x5b, flags: 0x0}, + 205: {region: 0x6e, script: 0x2c, flags: 0x0}, + 206: {region: 0x166, script: 0x5b, flags: 0x0}, + 207: {region: 0x166, script: 0x5b, flags: 0x0}, + 208: {region: 0x52, script: 0x5b, flags: 0x0}, + 209: {region: 0x166, script: 0x5b, flags: 0x0}, + 210: {region: 0x166, script: 0x5b, flags: 0x0}, + 211: {region: 0xc4, script: 0x5b, flags: 0x0}, + 212: {region: 0x166, script: 0x5b, flags: 0x0}, + 213: {region: 0x166, script: 0x5b, flags: 0x0}, + 214: {region: 0x166, script: 0x5b, flags: 0x0}, + 215: {region: 0x6f, script: 0x5b, flags: 0x0}, + 216: {region: 0x166, script: 0x5b, flags: 0x0}, + 217: {region: 0x166, script: 0x5b, flags: 0x0}, + 218: {region: 0xd7, script: 0x5b, flags: 0x0}, 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x20, flags: 0x0}, - 221: {region: 0xe7, script: 0x5a, flags: 0x0}, - 222: {region: 0x165, script: 0x5a, flags: 0x0}, - 223: {region: 0x131, script: 0x5a, flags: 0x0}, - 224: {region: 0x8a, script: 0x5a, flags: 0x0}, - 225: {region: 0x75, script: 0x5a, flags: 0x0}, - 226: {region: 0x106, script: 0x20, flags: 0x0}, - 227: {region: 0x135, script: 0x5a, flags: 0x0}, - 228: {region: 0x49, script: 0x5a, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x5a, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x5a, flags: 0x0}, - 235: {region: 0x165, script: 0x5a, flags: 0x0}, - 236: {region: 0x165, script: 0x5a, flags: 0x0}, - 237: {region: 0x165, script: 0x5a, flags: 0x0}, - 238: {region: 0x165, script: 0x5a, flags: 0x0}, - 239: {region: 0xc5, script: 0xd8, flags: 0x0}, - 240: {region: 0x78, script: 0x5a, flags: 0x0}, - 241: {region: 0x6b, script: 0x1d, flags: 0x0}, - 242: {region: 0xe7, script: 0x5a, flags: 0x0}, + 220: {region: 0x107, script: 0x20, flags: 0x0}, + 221: {region: 0xe8, script: 0x5b, flags: 0x0}, + 222: {region: 0x166, script: 0x5b, flags: 0x0}, + 223: {region: 0x132, script: 0x5b, flags: 0x0}, + 224: {region: 0x8b, script: 0x5b, flags: 0x0}, + 225: {region: 0x76, script: 0x5b, flags: 0x0}, + 226: {region: 0x107, script: 0x20, flags: 0x0}, + 227: {region: 0x136, script: 0x5b, flags: 0x0}, + 228: {region: 0x49, script: 0x5b, flags: 0x0}, + 229: {region: 0x136, script: 0x1a, flags: 0x0}, + 230: {region: 0xa7, script: 0x5, flags: 0x0}, + 231: {region: 0x13f, script: 0x19, flags: 0x0}, + 232: {region: 0x166, script: 0x5b, flags: 0x0}, + 233: {region: 0x9c, script: 0x5, flags: 0x0}, + 234: {region: 0x166, script: 0x5b, flags: 0x0}, + 235: {region: 0x166, script: 0x5b, flags: 0x0}, + 236: {region: 0x166, script: 0x5b, flags: 0x0}, + 237: {region: 0x166, script: 0x5b, flags: 0x0}, + 238: {region: 0x166, script: 0x5b, flags: 0x0}, + 239: {region: 0xc6, script: 0xda, flags: 0x0}, + 240: {region: 0x79, script: 0x5b, flags: 0x0}, + 241: {region: 0x6c, script: 0x1d, flags: 0x0}, + 242: {region: 0xe8, script: 0x5b, flags: 0x0}, 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x20, flags: 0x0}, + 244: {region: 0x131, script: 0x20, flags: 0x0}, 245: {region: 0x49, script: 0x17, flags: 0x0}, 246: {region: 0x49, script: 0x17, flags: 0x0}, 247: {region: 0x49, script: 0x17, flags: 0x0}, 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x5a, flags: 0x0}, - 250: {region: 0x5e, script: 0x5a, flags: 0x0}, - 251: {region: 0xe9, script: 0x5a, flags: 0x0}, + 249: {region: 0x10b, script: 0x5b, flags: 0x0}, + 250: {region: 0x5f, script: 0x5b, flags: 0x0}, + 251: {region: 0xea, script: 0x5b, flags: 0x0}, 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x86, flags: 0x0}, + 253: {region: 0xc5, script: 0x88, flags: 0x0}, 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x20, flags: 0x0}, - 256: {region: 0x7b, script: 0x5a, flags: 0x0}, - 257: {region: 0x63, script: 0x5a, flags: 0x0}, - 258: {region: 0x165, script: 0x5a, flags: 0x0}, - 259: {region: 0x165, script: 0x5a, flags: 0x0}, - 260: {region: 0x165, script: 0x5a, flags: 0x0}, - 261: {region: 0x165, script: 0x5a, flags: 0x0}, - 262: {region: 0x135, script: 0x5a, flags: 0x0}, - 263: {region: 0x106, script: 0x20, flags: 0x0}, - 264: {region: 0xa4, script: 0x5a, flags: 0x0}, - 265: {region: 0x165, script: 0x5a, flags: 0x0}, - 266: {region: 0x165, script: 0x5a, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x5a, flags: 0x0}, - 269: {region: 0x60, script: 0x5a, flags: 0x0}, - 270: {region: 0x165, script: 0x5a, flags: 0x0}, - 271: {region: 0x49, script: 0x5a, flags: 0x0}, - 272: {region: 0x165, script: 0x5a, flags: 0x0}, - 273: {region: 0x165, script: 0x5a, flags: 0x0}, - 274: {region: 0x165, script: 0x5a, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x5a, flags: 0x0}, - 277: {region: 0x165, script: 0x5a, flags: 0x0}, - 278: {region: 0x165, script: 0x5a, flags: 0x0}, - 279: {region: 0xd4, script: 0x5a, flags: 0x0}, - 280: {region: 0x4f, script: 0x5a, flags: 0x0}, - 281: {region: 0x165, script: 0x5a, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x5a, flags: 0x0}, - 284: {region: 0x165, script: 0x5a, flags: 0x0}, - 285: {region: 0x165, script: 0x5a, flags: 0x0}, - 286: {region: 0x165, script: 0x2c, flags: 0x0}, - 287: {region: 0x60, script: 0x5a, flags: 0x0}, - 288: {region: 0xc3, script: 0x5a, flags: 0x0}, - 289: {region: 0xd0, script: 0x5a, flags: 0x0}, - 290: {region: 0x165, script: 0x5a, flags: 0x0}, - 291: {region: 0xdb, script: 0x22, flags: 0x0}, - 292: {region: 0x52, script: 0x5a, flags: 0x0}, - 293: {region: 0x165, script: 0x5a, flags: 0x0}, - 294: {region: 0x165, script: 0x5a, flags: 0x0}, - 295: {region: 0x165, script: 0x5a, flags: 0x0}, - 296: {region: 0xcd, script: 0xea, flags: 0x0}, - 297: {region: 0x165, script: 0x5a, flags: 0x0}, - 298: {region: 0x165, script: 0x5a, flags: 0x0}, - 299: {region: 0x114, script: 0x5a, flags: 0x0}, - 300: {region: 0x37, script: 0x5a, flags: 0x0}, - 301: {region: 0x43, script: 0xec, flags: 0x0}, - 302: {region: 0x165, script: 0x5a, flags: 0x0}, - 303: {region: 0xa4, script: 0x5a, flags: 0x0}, - 304: {region: 0x80, script: 0x5a, flags: 0x0}, - 305: {region: 0xd6, script: 0x5a, flags: 0x0}, - 306: {region: 0x9e, script: 0x5a, flags: 0x0}, - 307: {region: 0x6b, script: 0x29, flags: 0x0}, - 308: {region: 0x165, script: 0x5a, flags: 0x0}, - 309: {region: 0xc4, script: 0x4b, flags: 0x0}, - 310: {region: 0x87, script: 0x34, flags: 0x0}, - 311: {region: 0x165, script: 0x5a, flags: 0x0}, - 312: {region: 0x165, script: 0x5a, flags: 0x0}, + 255: {region: 0x107, script: 0x20, flags: 0x0}, + 256: {region: 0x7c, script: 0x5b, flags: 0x0}, + 257: {region: 0x64, script: 0x5b, flags: 0x0}, + 258: {region: 0x166, script: 0x5b, flags: 0x0}, + 259: {region: 0x166, script: 0x5b, flags: 0x0}, + 260: {region: 0x166, script: 0x5b, flags: 0x0}, + 261: {region: 0x166, script: 0x5b, flags: 0x0}, + 262: {region: 0x136, script: 0x5b, flags: 0x0}, + 263: {region: 0x107, script: 0x20, flags: 0x0}, + 264: {region: 0xa5, script: 0x5b, flags: 0x0}, + 265: {region: 0x166, script: 0x5b, flags: 0x0}, + 266: {region: 0x166, script: 0x5b, flags: 0x0}, + 267: {region: 0x9a, script: 0x5, flags: 0x0}, + 268: {region: 0x166, script: 0x5b, flags: 0x0}, + 269: {region: 0x61, script: 0x5b, flags: 0x0}, + 270: {region: 0x166, script: 0x5b, flags: 0x0}, + 271: {region: 0x49, script: 0x5b, flags: 0x0}, + 272: {region: 0x166, script: 0x5b, flags: 0x0}, + 273: {region: 0x166, script: 0x5b, flags: 0x0}, + 274: {region: 0x166, script: 0x5b, flags: 0x0}, + 275: {region: 0x166, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x5b, flags: 0x0}, + 277: {region: 0x166, script: 0x5b, flags: 0x0}, + 278: {region: 0x166, script: 0x5b, flags: 0x0}, + 279: {region: 0xd5, script: 0x5b, flags: 0x0}, + 280: {region: 0x4f, script: 0x5b, flags: 0x0}, + 281: {region: 0x166, script: 0x5b, flags: 0x0}, + 282: {region: 0x9a, script: 0x5, flags: 0x0}, + 283: {region: 0x166, script: 0x5b, flags: 0x0}, + 284: {region: 0x166, script: 0x5b, flags: 0x0}, + 285: {region: 0x166, script: 0x5b, flags: 0x0}, + 286: {region: 0x166, script: 0x2c, flags: 0x0}, + 287: {region: 0x61, script: 0x5b, flags: 0x0}, + 288: {region: 0xc4, script: 0x5b, flags: 0x0}, + 289: {region: 0xd1, script: 0x5b, flags: 0x0}, + 290: {region: 0x166, script: 0x5b, flags: 0x0}, + 291: {region: 0xdc, script: 0x22, flags: 0x0}, + 292: {region: 0x52, script: 0x5b, flags: 0x0}, + 293: {region: 0x166, script: 0x5b, flags: 0x0}, + 294: {region: 0x166, script: 0x5b, flags: 0x0}, + 295: {region: 0x166, script: 0x5b, flags: 0x0}, + 296: {region: 0xce, script: 0xed, flags: 0x0}, + 297: {region: 0x166, script: 0x5b, flags: 0x0}, + 298: {region: 0x166, script: 0x5b, flags: 0x0}, + 299: {region: 0x115, script: 0x5b, flags: 0x0}, + 300: {region: 0x37, script: 0x5b, flags: 0x0}, + 301: {region: 0x43, script: 0xef, flags: 0x0}, + 302: {region: 0x166, script: 0x5b, flags: 0x0}, + 303: {region: 0xa5, script: 0x5b, flags: 0x0}, + 304: {region: 0x81, script: 0x5b, flags: 0x0}, + 305: {region: 0xd7, script: 0x5b, flags: 0x0}, + 306: {region: 0x9f, script: 0x5b, flags: 0x0}, + 307: {region: 0x6c, script: 0x29, flags: 0x0}, + 308: {region: 0x166, script: 0x5b, flags: 0x0}, + 309: {region: 0xc5, script: 0x4b, flags: 0x0}, + 310: {region: 0x88, script: 0x34, flags: 0x0}, + 311: {region: 0x166, script: 0x5b, flags: 0x0}, + 312: {region: 0x166, script: 0x5b, flags: 0x0}, 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x5a, flags: 0x0}, - 315: {region: 0x165, script: 0x5a, flags: 0x0}, - 316: {region: 0x1, script: 0x5a, flags: 0x0}, - 317: {region: 0x165, script: 0x5a, flags: 0x0}, - 318: {region: 0x6e, script: 0x5a, flags: 0x0}, - 319: {region: 0x135, script: 0x5a, flags: 0x0}, - 320: {region: 0x6a, script: 0x5a, flags: 0x0}, - 321: {region: 0x165, script: 0x5a, flags: 0x0}, - 322: {region: 0x9e, script: 0x46, flags: 0x0}, - 323: {region: 0x165, script: 0x5a, flags: 0x0}, - 324: {region: 0x165, script: 0x5a, flags: 0x0}, - 325: {region: 0x6e, script: 0x5a, flags: 0x0}, - 326: {region: 0x52, script: 0x5a, flags: 0x0}, - 327: {region: 0x6e, script: 0x5a, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x5a, flags: 0x0}, - 330: {region: 0x165, script: 0x5a, flags: 0x0}, - 331: {region: 0x165, script: 0x5a, flags: 0x0}, - 332: {region: 0x165, script: 0x5a, flags: 0x0}, - 333: {region: 0x86, script: 0x5a, flags: 0x0}, + 314: {region: 0x166, script: 0x5b, flags: 0x0}, + 315: {region: 0x166, script: 0x5b, flags: 0x0}, + 316: {region: 0x1, script: 0x5b, flags: 0x0}, + 317: {region: 0x166, script: 0x5b, flags: 0x0}, + 318: {region: 0x6f, script: 0x5b, flags: 0x0}, + 319: {region: 0x136, script: 0x5b, flags: 0x0}, + 320: {region: 0x6b, script: 0x5b, flags: 0x0}, + 321: {region: 0x166, script: 0x5b, flags: 0x0}, + 322: {region: 0x9f, script: 0x46, flags: 0x0}, + 323: {region: 0x166, script: 0x5b, flags: 0x0}, + 324: {region: 0x166, script: 0x5b, flags: 0x0}, + 325: {region: 0x6f, script: 0x5b, flags: 0x0}, + 326: {region: 0x52, script: 0x5b, flags: 0x0}, + 327: {region: 0x6f, script: 0x5b, flags: 0x0}, + 328: {region: 0x9d, script: 0x5, flags: 0x0}, + 329: {region: 0x166, script: 0x5b, flags: 0x0}, + 330: {region: 0x166, script: 0x5b, flags: 0x0}, + 331: {region: 0x166, script: 0x5b, flags: 0x0}, + 332: {region: 0x166, script: 0x5b, flags: 0x0}, + 333: {region: 0x87, script: 0x5b, flags: 0x0}, 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x5a, flags: 0x0}, - 336: {region: 0xc3, script: 0x5a, flags: 0x0}, - 337: {region: 0x72, script: 0x5a, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x5a, flags: 0x0}, - 340: {region: 0x10c, script: 0x5a, flags: 0x0}, - 341: {region: 0x73, script: 0x5a, flags: 0x0}, - 342: {region: 0x165, script: 0x5a, flags: 0x0}, - 343: {region: 0x165, script: 0x5a, flags: 0x0}, - 344: {region: 0x76, script: 0x5a, flags: 0x0}, - 345: {region: 0x165, script: 0x5a, flags: 0x0}, - 346: {region: 0x3b, script: 0x5a, flags: 0x0}, - 347: {region: 0x165, script: 0x5a, flags: 0x0}, - 348: {region: 0x165, script: 0x5a, flags: 0x0}, - 349: {region: 0x165, script: 0x5a, flags: 0x0}, - 350: {region: 0x78, script: 0x5a, flags: 0x0}, - 351: {region: 0x135, script: 0x5a, flags: 0x0}, - 352: {region: 0x78, script: 0x5a, flags: 0x0}, - 353: {region: 0x60, script: 0x5a, flags: 0x0}, - 354: {region: 0x60, script: 0x5a, flags: 0x0}, + 335: {region: 0x166, script: 0x5b, flags: 0x0}, + 336: {region: 0xc4, script: 0x5b, flags: 0x0}, + 337: {region: 0x73, script: 0x5b, flags: 0x0}, + 338: {region: 0x10c, script: 0x5, flags: 0x0}, + 339: {region: 0xe8, script: 0x5b, flags: 0x0}, + 340: {region: 0x10d, script: 0x5b, flags: 0x0}, + 341: {region: 0x74, script: 0x5b, flags: 0x0}, + 342: {region: 0x166, script: 0x5b, flags: 0x0}, + 343: {region: 0x166, script: 0x5b, flags: 0x0}, + 344: {region: 0x77, script: 0x5b, flags: 0x0}, + 345: {region: 0x166, script: 0x5b, flags: 0x0}, + 346: {region: 0x3b, script: 0x5b, flags: 0x0}, + 347: {region: 0x166, script: 0x5b, flags: 0x0}, + 348: {region: 0x166, script: 0x5b, flags: 0x0}, + 349: {region: 0x166, script: 0x5b, flags: 0x0}, + 350: {region: 0x79, script: 0x5b, flags: 0x0}, + 351: {region: 0x136, script: 0x5b, flags: 0x0}, + 352: {region: 0x79, script: 0x5b, flags: 0x0}, + 353: {region: 0x61, script: 0x5b, flags: 0x0}, + 354: {region: 0x61, script: 0x5b, flags: 0x0}, 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x5a, flags: 0x0}, - 357: {region: 0x165, script: 0x5a, flags: 0x0}, - 358: {region: 0x84, script: 0x5a, flags: 0x0}, - 359: {region: 0x165, script: 0x5a, flags: 0x0}, - 360: {region: 0xd4, script: 0x5a, flags: 0x0}, - 361: {region: 0x9e, script: 0x5a, flags: 0x0}, - 362: {region: 0xd6, script: 0x5a, flags: 0x0}, - 363: {region: 0x165, script: 0x5a, flags: 0x0}, - 364: {region: 0x10b, script: 0x5a, flags: 0x0}, - 365: {region: 0xd9, script: 0x5a, flags: 0x0}, - 366: {region: 0x96, script: 0x5a, flags: 0x0}, - 367: {region: 0x80, script: 0x5a, flags: 0x0}, - 368: {region: 0x165, script: 0x5a, flags: 0x0}, - 369: {region: 0xbc, script: 0x5a, flags: 0x0}, - 370: {region: 0x165, script: 0x5a, flags: 0x0}, - 371: {region: 0x165, script: 0x5a, flags: 0x0}, - 372: {region: 0x165, script: 0x5a, flags: 0x0}, + 356: {region: 0x141, script: 0x5b, flags: 0x0}, + 357: {region: 0x166, script: 0x5b, flags: 0x0}, + 358: {region: 0x85, script: 0x5b, flags: 0x0}, + 359: {region: 0x166, script: 0x5b, flags: 0x0}, + 360: {region: 0xd5, script: 0x5b, flags: 0x0}, + 361: {region: 0x9f, script: 0x5b, flags: 0x0}, + 362: {region: 0xd7, script: 0x5b, flags: 0x0}, + 363: {region: 0x166, script: 0x5b, flags: 0x0}, + 364: {region: 0x10c, script: 0x5b, flags: 0x0}, + 365: {region: 0xda, script: 0x5b, flags: 0x0}, + 366: {region: 0x97, script: 0x5b, flags: 0x0}, + 367: {region: 0x81, script: 0x5b, flags: 0x0}, + 368: {region: 0x166, script: 0x5b, flags: 0x0}, + 369: {region: 0xbd, script: 0x5b, flags: 0x0}, + 370: {region: 0x166, script: 0x5b, flags: 0x0}, + 371: {region: 0x166, script: 0x5b, flags: 0x0}, + 372: {region: 0x166, script: 0x5b, flags: 0x0}, 373: {region: 0x53, script: 0x3b, flags: 0x0}, - 374: {region: 0x165, script: 0x5a, flags: 0x0}, - 375: {region: 0x95, script: 0x5a, flags: 0x0}, - 376: {region: 0x165, script: 0x5a, flags: 0x0}, - 377: {region: 0x165, script: 0x5a, flags: 0x0}, - 378: {region: 0x99, script: 0x22, flags: 0x0}, - 379: {region: 0x165, script: 0x5a, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x5a, flags: 0x0}, - 382: {region: 0x7b, script: 0x5a, flags: 0x0}, - 383: {region: 0x165, script: 0x5a, flags: 0x0}, - 384: {region: 0x165, script: 0x5a, flags: 0x0}, - 385: {region: 0x165, script: 0x5a, flags: 0x0}, - 386: {region: 0x165, script: 0x5a, flags: 0x0}, - 387: {region: 0x165, script: 0x5a, flags: 0x0}, - 388: {region: 0x165, script: 0x5a, flags: 0x0}, - 389: {region: 0x6f, script: 0x2c, flags: 0x0}, - 390: {region: 0x165, script: 0x5a, flags: 0x0}, - 391: {region: 0xdb, script: 0x22, flags: 0x0}, - 392: {region: 0x165, script: 0x5a, flags: 0x0}, - 393: {region: 0xa7, script: 0x5a, flags: 0x0}, - 394: {region: 0x165, script: 0x5a, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x5a, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x5a, flags: 0x0}, - 399: {region: 0x165, script: 0x5a, flags: 0x0}, - 400: {region: 0x6e, script: 0x5a, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x5a, flags: 0x0}, - 403: {region: 0x165, script: 0x2c, flags: 0x0}, - 404: {region: 0xf1, script: 0x5a, flags: 0x0}, - 405: {region: 0x165, script: 0x5a, flags: 0x0}, - 406: {region: 0x165, script: 0x5a, flags: 0x0}, - 407: {region: 0x165, script: 0x5a, flags: 0x0}, - 408: {region: 0x165, script: 0x2c, flags: 0x0}, - 409: {region: 0x165, script: 0x5a, flags: 0x0}, - 410: {region: 0x99, script: 0x22, flags: 0x0}, - 411: {region: 0x99, script: 0xe6, flags: 0x0}, - 412: {region: 0x95, script: 0x5a, flags: 0x0}, - 413: {region: 0xd9, script: 0x5a, flags: 0x0}, - 414: {region: 0x130, script: 0x32, flags: 0x0}, - 415: {region: 0x165, script: 0x5a, flags: 0x0}, + 374: {region: 0x166, script: 0x5b, flags: 0x0}, + 375: {region: 0x96, script: 0x5b, flags: 0x0}, + 376: {region: 0x166, script: 0x5b, flags: 0x0}, + 377: {region: 0x166, script: 0x5b, flags: 0x0}, + 378: {region: 0x9a, script: 0x22, flags: 0x0}, + 379: {region: 0x166, script: 0x5b, flags: 0x0}, + 380: {region: 0x9d, script: 0x5, flags: 0x0}, + 381: {region: 0x7f, script: 0x5b, flags: 0x0}, + 382: {region: 0x7c, script: 0x5b, flags: 0x0}, + 383: {region: 0x166, script: 0x5b, flags: 0x0}, + 384: {region: 0x166, script: 0x5b, flags: 0x0}, + 385: {region: 0x166, script: 0x5b, flags: 0x0}, + 386: {region: 0x166, script: 0x5b, flags: 0x0}, + 387: {region: 0x166, script: 0x5b, flags: 0x0}, + 388: {region: 0x166, script: 0x5b, flags: 0x0}, + 389: {region: 0x70, script: 0x2c, flags: 0x0}, + 390: {region: 0x166, script: 0x5b, flags: 0x0}, + 391: {region: 0xdc, script: 0x22, flags: 0x0}, + 392: {region: 0x166, script: 0x5b, flags: 0x0}, + 393: {region: 0xa8, script: 0x5b, flags: 0x0}, + 394: {region: 0x166, script: 0x5b, flags: 0x0}, + 395: {region: 0xe9, script: 0x5, flags: 0x0}, + 396: {region: 0x166, script: 0x5b, flags: 0x0}, + 397: {region: 0xe9, script: 0x5, flags: 0x0}, + 398: {region: 0x166, script: 0x5b, flags: 0x0}, + 399: {region: 0x166, script: 0x5b, flags: 0x0}, + 400: {region: 0x6f, script: 0x5b, flags: 0x0}, + 401: {region: 0x9d, script: 0x5, flags: 0x0}, + 402: {region: 0x166, script: 0x5b, flags: 0x0}, + 403: {region: 0x166, script: 0x2c, flags: 0x0}, + 404: {region: 0xf2, script: 0x5b, flags: 0x0}, + 405: {region: 0x166, script: 0x5b, flags: 0x0}, + 406: {region: 0x166, script: 0x5b, flags: 0x0}, + 407: {region: 0x166, script: 0x5b, flags: 0x0}, + 408: {region: 0x166, script: 0x2c, flags: 0x0}, + 409: {region: 0x166, script: 0x5b, flags: 0x0}, + 410: {region: 0x9a, script: 0x22, flags: 0x0}, + 411: {region: 0x9a, script: 0xe9, flags: 0x0}, + 412: {region: 0x96, script: 0x5b, flags: 0x0}, + 413: {region: 0xda, script: 0x5b, flags: 0x0}, + 414: {region: 0x131, script: 0x32, flags: 0x0}, + 415: {region: 0x166, script: 0x5b, flags: 0x0}, 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x5a, flags: 0x0}, - 419: {region: 0x4e, script: 0x5a, flags: 0x0}, - 420: {region: 0x99, script: 0x35, flags: 0x0}, - 421: {region: 0x41, script: 0x5a, flags: 0x0}, - 422: {region: 0x54, script: 0x5a, flags: 0x0}, - 423: {region: 0x165, script: 0x5a, flags: 0x0}, - 424: {region: 0x80, script: 0x5a, flags: 0x0}, - 425: {region: 0x165, script: 0x5a, flags: 0x0}, - 426: {region: 0x165, script: 0x5a, flags: 0x0}, - 427: {region: 0xa4, script: 0x5a, flags: 0x0}, - 428: {region: 0x98, script: 0x5a, flags: 0x0}, - 429: {region: 0x165, script: 0x5a, flags: 0x0}, - 430: {region: 0xdb, script: 0x22, flags: 0x0}, - 431: {region: 0x165, script: 0x5a, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x5a, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x5a, flags: 0x0}, + 417: {region: 0x9a, script: 0xe, flags: 0x0}, + 418: {region: 0x166, script: 0x5b, flags: 0x0}, + 419: {region: 0x4e, script: 0x5b, flags: 0x0}, + 420: {region: 0x9a, script: 0x35, flags: 0x0}, + 421: {region: 0x41, script: 0x5b, flags: 0x0}, + 422: {region: 0x54, script: 0x5b, flags: 0x0}, + 423: {region: 0x166, script: 0x5b, flags: 0x0}, + 424: {region: 0x81, script: 0x5b, flags: 0x0}, + 425: {region: 0x166, script: 0x5b, flags: 0x0}, + 426: {region: 0x166, script: 0x5b, flags: 0x0}, + 427: {region: 0xa5, script: 0x5b, flags: 0x0}, + 428: {region: 0x99, script: 0x5b, flags: 0x0}, + 429: {region: 0x166, script: 0x5b, flags: 0x0}, + 430: {region: 0xdc, script: 0x22, flags: 0x0}, + 431: {region: 0x166, script: 0x5b, flags: 0x0}, + 432: {region: 0x166, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x5b, flags: 0x0}, + 434: {region: 0x166, script: 0x5, flags: 0x0}, + 435: {region: 0x166, script: 0x5b, flags: 0x0}, 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x5a, flags: 0x0}, + 437: {region: 0x166, script: 0x5b, flags: 0x0}, 438: {region: 0x53, script: 0x3b, flags: 0x0}, - 439: {region: 0x165, script: 0x5a, flags: 0x0}, - 440: {region: 0x135, script: 0x5a, flags: 0x0}, + 439: {region: 0x166, script: 0x5b, flags: 0x0}, + 440: {region: 0x136, script: 0x5b, flags: 0x0}, 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x5a, flags: 0x0}, - 443: {region: 0x165, script: 0x2c, flags: 0x0}, - 444: {region: 0x97, script: 0x3e, flags: 0x0}, - 445: {region: 0x165, script: 0x5a, flags: 0x0}, - 446: {region: 0x99, script: 0x22, flags: 0x0}, - 447: {region: 0x165, script: 0x5a, flags: 0x0}, - 448: {region: 0x73, script: 0x5a, flags: 0x0}, - 449: {region: 0x165, script: 0x5a, flags: 0x0}, - 450: {region: 0x165, script: 0x5a, flags: 0x0}, - 451: {region: 0xe7, script: 0x5a, flags: 0x0}, - 452: {region: 0x165, script: 0x5a, flags: 0x0}, - 453: {region: 0x12b, script: 0x40, flags: 0x0}, - 454: {region: 0x53, script: 0x90, flags: 0x0}, - 455: {region: 0x165, script: 0x5a, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x22, flags: 0x0}, - 458: {region: 0xaf, script: 0x41, flags: 0x0}, - 459: {region: 0xe7, script: 0x5a, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x5a, flags: 0x0}, - 462: {region: 0x99, script: 0x22, flags: 0x0}, - 463: {region: 0x99, script: 0x22, flags: 0x0}, - 464: {region: 0x165, script: 0x5a, flags: 0x0}, - 465: {region: 0x90, script: 0x5a, flags: 0x0}, - 466: {region: 0x60, script: 0x5a, flags: 0x0}, + 442: {region: 0x166, script: 0x5b, flags: 0x0}, + 443: {region: 0x166, script: 0x2c, flags: 0x0}, + 444: {region: 0x98, script: 0x3e, flags: 0x0}, + 445: {region: 0x166, script: 0x5b, flags: 0x0}, + 446: {region: 0x9a, script: 0x22, flags: 0x0}, + 447: {region: 0x166, script: 0x5b, flags: 0x0}, + 448: {region: 0x74, script: 0x5b, flags: 0x0}, + 449: {region: 0x166, script: 0x5b, flags: 0x0}, + 450: {region: 0x166, script: 0x5b, flags: 0x0}, + 451: {region: 0xe8, script: 0x5b, flags: 0x0}, + 452: {region: 0x166, script: 0x5b, flags: 0x0}, + 453: {region: 0x12c, script: 0x40, flags: 0x0}, + 454: {region: 0x53, script: 0x92, flags: 0x0}, + 455: {region: 0x166, script: 0x5b, flags: 0x0}, + 456: {region: 0xe9, script: 0x5, flags: 0x0}, + 457: {region: 0x9a, script: 0x22, flags: 0x0}, + 458: {region: 0xb0, script: 0x41, flags: 0x0}, + 459: {region: 0xe8, script: 0x5b, flags: 0x0}, + 460: {region: 0xe9, script: 0x5, flags: 0x0}, + 461: {region: 0xe7, script: 0x5b, flags: 0x0}, + 462: {region: 0x9a, script: 0x22, flags: 0x0}, + 463: {region: 0x9a, script: 0x22, flags: 0x0}, + 464: {region: 0x166, script: 0x5b, flags: 0x0}, + 465: {region: 0x91, script: 0x5b, flags: 0x0}, + 466: {region: 0x61, script: 0x5b, flags: 0x0}, 467: {region: 0x53, script: 0x3b, flags: 0x0}, - 468: {region: 0x91, script: 0x5a, flags: 0x0}, - 469: {region: 0x92, script: 0x5a, flags: 0x0}, - 470: {region: 0x165, script: 0x5a, flags: 0x0}, + 468: {region: 0x92, script: 0x5b, flags: 0x0}, + 469: {region: 0x93, script: 0x5b, flags: 0x0}, + 470: {region: 0x166, script: 0x5b, flags: 0x0}, 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x5a, flags: 0x0}, - 473: {region: 0x78, script: 0x5a, flags: 0x0}, - 474: {region: 0x165, script: 0x5a, flags: 0x0}, - 475: {region: 0x165, script: 0x5a, flags: 0x0}, - 476: {region: 0xd0, script: 0x5a, flags: 0x0}, - 477: {region: 0xd6, script: 0x5a, flags: 0x0}, - 478: {region: 0x165, script: 0x5a, flags: 0x0}, - 479: {region: 0x165, script: 0x5a, flags: 0x0}, - 480: {region: 0x165, script: 0x5a, flags: 0x0}, - 481: {region: 0x95, script: 0x5a, flags: 0x0}, - 482: {region: 0x165, script: 0x5a, flags: 0x0}, - 483: {region: 0x165, script: 0x5a, flags: 0x0}, - 484: {region: 0x165, script: 0x5a, flags: 0x0}, - 486: {region: 0x122, script: 0x5a, flags: 0x0}, - 487: {region: 0xd6, script: 0x5a, flags: 0x0}, - 488: {region: 0x165, script: 0x5a, flags: 0x0}, - 489: {region: 0x165, script: 0x5a, flags: 0x0}, - 490: {region: 0x53, script: 0xfa, flags: 0x0}, - 491: {region: 0x165, script: 0x5a, flags: 0x0}, - 492: {region: 0x135, script: 0x5a, flags: 0x0}, - 493: {region: 0x165, script: 0x5a, flags: 0x0}, - 494: {region: 0x49, script: 0x5a, flags: 0x0}, - 495: {region: 0x165, script: 0x5a, flags: 0x0}, - 496: {region: 0x165, script: 0x5a, flags: 0x0}, - 497: {region: 0xe7, script: 0x5a, flags: 0x0}, - 498: {region: 0x165, script: 0x5a, flags: 0x0}, - 499: {region: 0x95, script: 0x5a, flags: 0x0}, - 500: {region: 0x106, script: 0x20, flags: 0x0}, - 501: {region: 0x1, script: 0x5a, flags: 0x0}, - 502: {region: 0x165, script: 0x5a, flags: 0x0}, - 503: {region: 0x165, script: 0x5a, flags: 0x0}, - 504: {region: 0x9d, script: 0x5a, flags: 0x0}, - 505: {region: 0x9e, script: 0x5a, flags: 0x0}, + 472: {region: 0xd3, script: 0x5b, flags: 0x0}, + 473: {region: 0x79, script: 0x5b, flags: 0x0}, + 474: {region: 0x166, script: 0x5b, flags: 0x0}, + 475: {region: 0x166, script: 0x5b, flags: 0x0}, + 476: {region: 0xd1, script: 0x5b, flags: 0x0}, + 477: {region: 0xd7, script: 0x5b, flags: 0x0}, + 478: {region: 0x166, script: 0x5b, flags: 0x0}, + 479: {region: 0x166, script: 0x5b, flags: 0x0}, + 480: {region: 0x166, script: 0x5b, flags: 0x0}, + 481: {region: 0x96, script: 0x5b, flags: 0x0}, + 482: {region: 0x166, script: 0x5b, flags: 0x0}, + 483: {region: 0x166, script: 0x5b, flags: 0x0}, + 484: {region: 0x166, script: 0x5b, flags: 0x0}, + 486: {region: 0x123, script: 0x5b, flags: 0x0}, + 487: {region: 0xd7, script: 0x5b, flags: 0x0}, + 488: {region: 0x166, script: 0x5b, flags: 0x0}, + 489: {region: 0x166, script: 0x5b, flags: 0x0}, + 490: {region: 0x53, script: 0xfd, flags: 0x0}, + 491: {region: 0x166, script: 0x5b, flags: 0x0}, + 492: {region: 0x136, script: 0x5b, flags: 0x0}, + 493: {region: 0x166, script: 0x5b, flags: 0x0}, + 494: {region: 0x49, script: 0x5b, flags: 0x0}, + 495: {region: 0x166, script: 0x5b, flags: 0x0}, + 496: {region: 0x166, script: 0x5b, flags: 0x0}, + 497: {region: 0xe8, script: 0x5b, flags: 0x0}, + 498: {region: 0x166, script: 0x5b, flags: 0x0}, + 499: {region: 0x96, script: 0x5b, flags: 0x0}, + 500: {region: 0x107, script: 0x20, flags: 0x0}, + 501: {region: 0x1, script: 0x5b, flags: 0x0}, + 502: {region: 0x166, script: 0x5b, flags: 0x0}, + 503: {region: 0x166, script: 0x5b, flags: 0x0}, + 504: {region: 0x9e, script: 0x5b, flags: 0x0}, + 505: {region: 0x9f, script: 0x5b, flags: 0x0}, 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3e, flags: 0x0}, - 508: {region: 0x165, script: 0x5a, flags: 0x0}, - 509: {region: 0x165, script: 0x5a, flags: 0x0}, - 510: {region: 0x106, script: 0x5a, flags: 0x0}, - 511: {region: 0x165, script: 0x5a, flags: 0x0}, - 512: {region: 0xa2, script: 0x49, flags: 0x0}, - 513: {region: 0x165, script: 0x5a, flags: 0x0}, - 514: {region: 0xa0, script: 0x5a, flags: 0x0}, - 515: {region: 0x1, script: 0x5a, flags: 0x0}, - 516: {region: 0x165, script: 0x5a, flags: 0x0}, - 517: {region: 0x165, script: 0x5a, flags: 0x0}, - 518: {region: 0x165, script: 0x5a, flags: 0x0}, - 519: {region: 0x52, script: 0x5a, flags: 0x0}, - 520: {region: 0x130, script: 0x3e, flags: 0x0}, - 521: {region: 0x165, script: 0x5a, flags: 0x0}, - 522: {region: 0x12f, script: 0x5a, flags: 0x0}, - 523: {region: 0xdb, script: 0x22, flags: 0x0}, - 524: {region: 0x165, script: 0x5a, flags: 0x0}, - 525: {region: 0x63, script: 0x5a, flags: 0x0}, - 526: {region: 0x95, script: 0x5a, flags: 0x0}, - 527: {region: 0x95, script: 0x5a, flags: 0x0}, - 528: {region: 0x7d, script: 0x2e, flags: 0x0}, - 529: {region: 0x137, script: 0x20, flags: 0x0}, - 530: {region: 0x67, script: 0x5a, flags: 0x0}, - 531: {region: 0xc4, script: 0x5a, flags: 0x0}, - 532: {region: 0x165, script: 0x5a, flags: 0x0}, - 533: {region: 0x165, script: 0x5a, flags: 0x0}, - 534: {region: 0xd6, script: 0x5a, flags: 0x0}, - 535: {region: 0xa4, script: 0x5a, flags: 0x0}, - 536: {region: 0xc3, script: 0x5a, flags: 0x0}, - 537: {region: 0x106, script: 0x20, flags: 0x0}, - 538: {region: 0x165, script: 0x5a, flags: 0x0}, - 539: {region: 0x165, script: 0x5a, flags: 0x0}, - 540: {region: 0x165, script: 0x5a, flags: 0x0}, - 541: {region: 0x165, script: 0x5a, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x5a, flags: 0x0}, - 544: {region: 0x164, script: 0x5a, flags: 0x0}, - 545: {region: 0x165, script: 0x5a, flags: 0x0}, - 546: {region: 0x165, script: 0x5a, flags: 0x0}, - 547: {region: 0x12f, script: 0x5a, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x5a, flags: 0x0}, - 550: {region: 0x123, script: 0xeb, flags: 0x0}, - 551: {region: 0x5a, script: 0x5a, flags: 0x0}, - 552: {region: 0x52, script: 0x5a, flags: 0x0}, - 553: {region: 0x165, script: 0x5a, flags: 0x0}, - 554: {region: 0x4f, script: 0x5a, flags: 0x0}, - 555: {region: 0x99, script: 0x22, flags: 0x0}, - 556: {region: 0x99, script: 0x22, flags: 0x0}, - 557: {region: 0x4b, script: 0x5a, flags: 0x0}, - 558: {region: 0x95, script: 0x5a, flags: 0x0}, - 559: {region: 0x165, script: 0x5a, flags: 0x0}, - 560: {region: 0x41, script: 0x5a, flags: 0x0}, - 561: {region: 0x99, script: 0x5a, flags: 0x0}, - 562: {region: 0x53, script: 0xe2, flags: 0x0}, - 563: {region: 0x99, script: 0x22, flags: 0x0}, - 564: {region: 0xc3, script: 0x5a, flags: 0x0}, - 565: {region: 0x165, script: 0x5a, flags: 0x0}, - 566: {region: 0x99, script: 0x75, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x5a, flags: 0x0}, - 569: {region: 0xa4, script: 0x5a, flags: 0x0}, - 570: {region: 0x165, script: 0x5a, flags: 0x0}, - 571: {region: 0x12b, script: 0x5a, flags: 0x0}, - 572: {region: 0x165, script: 0x5a, flags: 0x0}, - 573: {region: 0xd2, script: 0x5a, flags: 0x0}, - 574: {region: 0x165, script: 0x5a, flags: 0x0}, - 575: {region: 0xaf, script: 0x57, flags: 0x0}, - 576: {region: 0x165, script: 0x5a, flags: 0x0}, - 577: {region: 0x165, script: 0x5a, flags: 0x0}, + 507: {region: 0x98, script: 0x3e, flags: 0x0}, + 508: {region: 0x166, script: 0x5b, flags: 0x0}, + 509: {region: 0x166, script: 0x5b, flags: 0x0}, + 510: {region: 0x107, script: 0x5b, flags: 0x0}, + 511: {region: 0x166, script: 0x5b, flags: 0x0}, + 512: {region: 0xa3, script: 0x49, flags: 0x0}, + 513: {region: 0x166, script: 0x5b, flags: 0x0}, + 514: {region: 0xa1, script: 0x5b, flags: 0x0}, + 515: {region: 0x1, script: 0x5b, flags: 0x0}, + 516: {region: 0x166, script: 0x5b, flags: 0x0}, + 517: {region: 0x166, script: 0x5b, flags: 0x0}, + 518: {region: 0x166, script: 0x5b, flags: 0x0}, + 519: {region: 0x52, script: 0x5b, flags: 0x0}, + 520: {region: 0x131, script: 0x3e, flags: 0x0}, + 521: {region: 0x166, script: 0x5b, flags: 0x0}, + 522: {region: 0x130, script: 0x5b, flags: 0x0}, + 523: {region: 0xdc, script: 0x22, flags: 0x0}, + 524: {region: 0x166, script: 0x5b, flags: 0x0}, + 525: {region: 0x64, script: 0x5b, flags: 0x0}, + 526: {region: 0x96, script: 0x5b, flags: 0x0}, + 527: {region: 0x96, script: 0x5b, flags: 0x0}, + 528: {region: 0x7e, script: 0x2e, flags: 0x0}, + 529: {region: 0x138, script: 0x20, flags: 0x0}, + 530: {region: 0x68, script: 0x5b, flags: 0x0}, + 531: {region: 0xc5, script: 0x5b, flags: 0x0}, + 532: {region: 0x166, script: 0x5b, flags: 0x0}, + 533: {region: 0x166, script: 0x5b, flags: 0x0}, + 534: {region: 0xd7, script: 0x5b, flags: 0x0}, + 535: {region: 0xa5, script: 0x5b, flags: 0x0}, + 536: {region: 0xc4, script: 0x5b, flags: 0x0}, + 537: {region: 0x107, script: 0x20, flags: 0x0}, + 538: {region: 0x166, script: 0x5b, flags: 0x0}, + 539: {region: 0x166, script: 0x5b, flags: 0x0}, + 540: {region: 0x166, script: 0x5b, flags: 0x0}, + 541: {region: 0x166, script: 0x5b, flags: 0x0}, + 542: {region: 0xd5, script: 0x5, flags: 0x0}, + 543: {region: 0xd7, script: 0x5b, flags: 0x0}, + 544: {region: 0x165, script: 0x5b, flags: 0x0}, + 545: {region: 0x166, script: 0x5b, flags: 0x0}, + 546: {region: 0x166, script: 0x5b, flags: 0x0}, + 547: {region: 0x130, script: 0x5b, flags: 0x0}, + 548: {region: 0x123, script: 0x5, flags: 0x0}, + 549: {region: 0x166, script: 0x5b, flags: 0x0}, + 550: {region: 0x124, script: 0xee, flags: 0x0}, + 551: {region: 0x5b, script: 0x5b, flags: 0x0}, + 552: {region: 0x52, script: 0x5b, flags: 0x0}, + 553: {region: 0x166, script: 0x5b, flags: 0x0}, + 554: {region: 0x4f, script: 0x5b, flags: 0x0}, + 555: {region: 0x9a, script: 0x22, flags: 0x0}, + 556: {region: 0x9a, script: 0x22, flags: 0x0}, + 557: {region: 0x4b, script: 0x5b, flags: 0x0}, + 558: {region: 0x96, script: 0x5b, flags: 0x0}, + 559: {region: 0x166, script: 0x5b, flags: 0x0}, + 560: {region: 0x41, script: 0x5b, flags: 0x0}, + 561: {region: 0x9a, script: 0x5b, flags: 0x0}, + 562: {region: 0x53, script: 0xe5, flags: 0x0}, + 563: {region: 0x9a, script: 0x22, flags: 0x0}, + 564: {region: 0xc4, script: 0x5b, flags: 0x0}, + 565: {region: 0x166, script: 0x5b, flags: 0x0}, + 566: {region: 0x9a, script: 0x76, flags: 0x0}, + 567: {region: 0xe9, script: 0x5, flags: 0x0}, + 568: {region: 0x166, script: 0x5b, flags: 0x0}, + 569: {region: 0xa5, script: 0x5b, flags: 0x0}, + 570: {region: 0x166, script: 0x5b, flags: 0x0}, + 571: {region: 0x12c, script: 0x5b, flags: 0x0}, + 572: {region: 0x166, script: 0x5b, flags: 0x0}, + 573: {region: 0xd3, script: 0x5b, flags: 0x0}, + 574: {region: 0x166, script: 0x5b, flags: 0x0}, + 575: {region: 0xb0, script: 0x58, flags: 0x0}, + 576: {region: 0x166, script: 0x5b, flags: 0x0}, + 577: {region: 0x166, script: 0x5b, flags: 0x0}, 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x5a, flags: 0x0}, - 580: {region: 0x52, script: 0x5a, flags: 0x0}, - 581: {region: 0x82, script: 0x5a, flags: 0x0}, - 582: {region: 0xa4, script: 0x5a, flags: 0x0}, - 583: {region: 0x165, script: 0x5a, flags: 0x0}, - 584: {region: 0x165, script: 0x5a, flags: 0x0}, - 585: {region: 0x165, script: 0x5a, flags: 0x0}, - 586: {region: 0xa6, script: 0x4e, flags: 0x0}, - 587: {region: 0x2a, script: 0x5a, flags: 0x0}, - 588: {region: 0x165, script: 0x5a, flags: 0x0}, - 589: {region: 0x165, script: 0x5a, flags: 0x0}, - 590: {region: 0x165, script: 0x5a, flags: 0x0}, - 591: {region: 0x165, script: 0x5a, flags: 0x0}, - 592: {region: 0x165, script: 0x5a, flags: 0x0}, - 593: {region: 0x99, script: 0x52, flags: 0x0}, - 594: {region: 0x8b, script: 0x5a, flags: 0x0}, - 595: {region: 0x165, script: 0x5a, flags: 0x0}, - 596: {region: 0xab, script: 0x53, flags: 0x0}, - 597: {region: 0x106, script: 0x20, flags: 0x0}, - 598: {region: 0x99, script: 0x22, flags: 0x0}, - 599: {region: 0x165, script: 0x5a, flags: 0x0}, - 600: {region: 0x75, script: 0x5a, flags: 0x0}, - 601: {region: 0x165, script: 0x5a, flags: 0x0}, - 602: {region: 0xb4, script: 0x5a, flags: 0x0}, - 603: {region: 0x165, script: 0x5a, flags: 0x0}, - 604: {region: 0x165, script: 0x5a, flags: 0x0}, - 605: {region: 0x165, script: 0x5a, flags: 0x0}, - 606: {region: 0x165, script: 0x5a, flags: 0x0}, - 607: {region: 0x165, script: 0x5a, flags: 0x0}, - 608: {region: 0x165, script: 0x5a, flags: 0x0}, - 609: {region: 0x165, script: 0x5a, flags: 0x0}, - 610: {region: 0x165, script: 0x2c, flags: 0x0}, - 611: {region: 0x165, script: 0x5a, flags: 0x0}, - 612: {region: 0x106, script: 0x20, flags: 0x0}, - 613: {region: 0x112, script: 0x5a, flags: 0x0}, - 614: {region: 0xe7, script: 0x5a, flags: 0x0}, - 615: {region: 0x106, script: 0x5a, flags: 0x0}, - 616: {region: 0x165, script: 0x5a, flags: 0x0}, - 617: {region: 0x99, script: 0x22, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x5a, flags: 0x0}, - 620: {region: 0x165, script: 0x5a, flags: 0x0}, - 621: {region: 0x52, script: 0x5a, flags: 0x0}, - 622: {region: 0x60, script: 0x5a, flags: 0x0}, - 623: {region: 0x165, script: 0x5a, flags: 0x0}, - 624: {region: 0x165, script: 0x5a, flags: 0x0}, - 625: {region: 0x165, script: 0x2c, flags: 0x0}, - 626: {region: 0x165, script: 0x5a, flags: 0x0}, - 627: {region: 0x165, script: 0x5a, flags: 0x0}, + 579: {region: 0x166, script: 0x5b, flags: 0x0}, + 580: {region: 0x52, script: 0x5b, flags: 0x0}, + 581: {region: 0x83, script: 0x5b, flags: 0x0}, + 582: {region: 0xa5, script: 0x5b, flags: 0x0}, + 583: {region: 0x166, script: 0x5b, flags: 0x0}, + 584: {region: 0x166, script: 0x5b, flags: 0x0}, + 585: {region: 0x166, script: 0x5b, flags: 0x0}, + 586: {region: 0xa7, script: 0x4f, flags: 0x0}, + 587: {region: 0x2a, script: 0x5b, flags: 0x0}, + 588: {region: 0x166, script: 0x5b, flags: 0x0}, + 589: {region: 0x166, script: 0x5b, flags: 0x0}, + 590: {region: 0x166, script: 0x5b, flags: 0x0}, + 591: {region: 0x166, script: 0x5b, flags: 0x0}, + 592: {region: 0x166, script: 0x5b, flags: 0x0}, + 593: {region: 0x9a, script: 0x53, flags: 0x0}, + 594: {region: 0x8c, script: 0x5b, flags: 0x0}, + 595: {region: 0x166, script: 0x5b, flags: 0x0}, + 596: {region: 0xac, script: 0x54, flags: 0x0}, + 597: {region: 0x107, script: 0x20, flags: 0x0}, + 598: {region: 0x9a, script: 0x22, flags: 0x0}, + 599: {region: 0x166, script: 0x5b, flags: 0x0}, + 600: {region: 0x76, script: 0x5b, flags: 0x0}, + 601: {region: 0x166, script: 0x5b, flags: 0x0}, + 602: {region: 0xb5, script: 0x5b, flags: 0x0}, + 603: {region: 0x166, script: 0x5b, flags: 0x0}, + 604: {region: 0x166, script: 0x5b, flags: 0x0}, + 605: {region: 0x166, script: 0x5b, flags: 0x0}, + 606: {region: 0x166, script: 0x5b, flags: 0x0}, + 607: {region: 0x166, script: 0x5b, flags: 0x0}, + 608: {region: 0x166, script: 0x5b, flags: 0x0}, + 609: {region: 0x166, script: 0x5b, flags: 0x0}, + 610: {region: 0x166, script: 0x2c, flags: 0x0}, + 611: {region: 0x166, script: 0x5b, flags: 0x0}, + 612: {region: 0x107, script: 0x20, flags: 0x0}, + 613: {region: 0x113, script: 0x5b, flags: 0x0}, + 614: {region: 0xe8, script: 0x5b, flags: 0x0}, + 615: {region: 0x107, script: 0x5b, flags: 0x0}, + 616: {region: 0x166, script: 0x5b, flags: 0x0}, + 617: {region: 0x9a, script: 0x22, flags: 0x0}, + 618: {region: 0x9a, script: 0x5, flags: 0x0}, + 619: {region: 0x130, script: 0x5b, flags: 0x0}, + 620: {region: 0x166, script: 0x5b, flags: 0x0}, + 621: {region: 0x52, script: 0x5b, flags: 0x0}, + 622: {region: 0x61, script: 0x5b, flags: 0x0}, + 623: {region: 0x166, script: 0x5b, flags: 0x0}, + 624: {region: 0x166, script: 0x5b, flags: 0x0}, + 625: {region: 0x166, script: 0x2c, flags: 0x0}, + 626: {region: 0x166, script: 0x5b, flags: 0x0}, + 627: {region: 0x166, script: 0x5b, flags: 0x0}, 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x5a, flags: 0x0}, - 630: {region: 0x165, script: 0x5a, flags: 0x0}, - 631: {region: 0x165, script: 0x5a, flags: 0x0}, - 632: {region: 0x165, script: 0x5a, flags: 0x0}, - 633: {region: 0x106, script: 0x20, flags: 0x0}, - 634: {region: 0x165, script: 0x5a, flags: 0x0}, - 635: {region: 0x165, script: 0x5a, flags: 0x0}, - 636: {region: 0x165, script: 0x5a, flags: 0x0}, - 637: {region: 0x106, script: 0x20, flags: 0x0}, - 638: {region: 0x165, script: 0x5a, flags: 0x0}, - 639: {region: 0x95, script: 0x5a, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x5a, flags: 0x0}, - 642: {region: 0x165, script: 0x5a, flags: 0x0}, - 643: {region: 0x165, script: 0x5a, flags: 0x0}, - 644: {region: 0x165, script: 0x5a, flags: 0x0}, - 645: {region: 0x165, script: 0x2c, flags: 0x0}, - 646: {region: 0x123, script: 0xeb, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x5a, flags: 0x0}, - 649: {region: 0x165, script: 0x5a, flags: 0x0}, + 629: {region: 0x166, script: 0x5b, flags: 0x0}, + 630: {region: 0x166, script: 0x5b, flags: 0x0}, + 631: {region: 0x166, script: 0x5b, flags: 0x0}, + 632: {region: 0x166, script: 0x5b, flags: 0x0}, + 633: {region: 0x107, script: 0x20, flags: 0x0}, + 634: {region: 0x166, script: 0x5b, flags: 0x0}, + 635: {region: 0x166, script: 0x5b, flags: 0x0}, + 636: {region: 0x166, script: 0x5b, flags: 0x0}, + 637: {region: 0x107, script: 0x20, flags: 0x0}, + 638: {region: 0x166, script: 0x5b, flags: 0x0}, + 639: {region: 0x96, script: 0x5b, flags: 0x0}, + 640: {region: 0xe9, script: 0x5, flags: 0x0}, + 641: {region: 0x7c, script: 0x5b, flags: 0x0}, + 642: {region: 0x166, script: 0x5b, flags: 0x0}, + 643: {region: 0x166, script: 0x5b, flags: 0x0}, + 644: {region: 0x166, script: 0x5b, flags: 0x0}, + 645: {region: 0x166, script: 0x2c, flags: 0x0}, + 646: {region: 0x124, script: 0xee, flags: 0x0}, + 647: {region: 0xe9, script: 0x5, flags: 0x0}, + 648: {region: 0x166, script: 0x5b, flags: 0x0}, + 649: {region: 0x166, script: 0x5b, flags: 0x0}, 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x5a, flags: 0x0}, - 652: {region: 0x165, script: 0x5a, flags: 0x0}, - 653: {region: 0x165, script: 0x5a, flags: 0x0}, - 654: {region: 0x138, script: 0x5a, flags: 0x0}, - 655: {region: 0x87, script: 0x5e, flags: 0x0}, - 656: {region: 0x97, script: 0x3e, flags: 0x0}, - 657: {region: 0x12f, script: 0x5a, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x5a, flags: 0x0}, - 660: {region: 0x165, script: 0x5a, flags: 0x0}, - 661: {region: 0xb7, script: 0x5a, flags: 0x0}, - 662: {region: 0x106, script: 0x20, flags: 0x0}, - 663: {region: 0x165, script: 0x5a, flags: 0x0}, - 664: {region: 0x95, script: 0x5a, flags: 0x0}, - 665: {region: 0x165, script: 0x5a, flags: 0x0}, - 666: {region: 0x53, script: 0xeb, flags: 0x0}, - 667: {region: 0x165, script: 0x5a, flags: 0x0}, - 668: {region: 0x165, script: 0x5a, flags: 0x0}, - 669: {region: 0x165, script: 0x5a, flags: 0x0}, - 670: {region: 0x165, script: 0x5a, flags: 0x0}, - 671: {region: 0x99, script: 0x5c, flags: 0x0}, - 672: {region: 0x165, script: 0x5a, flags: 0x0}, - 673: {region: 0x165, script: 0x5a, flags: 0x0}, - 674: {region: 0x106, script: 0x20, flags: 0x0}, - 675: {region: 0x131, script: 0x5a, flags: 0x0}, - 676: {region: 0x165, script: 0x5a, flags: 0x0}, - 677: {region: 0xd9, script: 0x5a, flags: 0x0}, - 678: {region: 0x165, script: 0x5a, flags: 0x0}, - 679: {region: 0x165, script: 0x5a, flags: 0x0}, + 651: {region: 0x166, script: 0x5b, flags: 0x0}, + 652: {region: 0x166, script: 0x5b, flags: 0x0}, + 653: {region: 0x166, script: 0x5b, flags: 0x0}, + 654: {region: 0x139, script: 0x5b, flags: 0x0}, + 655: {region: 0x88, script: 0x5f, flags: 0x0}, + 656: {region: 0x98, script: 0x3e, flags: 0x0}, + 657: {region: 0x130, script: 0x5b, flags: 0x0}, + 658: {region: 0xe9, script: 0x5, flags: 0x0}, + 659: {region: 0x132, script: 0x5b, flags: 0x0}, + 660: {region: 0x166, script: 0x5b, flags: 0x0}, + 661: {region: 0xb8, script: 0x5b, flags: 0x0}, + 662: {region: 0x107, script: 0x20, flags: 0x0}, + 663: {region: 0x166, script: 0x5b, flags: 0x0}, + 664: {region: 0x96, script: 0x5b, flags: 0x0}, + 665: {region: 0x166, script: 0x5b, flags: 0x0}, + 666: {region: 0x53, script: 0xee, flags: 0x0}, + 667: {region: 0x166, script: 0x5b, flags: 0x0}, + 668: {region: 0x166, script: 0x5b, flags: 0x0}, + 669: {region: 0x166, script: 0x5b, flags: 0x0}, + 670: {region: 0x166, script: 0x5b, flags: 0x0}, + 671: {region: 0x9a, script: 0x5d, flags: 0x0}, + 672: {region: 0x166, script: 0x5b, flags: 0x0}, + 673: {region: 0x166, script: 0x5b, flags: 0x0}, + 674: {region: 0x107, script: 0x20, flags: 0x0}, + 675: {region: 0x132, script: 0x5b, flags: 0x0}, + 676: {region: 0x166, script: 0x5b, flags: 0x0}, + 677: {region: 0xda, script: 0x5b, flags: 0x0}, + 678: {region: 0x166, script: 0x5b, flags: 0x0}, + 679: {region: 0x166, script: 0x5b, flags: 0x0}, 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x5a, flags: 0x0}, - 682: {region: 0x165, script: 0x5a, flags: 0x0}, - 683: {region: 0x9e, script: 0x5a, flags: 0x0}, - 684: {region: 0x53, script: 0x60, flags: 0x0}, - 685: {region: 0x95, script: 0x5a, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x5a, flags: 0x0}, - 688: {region: 0x165, script: 0x5a, flags: 0x0}, - 689: {region: 0x165, script: 0x5a, flags: 0x0}, - 690: {region: 0x99, script: 0xe6, flags: 0x0}, - 691: {region: 0x9e, script: 0x5a, flags: 0x0}, - 692: {region: 0x165, script: 0x5a, flags: 0x0}, - 693: {region: 0x4b, script: 0x5a, flags: 0x0}, - 694: {region: 0x165, script: 0x5a, flags: 0x0}, - 695: {region: 0x165, script: 0x5a, flags: 0x0}, - 696: {region: 0xaf, script: 0x57, flags: 0x0}, - 697: {region: 0x165, script: 0x5a, flags: 0x0}, - 698: {region: 0x165, script: 0x5a, flags: 0x0}, - 699: {region: 0x4b, script: 0x5a, flags: 0x0}, - 700: {region: 0x165, script: 0x5a, flags: 0x0}, - 701: {region: 0x165, script: 0x5a, flags: 0x0}, - 702: {region: 0x162, script: 0x5a, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x5a, flags: 0x0}, - 705: {region: 0xb8, script: 0x5a, flags: 0x0}, - 706: {region: 0x4b, script: 0x5a, flags: 0x0}, - 707: {region: 0x4b, script: 0x5a, flags: 0x0}, - 708: {region: 0xa4, script: 0x5a, flags: 0x0}, - 709: {region: 0xa4, script: 0x5a, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x5a, flags: 0x0}, - 712: {region: 0x123, script: 0xeb, flags: 0x0}, + 681: {region: 0x166, script: 0x5b, flags: 0x0}, + 682: {region: 0x166, script: 0x5b, flags: 0x0}, + 683: {region: 0x9f, script: 0x5b, flags: 0x0}, + 684: {region: 0x53, script: 0x61, flags: 0x0}, + 685: {region: 0x96, script: 0x5b, flags: 0x0}, + 686: {region: 0x9d, script: 0x5, flags: 0x0}, + 687: {region: 0x136, script: 0x5b, flags: 0x0}, + 688: {region: 0x166, script: 0x5b, flags: 0x0}, + 689: {region: 0x166, script: 0x5b, flags: 0x0}, + 690: {region: 0x9a, script: 0xe9, flags: 0x0}, + 691: {region: 0x9f, script: 0x5b, flags: 0x0}, + 692: {region: 0x166, script: 0x5b, flags: 0x0}, + 693: {region: 0x4b, script: 0x5b, flags: 0x0}, + 694: {region: 0x166, script: 0x5b, flags: 0x0}, + 695: {region: 0x166, script: 0x5b, flags: 0x0}, + 696: {region: 0xb0, script: 0x58, flags: 0x0}, + 697: {region: 0x166, script: 0x5b, flags: 0x0}, + 698: {region: 0x166, script: 0x5b, flags: 0x0}, + 699: {region: 0x4b, script: 0x5b, flags: 0x0}, + 700: {region: 0x166, script: 0x5b, flags: 0x0}, + 701: {region: 0x166, script: 0x5b, flags: 0x0}, + 702: {region: 0x163, script: 0x5b, flags: 0x0}, + 703: {region: 0x9d, script: 0x5, flags: 0x0}, + 704: {region: 0xb7, script: 0x5b, flags: 0x0}, + 705: {region: 0xb9, script: 0x5b, flags: 0x0}, + 706: {region: 0x4b, script: 0x5b, flags: 0x0}, + 707: {region: 0x4b, script: 0x5b, flags: 0x0}, + 708: {region: 0xa5, script: 0x5b, flags: 0x0}, + 709: {region: 0xa5, script: 0x5b, flags: 0x0}, + 710: {region: 0x9d, script: 0x5, flags: 0x0}, + 711: {region: 0xb9, script: 0x5b, flags: 0x0}, + 712: {region: 0x124, script: 0xee, flags: 0x0}, 713: {region: 0x53, script: 0x3b, flags: 0x0}, - 714: {region: 0x12b, script: 0x5a, flags: 0x0}, - 715: {region: 0x95, script: 0x5a, flags: 0x0}, - 716: {region: 0x52, script: 0x5a, flags: 0x0}, - 717: {region: 0x99, script: 0x22, flags: 0x0}, - 718: {region: 0x99, script: 0x22, flags: 0x0}, - 719: {region: 0x95, script: 0x5a, flags: 0x0}, + 714: {region: 0x12c, script: 0x5b, flags: 0x0}, + 715: {region: 0x96, script: 0x5b, flags: 0x0}, + 716: {region: 0x52, script: 0x5b, flags: 0x0}, + 717: {region: 0x9a, script: 0x22, flags: 0x0}, + 718: {region: 0x9a, script: 0x22, flags: 0x0}, + 719: {region: 0x96, script: 0x5b, flags: 0x0}, 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x5a, flags: 0x0}, - 722: {region: 0x165, script: 0x5a, flags: 0x0}, - 723: {region: 0xcf, script: 0x5a, flags: 0x0}, - 724: {region: 0x165, script: 0x5a, flags: 0x0}, - 725: {region: 0x165, script: 0x5a, flags: 0x0}, - 726: {region: 0x165, script: 0x5a, flags: 0x0}, - 727: {region: 0x165, script: 0x5a, flags: 0x0}, - 728: {region: 0x165, script: 0x5a, flags: 0x0}, - 729: {region: 0x165, script: 0x5a, flags: 0x0}, - 730: {region: 0x165, script: 0x5a, flags: 0x0}, - 731: {region: 0x165, script: 0x5a, flags: 0x0}, - 732: {region: 0x165, script: 0x5a, flags: 0x0}, - 733: {region: 0x165, script: 0x5a, flags: 0x0}, - 734: {region: 0x165, script: 0x5a, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x20, flags: 0x0}, - 737: {region: 0xe7, script: 0x5a, flags: 0x0}, - 738: {region: 0x165, script: 0x5a, flags: 0x0}, - 739: {region: 0x95, script: 0x5a, flags: 0x0}, - 740: {region: 0x165, script: 0x2c, flags: 0x0}, - 741: {region: 0x165, script: 0x5a, flags: 0x0}, - 742: {region: 0x165, script: 0x5a, flags: 0x0}, - 743: {region: 0x165, script: 0x5a, flags: 0x0}, - 744: {region: 0x112, script: 0x5a, flags: 0x0}, - 745: {region: 0xa4, script: 0x5a, flags: 0x0}, - 746: {region: 0x165, script: 0x5a, flags: 0x0}, - 747: {region: 0x165, script: 0x5a, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x5a, flags: 0x0}, - 750: {region: 0x165, script: 0x5a, flags: 0x0}, - 751: {region: 0x165, script: 0x5a, flags: 0x0}, - 752: {region: 0x165, script: 0x5a, flags: 0x0}, - 753: {region: 0xbf, script: 0x5a, flags: 0x0}, - 754: {region: 0xd1, script: 0x5a, flags: 0x0}, - 755: {region: 0x165, script: 0x5a, flags: 0x0}, - 756: {region: 0x52, script: 0x5a, flags: 0x0}, - 757: {region: 0xdb, script: 0x22, flags: 0x0}, - 758: {region: 0x12f, script: 0x5a, flags: 0x0}, - 759: {region: 0xc0, script: 0x5a, flags: 0x0}, - 760: {region: 0x165, script: 0x5a, flags: 0x0}, - 761: {region: 0x165, script: 0x5a, flags: 0x0}, - 762: {region: 0xe0, script: 0x5a, flags: 0x0}, - 763: {region: 0x165, script: 0x5a, flags: 0x0}, - 764: {region: 0x95, script: 0x5a, flags: 0x0}, - 765: {region: 0x9b, script: 0x3d, flags: 0x0}, - 766: {region: 0x165, script: 0x5a, flags: 0x0}, - 767: {region: 0xc2, script: 0x20, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x5a, flags: 0x0}, - 770: {region: 0x165, script: 0x5a, flags: 0x0}, - 771: {region: 0x165, script: 0x5a, flags: 0x0}, - 772: {region: 0x99, script: 0x6e, flags: 0x0}, - 773: {region: 0x165, script: 0x5a, flags: 0x0}, - 774: {region: 0x165, script: 0x5a, flags: 0x0}, - 775: {region: 0x10b, script: 0x5a, flags: 0x0}, - 776: {region: 0x165, script: 0x5a, flags: 0x0}, - 777: {region: 0x165, script: 0x5a, flags: 0x0}, - 778: {region: 0x165, script: 0x5a, flags: 0x0}, + 721: {region: 0xa5, script: 0x5b, flags: 0x0}, + 722: {region: 0x166, script: 0x5b, flags: 0x0}, + 723: {region: 0xd0, script: 0x5b, flags: 0x0}, + 724: {region: 0x166, script: 0x5b, flags: 0x0}, + 725: {region: 0x166, script: 0x5b, flags: 0x0}, + 726: {region: 0x166, script: 0x5b, flags: 0x0}, + 727: {region: 0x166, script: 0x5b, flags: 0x0}, + 728: {region: 0x166, script: 0x5b, flags: 0x0}, + 729: {region: 0x166, script: 0x5b, flags: 0x0}, + 730: {region: 0x166, script: 0x5b, flags: 0x0}, + 731: {region: 0x166, script: 0x5b, flags: 0x0}, + 732: {region: 0x166, script: 0x5b, flags: 0x0}, + 733: {region: 0x166, script: 0x5b, flags: 0x0}, + 734: {region: 0x166, script: 0x5b, flags: 0x0}, + 735: {region: 0x166, script: 0x5, flags: 0x0}, + 736: {region: 0x107, script: 0x20, flags: 0x0}, + 737: {region: 0xe8, script: 0x5b, flags: 0x0}, + 738: {region: 0x166, script: 0x5b, flags: 0x0}, + 739: {region: 0x96, script: 0x5b, flags: 0x0}, + 740: {region: 0x166, script: 0x2c, flags: 0x0}, + 741: {region: 0x166, script: 0x5b, flags: 0x0}, + 742: {region: 0x166, script: 0x5b, flags: 0x0}, + 743: {region: 0x166, script: 0x5b, flags: 0x0}, + 744: {region: 0x113, script: 0x5b, flags: 0x0}, + 745: {region: 0xa5, script: 0x5b, flags: 0x0}, + 746: {region: 0x166, script: 0x5b, flags: 0x0}, + 747: {region: 0x166, script: 0x5b, flags: 0x0}, + 748: {region: 0x124, script: 0x5, flags: 0x0}, + 749: {region: 0xcd, script: 0x5b, flags: 0x0}, + 750: {region: 0x166, script: 0x5b, flags: 0x0}, + 751: {region: 0x166, script: 0x5b, flags: 0x0}, + 752: {region: 0x166, script: 0x5b, flags: 0x0}, + 753: {region: 0xc0, script: 0x5b, flags: 0x0}, + 754: {region: 0xd2, script: 0x5b, flags: 0x0}, + 755: {region: 0x166, script: 0x5b, flags: 0x0}, + 756: {region: 0x52, script: 0x5b, flags: 0x0}, + 757: {region: 0xdc, script: 0x22, flags: 0x0}, + 758: {region: 0x130, script: 0x5b, flags: 0x0}, + 759: {region: 0xc1, script: 0x5b, flags: 0x0}, + 760: {region: 0x166, script: 0x5b, flags: 0x0}, + 761: {region: 0x166, script: 0x5b, flags: 0x0}, + 762: {region: 0xe1, script: 0x5b, flags: 0x0}, + 763: {region: 0x166, script: 0x5b, flags: 0x0}, + 764: {region: 0x96, script: 0x5b, flags: 0x0}, + 765: {region: 0x9c, script: 0x3d, flags: 0x0}, + 766: {region: 0x166, script: 0x5b, flags: 0x0}, + 767: {region: 0xc3, script: 0x20, flags: 0x0}, + 768: {region: 0x166, script: 0x5, flags: 0x0}, + 769: {region: 0x166, script: 0x5b, flags: 0x0}, + 770: {region: 0x166, script: 0x5b, flags: 0x0}, + 771: {region: 0x166, script: 0x5b, flags: 0x0}, + 772: {region: 0x9a, script: 0x6f, flags: 0x0}, + 773: {region: 0x166, script: 0x5b, flags: 0x0}, + 774: {region: 0x166, script: 0x5b, flags: 0x0}, + 775: {region: 0x10c, script: 0x5b, flags: 0x0}, + 776: {region: 0x166, script: 0x5b, flags: 0x0}, + 777: {region: 0x166, script: 0x5b, flags: 0x0}, + 778: {region: 0x166, script: 0x5b, flags: 0x0}, 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x5a, flags: 0x0}, - 781: {region: 0x165, script: 0x5a, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x75, flags: 0x0}, - 785: {region: 0x165, script: 0x5a, flags: 0x0}, - 786: {region: 0x49, script: 0x5a, flags: 0x0}, - 787: {region: 0x49, script: 0x5a, flags: 0x0}, - 788: {region: 0x37, script: 0x5a, flags: 0x0}, - 789: {region: 0x165, script: 0x5a, flags: 0x0}, - 790: {region: 0x165, script: 0x5a, flags: 0x0}, - 791: {region: 0x165, script: 0x5a, flags: 0x0}, - 792: {region: 0x165, script: 0x5a, flags: 0x0}, - 793: {region: 0x165, script: 0x5a, flags: 0x0}, - 794: {region: 0x165, script: 0x5a, flags: 0x0}, - 795: {region: 0x99, script: 0x22, flags: 0x0}, - 796: {region: 0xdb, script: 0x22, flags: 0x0}, - 797: {region: 0x106, script: 0x20, flags: 0x0}, - 798: {region: 0x35, script: 0x72, flags: 0x0}, + 780: {region: 0x166, script: 0x5b, flags: 0x0}, + 781: {region: 0x166, script: 0x5b, flags: 0x0}, + 782: {region: 0x9a, script: 0xe, flags: 0x0}, + 783: {region: 0xc5, script: 0x76, flags: 0x0}, + 785: {region: 0x166, script: 0x5b, flags: 0x0}, + 786: {region: 0x49, script: 0x5b, flags: 0x0}, + 787: {region: 0x49, script: 0x5b, flags: 0x0}, + 788: {region: 0x37, script: 0x5b, flags: 0x0}, + 789: {region: 0x166, script: 0x5b, flags: 0x0}, + 790: {region: 0x166, script: 0x5b, flags: 0x0}, + 791: {region: 0x166, script: 0x5b, flags: 0x0}, + 792: {region: 0x166, script: 0x5b, flags: 0x0}, + 793: {region: 0x166, script: 0x5b, flags: 0x0}, + 794: {region: 0x166, script: 0x5b, flags: 0x0}, + 795: {region: 0x9a, script: 0x22, flags: 0x0}, + 796: {region: 0xdc, script: 0x22, flags: 0x0}, + 797: {region: 0x107, script: 0x20, flags: 0x0}, + 798: {region: 0x35, script: 0x73, flags: 0x0}, 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x5a, flags: 0x0}, - 801: {region: 0x165, script: 0x5a, flags: 0x0}, - 802: {region: 0x165, script: 0x5a, flags: 0x0}, - 803: {region: 0x165, script: 0x5a, flags: 0x0}, - 804: {region: 0x99, script: 0x22, flags: 0x0}, - 805: {region: 0x52, script: 0x5a, flags: 0x0}, - 807: {region: 0x165, script: 0x5a, flags: 0x0}, - 808: {region: 0x135, script: 0x5a, flags: 0x0}, - 809: {region: 0x165, script: 0x5a, flags: 0x0}, - 810: {region: 0x165, script: 0x5a, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x5a, flags: 0x0}, - 813: {region: 0x99, script: 0x22, flags: 0x0}, - 814: {region: 0x95, script: 0x5a, flags: 0x0}, - 815: {region: 0x164, script: 0x5a, flags: 0x0}, - 816: {region: 0x165, script: 0x5a, flags: 0x0}, - 817: {region: 0xc4, script: 0x75, flags: 0x0}, - 818: {region: 0x165, script: 0x5a, flags: 0x0}, - 819: {region: 0x165, script: 0x2c, flags: 0x0}, - 820: {region: 0x106, script: 0x20, flags: 0x0}, - 821: {region: 0x165, script: 0x5a, flags: 0x0}, - 822: {region: 0x131, script: 0x5a, flags: 0x0}, - 823: {region: 0x9c, script: 0x66, flags: 0x0}, - 824: {region: 0x165, script: 0x5a, flags: 0x0}, - 825: {region: 0x165, script: 0x5a, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x5a, flags: 0x0}, - 828: {region: 0x165, script: 0x5a, flags: 0x0}, - 829: {region: 0x165, script: 0x5a, flags: 0x0}, - 830: {region: 0xdd, script: 0x5a, flags: 0x0}, - 831: {region: 0x165, script: 0x5a, flags: 0x0}, - 832: {region: 0x165, script: 0x5a, flags: 0x0}, - 834: {region: 0x165, script: 0x5a, flags: 0x0}, + 800: {region: 0xcc, script: 0x5b, flags: 0x0}, + 801: {region: 0x166, script: 0x5b, flags: 0x0}, + 802: {region: 0x166, script: 0x5b, flags: 0x0}, + 803: {region: 0x166, script: 0x5b, flags: 0x0}, + 804: {region: 0x9a, script: 0x22, flags: 0x0}, + 805: {region: 0x52, script: 0x5b, flags: 0x0}, + 807: {region: 0x166, script: 0x5b, flags: 0x0}, + 808: {region: 0x136, script: 0x5b, flags: 0x0}, + 809: {region: 0x166, script: 0x5b, flags: 0x0}, + 810: {region: 0x166, script: 0x5b, flags: 0x0}, + 811: {region: 0xe9, script: 0x5, flags: 0x0}, + 812: {region: 0xc4, script: 0x5b, flags: 0x0}, + 813: {region: 0x9a, script: 0x22, flags: 0x0}, + 814: {region: 0x96, script: 0x5b, flags: 0x0}, + 815: {region: 0x165, script: 0x5b, flags: 0x0}, + 816: {region: 0x166, script: 0x5b, flags: 0x0}, + 817: {region: 0xc5, script: 0x76, flags: 0x0}, + 818: {region: 0x166, script: 0x5b, flags: 0x0}, + 819: {region: 0x166, script: 0x2c, flags: 0x0}, + 820: {region: 0x107, script: 0x20, flags: 0x0}, + 821: {region: 0x166, script: 0x5b, flags: 0x0}, + 822: {region: 0x132, script: 0x5b, flags: 0x0}, + 823: {region: 0x9d, script: 0x67, flags: 0x0}, + 824: {region: 0x166, script: 0x5b, flags: 0x0}, + 825: {region: 0x166, script: 0x5b, flags: 0x0}, + 826: {region: 0x9d, script: 0x5, flags: 0x0}, + 827: {region: 0x166, script: 0x5b, flags: 0x0}, + 828: {region: 0x166, script: 0x5b, flags: 0x0}, + 829: {region: 0x166, script: 0x5b, flags: 0x0}, + 830: {region: 0xde, script: 0x5b, flags: 0x0}, + 831: {region: 0x166, script: 0x5b, flags: 0x0}, + 832: {region: 0x166, script: 0x5b, flags: 0x0}, + 834: {region: 0x166, script: 0x5b, flags: 0x0}, 835: {region: 0x53, script: 0x3b, flags: 0x0}, - 836: {region: 0x9e, script: 0x5a, flags: 0x0}, - 837: {region: 0xd2, script: 0x5a, flags: 0x0}, - 838: {region: 0x165, script: 0x5a, flags: 0x0}, - 839: {region: 0xda, script: 0x5a, flags: 0x0}, - 840: {region: 0x165, script: 0x5a, flags: 0x0}, - 841: {region: 0x165, script: 0x5a, flags: 0x0}, - 842: {region: 0x165, script: 0x5a, flags: 0x0}, - 843: {region: 0xcf, script: 0x5a, flags: 0x0}, - 844: {region: 0x165, script: 0x5a, flags: 0x0}, - 845: {region: 0x165, script: 0x5a, flags: 0x0}, - 846: {region: 0x164, script: 0x5a, flags: 0x0}, - 847: {region: 0xd1, script: 0x5a, flags: 0x0}, - 848: {region: 0x60, script: 0x5a, flags: 0x0}, - 849: {region: 0xdb, script: 0x22, flags: 0x0}, - 850: {region: 0x165, script: 0x5a, flags: 0x0}, - 851: {region: 0xdb, script: 0x22, flags: 0x0}, - 852: {region: 0x165, script: 0x5a, flags: 0x0}, - 853: {region: 0x165, script: 0x5a, flags: 0x0}, - 854: {region: 0xd2, script: 0x5a, flags: 0x0}, - 855: {region: 0x165, script: 0x5a, flags: 0x0}, - 856: {region: 0x165, script: 0x5a, flags: 0x0}, - 857: {region: 0xd1, script: 0x5a, flags: 0x0}, - 858: {region: 0x165, script: 0x5a, flags: 0x0}, - 859: {region: 0xcf, script: 0x5a, flags: 0x0}, - 860: {region: 0xcf, script: 0x5a, flags: 0x0}, - 861: {region: 0x165, script: 0x5a, flags: 0x0}, - 862: {region: 0x165, script: 0x5a, flags: 0x0}, - 863: {region: 0x95, script: 0x5a, flags: 0x0}, - 864: {region: 0x165, script: 0x5a, flags: 0x0}, - 865: {region: 0xdf, script: 0x5a, flags: 0x0}, - 866: {region: 0x165, script: 0x5a, flags: 0x0}, - 867: {region: 0x165, script: 0x5a, flags: 0x0}, - 868: {region: 0x99, script: 0x5a, flags: 0x0}, - 869: {region: 0x165, script: 0x5a, flags: 0x0}, - 870: {region: 0x165, script: 0x5a, flags: 0x0}, - 871: {region: 0xd9, script: 0x5a, flags: 0x0}, - 872: {region: 0x52, script: 0x5a, flags: 0x0}, - 873: {region: 0x165, script: 0x5a, flags: 0x0}, - 874: {region: 0xda, script: 0x5a, flags: 0x0}, - 875: {region: 0x165, script: 0x5a, flags: 0x0}, - 876: {region: 0x52, script: 0x5a, flags: 0x0}, - 877: {region: 0x165, script: 0x5a, flags: 0x0}, - 878: {region: 0x165, script: 0x5a, flags: 0x0}, - 879: {region: 0xda, script: 0x5a, flags: 0x0}, - 880: {region: 0x123, script: 0x56, flags: 0x0}, - 881: {region: 0x99, script: 0x22, flags: 0x0}, - 882: {region: 0x10c, script: 0xc9, flags: 0x0}, - 883: {region: 0x165, script: 0x5a, flags: 0x0}, - 884: {region: 0x165, script: 0x5a, flags: 0x0}, - 885: {region: 0x84, script: 0x7c, flags: 0x0}, - 886: {region: 0x161, script: 0x5a, flags: 0x0}, - 887: {region: 0x165, script: 0x5a, flags: 0x0}, + 836: {region: 0x9f, script: 0x5b, flags: 0x0}, + 837: {region: 0xd3, script: 0x5b, flags: 0x0}, + 838: {region: 0x166, script: 0x5b, flags: 0x0}, + 839: {region: 0xdb, script: 0x5b, flags: 0x0}, + 840: {region: 0x166, script: 0x5b, flags: 0x0}, + 841: {region: 0x166, script: 0x5b, flags: 0x0}, + 842: {region: 0x166, script: 0x5b, flags: 0x0}, + 843: {region: 0xd0, script: 0x5b, flags: 0x0}, + 844: {region: 0x166, script: 0x5b, flags: 0x0}, + 845: {region: 0x166, script: 0x5b, flags: 0x0}, + 846: {region: 0x165, script: 0x5b, flags: 0x0}, + 847: {region: 0xd2, script: 0x5b, flags: 0x0}, + 848: {region: 0x61, script: 0x5b, flags: 0x0}, + 849: {region: 0xdc, script: 0x22, flags: 0x0}, + 850: {region: 0x166, script: 0x5b, flags: 0x0}, + 851: {region: 0xdc, script: 0x22, flags: 0x0}, + 852: {region: 0x166, script: 0x5b, flags: 0x0}, + 853: {region: 0x166, script: 0x5b, flags: 0x0}, + 854: {region: 0xd3, script: 0x5b, flags: 0x0}, + 855: {region: 0x166, script: 0x5b, flags: 0x0}, + 856: {region: 0x166, script: 0x5b, flags: 0x0}, + 857: {region: 0xd2, script: 0x5b, flags: 0x0}, + 858: {region: 0x166, script: 0x5b, flags: 0x0}, + 859: {region: 0xd0, script: 0x5b, flags: 0x0}, + 860: {region: 0xd0, script: 0x5b, flags: 0x0}, + 861: {region: 0x166, script: 0x5b, flags: 0x0}, + 862: {region: 0x166, script: 0x5b, flags: 0x0}, + 863: {region: 0x96, script: 0x5b, flags: 0x0}, + 864: {region: 0x166, script: 0x5b, flags: 0x0}, + 865: {region: 0xe0, script: 0x5b, flags: 0x0}, + 866: {region: 0x166, script: 0x5b, flags: 0x0}, + 867: {region: 0x166, script: 0x5b, flags: 0x0}, + 868: {region: 0x9a, script: 0x5b, flags: 0x0}, + 869: {region: 0x166, script: 0x5b, flags: 0x0}, + 870: {region: 0x166, script: 0x5b, flags: 0x0}, + 871: {region: 0xda, script: 0x5b, flags: 0x0}, + 872: {region: 0x52, script: 0x5b, flags: 0x0}, + 873: {region: 0x166, script: 0x5b, flags: 0x0}, + 874: {region: 0xdb, script: 0x5b, flags: 0x0}, + 875: {region: 0x166, script: 0x5b, flags: 0x0}, + 876: {region: 0x52, script: 0x5b, flags: 0x0}, + 877: {region: 0x166, script: 0x5b, flags: 0x0}, + 878: {region: 0x166, script: 0x5b, flags: 0x0}, + 879: {region: 0xdb, script: 0x5b, flags: 0x0}, + 880: {region: 0x124, script: 0x57, flags: 0x0}, + 881: {region: 0x9a, script: 0x22, flags: 0x0}, + 882: {region: 0x10d, script: 0xcb, flags: 0x0}, + 883: {region: 0x166, script: 0x5b, flags: 0x0}, + 884: {region: 0x166, script: 0x5b, flags: 0x0}, + 885: {region: 0x85, script: 0x7e, flags: 0x0}, + 886: {region: 0x162, script: 0x5b, flags: 0x0}, + 887: {region: 0x166, script: 0x5b, flags: 0x0}, 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x5a, flags: 0x0}, - 890: {region: 0x161, script: 0x5a, flags: 0x0}, - 891: {region: 0x165, script: 0x5a, flags: 0x0}, - 892: {region: 0x165, script: 0x5a, flags: 0x0}, - 893: {region: 0x165, script: 0x5a, flags: 0x0}, - 894: {region: 0x165, script: 0x5a, flags: 0x0}, - 895: {region: 0x165, script: 0x5a, flags: 0x0}, - 896: {region: 0x117, script: 0x5a, flags: 0x0}, - 897: {region: 0x165, script: 0x5a, flags: 0x0}, - 898: {region: 0x165, script: 0x5a, flags: 0x0}, - 899: {region: 0x135, script: 0x5a, flags: 0x0}, - 900: {region: 0x165, script: 0x5a, flags: 0x0}, - 901: {region: 0x53, script: 0x5a, flags: 0x0}, - 902: {region: 0x165, script: 0x5a, flags: 0x0}, - 903: {region: 0xce, script: 0x5a, flags: 0x0}, - 904: {region: 0x12f, script: 0x5a, flags: 0x0}, - 905: {region: 0x131, script: 0x5a, flags: 0x0}, - 906: {region: 0x80, script: 0x5a, flags: 0x0}, - 907: {region: 0x78, script: 0x5a, flags: 0x0}, - 908: {region: 0x165, script: 0x5a, flags: 0x0}, - 910: {region: 0x165, script: 0x5a, flags: 0x0}, - 911: {region: 0x165, script: 0x5a, flags: 0x0}, - 912: {region: 0x6f, script: 0x5a, flags: 0x0}, - 913: {region: 0x165, script: 0x5a, flags: 0x0}, - 914: {region: 0x165, script: 0x5a, flags: 0x0}, - 915: {region: 0x165, script: 0x5a, flags: 0x0}, - 916: {region: 0x165, script: 0x5a, flags: 0x0}, - 917: {region: 0x99, script: 0x81, flags: 0x0}, - 918: {region: 0x165, script: 0x5a, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x20, flags: 0x0}, - 921: {region: 0x135, script: 0x82, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x80, flags: 0x0}, - 924: {region: 0x165, script: 0x5a, flags: 0x0}, + 889: {region: 0x166, script: 0x5b, flags: 0x0}, + 890: {region: 0x162, script: 0x5b, flags: 0x0}, + 891: {region: 0x166, script: 0x5b, flags: 0x0}, + 892: {region: 0x166, script: 0x5b, flags: 0x0}, + 893: {region: 0x166, script: 0x5b, flags: 0x0}, + 894: {region: 0x166, script: 0x5b, flags: 0x0}, + 895: {region: 0x166, script: 0x5b, flags: 0x0}, + 896: {region: 0x118, script: 0x5b, flags: 0x0}, + 897: {region: 0x166, script: 0x5b, flags: 0x0}, + 898: {region: 0x166, script: 0x5b, flags: 0x0}, + 899: {region: 0x136, script: 0x5b, flags: 0x0}, + 900: {region: 0x166, script: 0x5b, flags: 0x0}, + 901: {region: 0x53, script: 0x5b, flags: 0x0}, + 902: {region: 0x166, script: 0x5b, flags: 0x0}, + 903: {region: 0xcf, script: 0x5b, flags: 0x0}, + 904: {region: 0x130, script: 0x5b, flags: 0x0}, + 905: {region: 0x132, script: 0x5b, flags: 0x0}, + 906: {region: 0x81, script: 0x5b, flags: 0x0}, + 907: {region: 0x79, script: 0x5b, flags: 0x0}, + 908: {region: 0x166, script: 0x5b, flags: 0x0}, + 910: {region: 0x166, script: 0x5b, flags: 0x0}, + 911: {region: 0x166, script: 0x5b, flags: 0x0}, + 912: {region: 0x70, script: 0x5b, flags: 0x0}, + 913: {region: 0x166, script: 0x5b, flags: 0x0}, + 914: {region: 0x166, script: 0x5b, flags: 0x0}, + 915: {region: 0x166, script: 0x5b, flags: 0x0}, + 916: {region: 0x166, script: 0x5b, flags: 0x0}, + 917: {region: 0x9a, script: 0x83, flags: 0x0}, + 918: {region: 0x166, script: 0x5b, flags: 0x0}, + 919: {region: 0x166, script: 0x5, flags: 0x0}, + 920: {region: 0x7e, script: 0x20, flags: 0x0}, + 921: {region: 0x136, script: 0x84, flags: 0x0}, + 922: {region: 0x166, script: 0x5, flags: 0x0}, + 923: {region: 0xc6, script: 0x82, flags: 0x0}, + 924: {region: 0x166, script: 0x5b, flags: 0x0}, 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x5a, flags: 0x0}, + 926: {region: 0xe8, script: 0x5b, flags: 0x0}, 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x5a, flags: 0x0}, - 929: {region: 0x30, script: 0x5a, flags: 0x0}, - 930: {region: 0xf0, script: 0x5a, flags: 0x0}, - 931: {region: 0x165, script: 0x5a, flags: 0x0}, - 932: {region: 0x78, script: 0x5a, flags: 0x0}, - 933: {region: 0xd6, script: 0x5a, flags: 0x0}, - 934: {region: 0x135, script: 0x5a, flags: 0x0}, - 935: {region: 0x49, script: 0x5a, flags: 0x0}, - 936: {region: 0x165, script: 0x5a, flags: 0x0}, - 937: {region: 0x9c, script: 0xf7, flags: 0x0}, - 938: {region: 0x165, script: 0x5a, flags: 0x0}, - 939: {region: 0x60, script: 0x5a, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x8e, flags: 0x0}, - 943: {region: 0x165, script: 0x5a, flags: 0x0}, - 944: {region: 0x165, script: 0x5a, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x5a, flags: 0x0}, - 947: {region: 0xe9, script: 0x5a, flags: 0x0}, - 948: {region: 0x165, script: 0x5a, flags: 0x0}, - 949: {region: 0x9e, script: 0x5a, flags: 0x0}, - 950: {region: 0x165, script: 0x5a, flags: 0x0}, - 951: {region: 0x165, script: 0x5a, flags: 0x0}, - 952: {region: 0x87, script: 0x34, flags: 0x0}, - 953: {region: 0x75, script: 0x5a, flags: 0x0}, - 954: {region: 0x165, script: 0x5a, flags: 0x0}, - 955: {region: 0xe8, script: 0x4d, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x5a, flags: 0x0}, + 928: {region: 0xe8, script: 0x5b, flags: 0x0}, + 929: {region: 0x30, script: 0x5b, flags: 0x0}, + 930: {region: 0xf1, script: 0x5b, flags: 0x0}, + 931: {region: 0x166, script: 0x5b, flags: 0x0}, + 932: {region: 0x79, script: 0x5b, flags: 0x0}, + 933: {region: 0xd7, script: 0x5b, flags: 0x0}, + 934: {region: 0x136, script: 0x5b, flags: 0x0}, + 935: {region: 0x49, script: 0x5b, flags: 0x0}, + 936: {region: 0x166, script: 0x5b, flags: 0x0}, + 937: {region: 0x9d, script: 0xfa, flags: 0x0}, + 938: {region: 0x166, script: 0x5b, flags: 0x0}, + 939: {region: 0x61, script: 0x5b, flags: 0x0}, + 940: {region: 0x166, script: 0x5, flags: 0x0}, + 941: {region: 0xb1, script: 0x90, flags: 0x0}, + 943: {region: 0x166, script: 0x5b, flags: 0x0}, + 944: {region: 0x166, script: 0x5b, flags: 0x0}, + 945: {region: 0x9a, script: 0x12, flags: 0x0}, + 946: {region: 0xa5, script: 0x5b, flags: 0x0}, + 947: {region: 0xea, script: 0x5b, flags: 0x0}, + 948: {region: 0x166, script: 0x5b, flags: 0x0}, + 949: {region: 0x9f, script: 0x5b, flags: 0x0}, + 950: {region: 0x166, script: 0x5b, flags: 0x0}, + 951: {region: 0x166, script: 0x5b, flags: 0x0}, + 952: {region: 0x88, script: 0x34, flags: 0x0}, + 953: {region: 0x76, script: 0x5b, flags: 0x0}, + 954: {region: 0x166, script: 0x5b, flags: 0x0}, + 955: {region: 0xe9, script: 0x4e, flags: 0x0}, + 956: {region: 0x9d, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x5b, flags: 0x0}, 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x5a, flags: 0x0}, - 960: {region: 0x41, script: 0x5a, flags: 0x0}, - 961: {region: 0x165, script: 0x5a, flags: 0x0}, - 962: {region: 0x7a, script: 0x5a, flags: 0x0}, - 963: {region: 0x165, script: 0x5a, flags: 0x0}, - 964: {region: 0xe4, script: 0x5a, flags: 0x0}, - 965: {region: 0x89, script: 0x5a, flags: 0x0}, - 966: {region: 0x69, script: 0x5a, flags: 0x0}, - 967: {region: 0x165, script: 0x5a, flags: 0x0}, - 968: {region: 0x99, script: 0x22, flags: 0x0}, - 969: {region: 0x165, script: 0x5a, flags: 0x0}, - 970: {region: 0x102, script: 0x5a, flags: 0x0}, - 971: {region: 0x95, script: 0x5a, flags: 0x0}, - 972: {region: 0x165, script: 0x5a, flags: 0x0}, - 973: {region: 0x165, script: 0x5a, flags: 0x0}, - 974: {region: 0x9e, script: 0x5a, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x5a, flags: 0x0}, + 959: {region: 0x166, script: 0x5b, flags: 0x0}, + 960: {region: 0x41, script: 0x5b, flags: 0x0}, + 961: {region: 0x166, script: 0x5b, flags: 0x0}, + 962: {region: 0x7b, script: 0x5b, flags: 0x0}, + 963: {region: 0x166, script: 0x5b, flags: 0x0}, + 964: {region: 0xe5, script: 0x5b, flags: 0x0}, + 965: {region: 0x8a, script: 0x5b, flags: 0x0}, + 966: {region: 0x6a, script: 0x5b, flags: 0x0}, + 967: {region: 0x166, script: 0x5b, flags: 0x0}, + 968: {region: 0x9a, script: 0x22, flags: 0x0}, + 969: {region: 0x166, script: 0x5b, flags: 0x0}, + 970: {region: 0x103, script: 0x5b, flags: 0x0}, + 971: {region: 0x96, script: 0x5b, flags: 0x0}, + 972: {region: 0x166, script: 0x5b, flags: 0x0}, + 973: {region: 0x166, script: 0x5b, flags: 0x0}, + 974: {region: 0x9f, script: 0x5b, flags: 0x0}, + 975: {region: 0x166, script: 0x5, flags: 0x0}, + 976: {region: 0x9a, script: 0x5b, flags: 0x0}, 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x22, flags: 0x0}, + 978: {region: 0xdc, script: 0x22, flags: 0x0}, 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x5a, flags: 0x0}, - 981: {region: 0x72, script: 0x5a, flags: 0x0}, - 982: {region: 0x4e, script: 0x5a, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x5a, flags: 0x0}, - 985: {region: 0x3a, script: 0x5a, flags: 0x0}, - 986: {region: 0x165, script: 0x5a, flags: 0x0}, - 987: {region: 0xd1, script: 0x5a, flags: 0x0}, - 988: {region: 0x104, script: 0x5a, flags: 0x0}, - 989: {region: 0x95, script: 0x5a, flags: 0x0}, - 990: {region: 0x12f, script: 0x5a, flags: 0x0}, - 991: {region: 0x165, script: 0x5a, flags: 0x0}, - 992: {region: 0x165, script: 0x5a, flags: 0x0}, - 993: {region: 0x73, script: 0x5a, flags: 0x0}, - 994: {region: 0x106, script: 0x20, flags: 0x0}, - 995: {region: 0x130, script: 0x20, flags: 0x0}, - 996: {region: 0x109, script: 0x5a, flags: 0x0}, - 997: {region: 0x107, script: 0x5a, flags: 0x0}, - 998: {region: 0x12f, script: 0x5a, flags: 0x0}, - 999: {region: 0x165, script: 0x5a, flags: 0x0}, - 1000: {region: 0xa2, script: 0x4c, flags: 0x0}, - 1001: {region: 0x99, script: 0x22, flags: 0x0}, - 1002: {region: 0x80, script: 0x5a, flags: 0x0}, - 1003: {region: 0x106, script: 0x20, flags: 0x0}, - 1004: {region: 0xa4, script: 0x5a, flags: 0x0}, - 1005: {region: 0x95, script: 0x5a, flags: 0x0}, - 1006: {region: 0x99, script: 0x5a, flags: 0x0}, - 1007: {region: 0x114, script: 0x5a, flags: 0x0}, - 1008: {region: 0x99, script: 0xcd, flags: 0x0}, - 1009: {region: 0x165, script: 0x5a, flags: 0x0}, - 1010: {region: 0x165, script: 0x5a, flags: 0x0}, - 1011: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1012: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1013: {region: 0x99, script: 0x22, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1016: {region: 0x7b, script: 0x5a, flags: 0x0}, - 1017: {region: 0x49, script: 0x5a, flags: 0x0}, + 980: {region: 0x4e, script: 0x5b, flags: 0x0}, + 981: {region: 0x73, script: 0x5b, flags: 0x0}, + 982: {region: 0x4e, script: 0x5b, flags: 0x0}, + 983: {region: 0x9d, script: 0x5, flags: 0x0}, + 984: {region: 0x10d, script: 0x5b, flags: 0x0}, + 985: {region: 0x3a, script: 0x5b, flags: 0x0}, + 986: {region: 0x166, script: 0x5b, flags: 0x0}, + 987: {region: 0xd2, script: 0x5b, flags: 0x0}, + 988: {region: 0x105, script: 0x5b, flags: 0x0}, + 989: {region: 0x96, script: 0x5b, flags: 0x0}, + 990: {region: 0x130, script: 0x5b, flags: 0x0}, + 991: {region: 0x166, script: 0x5b, flags: 0x0}, + 992: {region: 0x166, script: 0x5b, flags: 0x0}, + 993: {region: 0x74, script: 0x5b, flags: 0x0}, + 994: {region: 0x107, script: 0x20, flags: 0x0}, + 995: {region: 0x131, script: 0x20, flags: 0x0}, + 996: {region: 0x10a, script: 0x5b, flags: 0x0}, + 997: {region: 0x108, script: 0x5b, flags: 0x0}, + 998: {region: 0x130, script: 0x5b, flags: 0x0}, + 999: {region: 0x166, script: 0x5b, flags: 0x0}, + 1000: {region: 0xa3, script: 0x4c, flags: 0x0}, + 1001: {region: 0x9a, script: 0x22, flags: 0x0}, + 1002: {region: 0x81, script: 0x5b, flags: 0x0}, + 1003: {region: 0x107, script: 0x20, flags: 0x0}, + 1004: {region: 0xa5, script: 0x5b, flags: 0x0}, + 1005: {region: 0x96, script: 0x5b, flags: 0x0}, + 1006: {region: 0x9a, script: 0x5b, flags: 0x0}, + 1007: {region: 0x115, script: 0x5b, flags: 0x0}, + 1008: {region: 0x9a, script: 0xcf, flags: 0x0}, + 1009: {region: 0x166, script: 0x5b, flags: 0x0}, + 1010: {region: 0x166, script: 0x5b, flags: 0x0}, + 1011: {region: 0x130, script: 0x5b, flags: 0x0}, + 1012: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1013: {region: 0x9a, script: 0x22, flags: 0x0}, + 1014: {region: 0x166, script: 0x5, flags: 0x0}, + 1015: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1016: {region: 0x7c, script: 0x5b, flags: 0x0}, + 1017: {region: 0x49, script: 0x5b, flags: 0x0}, 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x5a, flags: 0x0}, - 1022: {region: 0x4f, script: 0x5a, flags: 0x0}, - 1023: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1024: {region: 0xcf, script: 0x5a, flags: 0x0}, - 1025: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1026: {region: 0x4c, script: 0x5a, flags: 0x0}, - 1027: {region: 0x96, script: 0x7e, flags: 0x0}, - 1028: {region: 0xb6, script: 0x5a, flags: 0x0}, - 1029: {region: 0x165, script: 0x2c, flags: 0x0}, - 1030: {region: 0x165, script: 0x5a, flags: 0x0}, - 1032: {region: 0xba, script: 0xe8, flags: 0x0}, - 1033: {region: 0x165, script: 0x5a, flags: 0x0}, - 1034: {region: 0xc4, script: 0x75, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xd4, flags: 0x0}, - 1037: {region: 0x6f, script: 0x5a, flags: 0x0}, - 1038: {region: 0x165, script: 0x5a, flags: 0x0}, - 1039: {region: 0x165, script: 0x5a, flags: 0x0}, - 1040: {region: 0x165, script: 0x5a, flags: 0x0}, - 1041: {region: 0x165, script: 0x5a, flags: 0x0}, - 1042: {region: 0x111, script: 0x5a, flags: 0x0}, - 1043: {region: 0x165, script: 0x5a, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x5a, flags: 0x0}, - 1046: {region: 0x10f, script: 0x5a, flags: 0x0}, - 1047: {region: 0x165, script: 0x5a, flags: 0x0}, - 1048: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1049: {region: 0x165, script: 0x5a, flags: 0x0}, - 1050: {region: 0x95, script: 0x5a, flags: 0x0}, - 1051: {region: 0x142, script: 0x5a, flags: 0x0}, - 1052: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1054: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1055: {region: 0x72, script: 0x5a, flags: 0x0}, - 1056: {region: 0x97, script: 0xca, flags: 0x0}, - 1057: {region: 0x165, script: 0x5a, flags: 0x0}, - 1058: {region: 0x72, script: 0x5a, flags: 0x0}, - 1059: {region: 0x164, script: 0x5a, flags: 0x0}, - 1060: {region: 0x165, script: 0x5a, flags: 0x0}, - 1061: {region: 0xc3, script: 0x5a, flags: 0x0}, - 1062: {region: 0x165, script: 0x5a, flags: 0x0}, - 1063: {region: 0x165, script: 0x5a, flags: 0x0}, - 1064: {region: 0x165, script: 0x5a, flags: 0x0}, - 1065: {region: 0x115, script: 0x5a, flags: 0x0}, - 1066: {region: 0x165, script: 0x5a, flags: 0x0}, - 1067: {region: 0x165, script: 0x5a, flags: 0x0}, - 1068: {region: 0x123, script: 0xeb, flags: 0x0}, - 1069: {region: 0x165, script: 0x5a, flags: 0x0}, - 1070: {region: 0x165, script: 0x5a, flags: 0x0}, - 1071: {region: 0x165, script: 0x5a, flags: 0x0}, - 1072: {region: 0x165, script: 0x5a, flags: 0x0}, - 1073: {region: 0x27, script: 0x5a, flags: 0x0}, + 1019: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1020: {region: 0x9d, script: 0x5, flags: 0x0}, + 1021: {region: 0xdb, script: 0x5b, flags: 0x0}, + 1022: {region: 0x4f, script: 0x5b, flags: 0x0}, + 1023: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1024: {region: 0xd0, script: 0x5b, flags: 0x0}, + 1025: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1026: {region: 0x4c, script: 0x5b, flags: 0x0}, + 1027: {region: 0x97, script: 0x80, flags: 0x0}, + 1028: {region: 0xb7, script: 0x5b, flags: 0x0}, + 1029: {region: 0x166, script: 0x2c, flags: 0x0}, + 1030: {region: 0x166, script: 0x5b, flags: 0x0}, + 1032: {region: 0xbb, script: 0xeb, flags: 0x0}, + 1033: {region: 0x166, script: 0x5b, flags: 0x0}, + 1034: {region: 0xc5, script: 0x76, flags: 0x0}, + 1035: {region: 0x166, script: 0x5, flags: 0x0}, + 1036: {region: 0xb4, script: 0xd6, flags: 0x0}, + 1037: {region: 0x70, script: 0x5b, flags: 0x0}, + 1038: {region: 0x166, script: 0x5b, flags: 0x0}, + 1039: {region: 0x166, script: 0x5b, flags: 0x0}, + 1040: {region: 0x166, script: 0x5b, flags: 0x0}, + 1041: {region: 0x166, script: 0x5b, flags: 0x0}, + 1042: {region: 0x112, script: 0x5b, flags: 0x0}, + 1043: {region: 0x166, script: 0x5b, flags: 0x0}, + 1044: {region: 0xe9, script: 0x5, flags: 0x0}, + 1045: {region: 0x166, script: 0x5b, flags: 0x0}, + 1046: {region: 0x110, script: 0x5b, flags: 0x0}, + 1047: {region: 0x166, script: 0x5b, flags: 0x0}, + 1048: {region: 0xea, script: 0x5b, flags: 0x0}, + 1049: {region: 0x166, script: 0x5b, flags: 0x0}, + 1050: {region: 0x96, script: 0x5b, flags: 0x0}, + 1051: {region: 0x143, script: 0x5b, flags: 0x0}, + 1052: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1054: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1055: {region: 0x73, script: 0x5b, flags: 0x0}, + 1056: {region: 0x98, script: 0xcc, flags: 0x0}, + 1057: {region: 0x166, script: 0x5b, flags: 0x0}, + 1058: {region: 0x73, script: 0x5b, flags: 0x0}, + 1059: {region: 0x165, script: 0x5b, flags: 0x0}, + 1060: {region: 0x166, script: 0x5b, flags: 0x0}, + 1061: {region: 0xc4, script: 0x5b, flags: 0x0}, + 1062: {region: 0x166, script: 0x5b, flags: 0x0}, + 1063: {region: 0x166, script: 0x5b, flags: 0x0}, + 1064: {region: 0x166, script: 0x5b, flags: 0x0}, + 1065: {region: 0x116, script: 0x5b, flags: 0x0}, + 1066: {region: 0x166, script: 0x5b, flags: 0x0}, + 1067: {region: 0x166, script: 0x5b, flags: 0x0}, + 1068: {region: 0x124, script: 0xee, flags: 0x0}, + 1069: {region: 0x166, script: 0x5b, flags: 0x0}, + 1070: {region: 0x166, script: 0x5b, flags: 0x0}, + 1071: {region: 0x166, script: 0x5b, flags: 0x0}, + 1072: {region: 0x166, script: 0x5b, flags: 0x0}, + 1073: {region: 0x27, script: 0x5b, flags: 0x0}, 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xd7, flags: 0x0}, - 1076: {region: 0x116, script: 0x5a, flags: 0x0}, - 1077: {region: 0x114, script: 0x5a, flags: 0x0}, - 1078: {region: 0x99, script: 0x22, flags: 0x0}, - 1079: {region: 0x161, script: 0x5a, flags: 0x0}, - 1080: {region: 0x165, script: 0x5a, flags: 0x0}, - 1081: {region: 0x165, script: 0x5a, flags: 0x0}, - 1082: {region: 0x6d, script: 0x5a, flags: 0x0}, - 1083: {region: 0x161, script: 0x5a, flags: 0x0}, - 1084: {region: 0x165, script: 0x5a, flags: 0x0}, - 1085: {region: 0x60, script: 0x5a, flags: 0x0}, - 1086: {region: 0x95, script: 0x5a, flags: 0x0}, - 1087: {region: 0x165, script: 0x5a, flags: 0x0}, - 1088: {region: 0x165, script: 0x5a, flags: 0x0}, - 1089: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1090: {region: 0x165, script: 0x5a, flags: 0x0}, - 1091: {region: 0x84, script: 0x5a, flags: 0x0}, - 1092: {region: 0x10c, script: 0x5a, flags: 0x0}, - 1093: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x5a, flags: 0x0}, - 1096: {region: 0x60, script: 0x5a, flags: 0x0}, - 1097: {region: 0x165, script: 0x5a, flags: 0x0}, - 1098: {region: 0x99, script: 0x22, flags: 0x0}, - 1099: {region: 0x95, script: 0x5a, flags: 0x0}, - 1100: {region: 0x165, script: 0x5a, flags: 0x0}, + 1075: {region: 0x9a, script: 0xd9, flags: 0x0}, + 1076: {region: 0x117, script: 0x5b, flags: 0x0}, + 1077: {region: 0x115, script: 0x5b, flags: 0x0}, + 1078: {region: 0x9a, script: 0x22, flags: 0x0}, + 1079: {region: 0x162, script: 0x5b, flags: 0x0}, + 1080: {region: 0x166, script: 0x5b, flags: 0x0}, + 1081: {region: 0x166, script: 0x5b, flags: 0x0}, + 1082: {region: 0x6e, script: 0x5b, flags: 0x0}, + 1083: {region: 0x162, script: 0x5b, flags: 0x0}, + 1084: {region: 0x166, script: 0x5b, flags: 0x0}, + 1085: {region: 0x61, script: 0x5b, flags: 0x0}, + 1086: {region: 0x96, script: 0x5b, flags: 0x0}, + 1087: {region: 0x166, script: 0x5b, flags: 0x0}, + 1088: {region: 0x166, script: 0x5b, flags: 0x0}, + 1089: {region: 0x130, script: 0x5b, flags: 0x0}, + 1090: {region: 0x166, script: 0x5b, flags: 0x0}, + 1091: {region: 0x85, script: 0x5b, flags: 0x0}, + 1092: {region: 0x10d, script: 0x5b, flags: 0x0}, + 1093: {region: 0x130, script: 0x5b, flags: 0x0}, + 1094: {region: 0x160, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x5b, flags: 0x0}, + 1096: {region: 0x61, script: 0x5b, flags: 0x0}, + 1097: {region: 0x166, script: 0x5b, flags: 0x0}, + 1098: {region: 0x9a, script: 0x22, flags: 0x0}, + 1099: {region: 0x96, script: 0x5b, flags: 0x0}, + 1100: {region: 0x166, script: 0x5b, flags: 0x0}, 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xdb, flags: 0x0}, - 1103: {region: 0xe9, script: 0x5a, flags: 0x0}, - 1104: {region: 0x99, script: 0xe3, flags: 0x0}, - 1105: {region: 0xdb, script: 0x22, flags: 0x0}, - 1106: {region: 0x165, script: 0x5a, flags: 0x0}, - 1107: {region: 0x165, script: 0x5a, flags: 0x0}, - 1108: {region: 0x165, script: 0x5a, flags: 0x0}, - 1109: {region: 0x165, script: 0x5a, flags: 0x0}, - 1110: {region: 0x165, script: 0x5a, flags: 0x0}, - 1111: {region: 0x165, script: 0x5a, flags: 0x0}, - 1112: {region: 0x165, script: 0x5a, flags: 0x0}, - 1113: {region: 0x165, script: 0x5a, flags: 0x0}, - 1114: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1115: {region: 0x165, script: 0x5a, flags: 0x0}, - 1116: {region: 0x165, script: 0x5a, flags: 0x0}, - 1117: {region: 0x99, script: 0x52, flags: 0x0}, - 1118: {region: 0x53, script: 0xe1, flags: 0x0}, - 1119: {region: 0xdb, script: 0x22, flags: 0x0}, - 1120: {region: 0xdb, script: 0x22, flags: 0x0}, - 1121: {region: 0x99, script: 0xe6, flags: 0x0}, - 1122: {region: 0x165, script: 0x5a, flags: 0x0}, - 1123: {region: 0x112, script: 0x5a, flags: 0x0}, - 1124: {region: 0x131, script: 0x5a, flags: 0x0}, - 1125: {region: 0x126, script: 0x5a, flags: 0x0}, - 1126: {region: 0x165, script: 0x5a, flags: 0x0}, + 1102: {region: 0x9c, script: 0xde, flags: 0x0}, + 1103: {region: 0xea, script: 0x5b, flags: 0x0}, + 1104: {region: 0x9a, script: 0xe6, flags: 0x0}, + 1105: {region: 0xdc, script: 0x22, flags: 0x0}, + 1106: {region: 0x166, script: 0x5b, flags: 0x0}, + 1107: {region: 0x166, script: 0x5b, flags: 0x0}, + 1108: {region: 0x166, script: 0x5b, flags: 0x0}, + 1109: {region: 0x166, script: 0x5b, flags: 0x0}, + 1110: {region: 0x166, script: 0x5b, flags: 0x0}, + 1111: {region: 0x166, script: 0x5b, flags: 0x0}, + 1112: {region: 0x166, script: 0x5b, flags: 0x0}, + 1113: {region: 0x166, script: 0x5b, flags: 0x0}, + 1114: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1115: {region: 0x166, script: 0x5b, flags: 0x0}, + 1116: {region: 0x166, script: 0x5b, flags: 0x0}, + 1117: {region: 0x9a, script: 0x53, flags: 0x0}, + 1118: {region: 0x53, script: 0xe4, flags: 0x0}, + 1119: {region: 0xdc, script: 0x22, flags: 0x0}, + 1120: {region: 0xdc, script: 0x22, flags: 0x0}, + 1121: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1122: {region: 0x166, script: 0x5b, flags: 0x0}, + 1123: {region: 0x113, script: 0x5b, flags: 0x0}, + 1124: {region: 0x132, script: 0x5b, flags: 0x0}, + 1125: {region: 0x127, script: 0x5b, flags: 0x0}, + 1126: {region: 0x166, script: 0x5b, flags: 0x0}, 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x5a, flags: 0x0}, - 1129: {region: 0x165, script: 0x5a, flags: 0x0}, - 1130: {region: 0x165, script: 0x5a, flags: 0x0}, - 1131: {region: 0x123, script: 0xeb, flags: 0x0}, - 1132: {region: 0xdb, script: 0x22, flags: 0x0}, - 1133: {region: 0xdb, script: 0x22, flags: 0x0}, - 1134: {region: 0xdb, script: 0x22, flags: 0x0}, - 1135: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1136: {region: 0x165, script: 0x5a, flags: 0x0}, - 1137: {region: 0x6d, script: 0x2c, flags: 0x0}, - 1138: {region: 0x165, script: 0x5a, flags: 0x0}, - 1139: {region: 0x165, script: 0x5a, flags: 0x0}, - 1140: {region: 0x165, script: 0x5a, flags: 0x0}, - 1141: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1142: {region: 0x127, script: 0x5a, flags: 0x0}, - 1143: {region: 0x125, script: 0x5a, flags: 0x0}, - 1144: {region: 0x32, script: 0x5a, flags: 0x0}, - 1145: {region: 0xdb, script: 0x22, flags: 0x0}, - 1146: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1147: {region: 0x165, script: 0x5a, flags: 0x0}, - 1148: {region: 0x165, script: 0x5a, flags: 0x0}, - 1149: {region: 0x32, script: 0x5a, flags: 0x0}, - 1150: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1151: {region: 0x165, script: 0x5a, flags: 0x0}, - 1152: {region: 0x161, script: 0x5a, flags: 0x0}, - 1153: {region: 0x165, script: 0x5a, flags: 0x0}, - 1154: {region: 0x129, script: 0x5a, flags: 0x0}, - 1155: {region: 0x165, script: 0x5a, flags: 0x0}, - 1156: {region: 0xce, script: 0x5a, flags: 0x0}, - 1157: {region: 0x165, script: 0x5a, flags: 0x0}, - 1158: {region: 0xe6, script: 0x5a, flags: 0x0}, - 1159: {region: 0x165, script: 0x5a, flags: 0x0}, - 1160: {region: 0x165, script: 0x5a, flags: 0x0}, - 1161: {region: 0x165, script: 0x5a, flags: 0x0}, - 1162: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1163: {region: 0x12b, script: 0x5a, flags: 0x0}, - 1164: {region: 0x12e, script: 0x5a, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x5a, flags: 0x0}, - 1167: {region: 0x87, script: 0x34, flags: 0x0}, - 1168: {region: 0xdb, script: 0x22, flags: 0x0}, - 1169: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1170: {region: 0x43, script: 0xec, flags: 0x0}, - 1171: {region: 0x165, script: 0x5a, flags: 0x0}, - 1172: {region: 0x106, script: 0x20, flags: 0x0}, - 1173: {region: 0x165, script: 0x5a, flags: 0x0}, - 1174: {region: 0x165, script: 0x5a, flags: 0x0}, - 1175: {region: 0x131, script: 0x5a, flags: 0x0}, - 1176: {region: 0x165, script: 0x5a, flags: 0x0}, - 1177: {region: 0x123, script: 0xeb, flags: 0x0}, - 1178: {region: 0x32, script: 0x5a, flags: 0x0}, - 1179: {region: 0x165, script: 0x5a, flags: 0x0}, - 1180: {region: 0x165, script: 0x5a, flags: 0x0}, - 1181: {region: 0xce, script: 0x5a, flags: 0x0}, - 1182: {region: 0x165, script: 0x5a, flags: 0x0}, - 1183: {region: 0x165, script: 0x5a, flags: 0x0}, - 1184: {region: 0x12d, script: 0x5a, flags: 0x0}, - 1185: {region: 0x165, script: 0x5a, flags: 0x0}, - 1187: {region: 0x165, script: 0x5a, flags: 0x0}, - 1188: {region: 0xd4, script: 0x5a, flags: 0x0}, - 1189: {region: 0x53, script: 0xe4, flags: 0x0}, - 1190: {region: 0xe5, script: 0x5a, flags: 0x0}, - 1191: {region: 0x165, script: 0x5a, flags: 0x0}, - 1192: {region: 0x106, script: 0x20, flags: 0x0}, - 1193: {region: 0xba, script: 0x5a, flags: 0x0}, - 1194: {region: 0x165, script: 0x5a, flags: 0x0}, - 1195: {region: 0x106, script: 0x20, flags: 0x0}, + 1128: {region: 0x166, script: 0x5b, flags: 0x0}, + 1129: {region: 0x166, script: 0x5b, flags: 0x0}, + 1130: {region: 0x166, script: 0x5b, flags: 0x0}, + 1131: {region: 0x124, script: 0xee, flags: 0x0}, + 1132: {region: 0xdc, script: 0x22, flags: 0x0}, + 1133: {region: 0xdc, script: 0x22, flags: 0x0}, + 1134: {region: 0xdc, script: 0x22, flags: 0x0}, + 1135: {region: 0x70, script: 0x2c, flags: 0x0}, + 1136: {region: 0x166, script: 0x5b, flags: 0x0}, + 1137: {region: 0x6e, script: 0x2c, flags: 0x0}, + 1138: {region: 0x166, script: 0x5b, flags: 0x0}, + 1139: {region: 0x166, script: 0x5b, flags: 0x0}, + 1140: {region: 0x166, script: 0x5b, flags: 0x0}, + 1141: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1142: {region: 0x128, script: 0x5b, flags: 0x0}, + 1143: {region: 0x126, script: 0x5b, flags: 0x0}, + 1144: {region: 0x32, script: 0x5b, flags: 0x0}, + 1145: {region: 0xdc, script: 0x22, flags: 0x0}, + 1146: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1147: {region: 0x166, script: 0x5b, flags: 0x0}, + 1148: {region: 0x166, script: 0x5b, flags: 0x0}, + 1149: {region: 0x32, script: 0x5b, flags: 0x0}, + 1150: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1151: {region: 0x166, script: 0x5b, flags: 0x0}, + 1152: {region: 0x162, script: 0x5b, flags: 0x0}, + 1153: {region: 0x166, script: 0x5b, flags: 0x0}, + 1154: {region: 0x12a, script: 0x5b, flags: 0x0}, + 1155: {region: 0x166, script: 0x5b, flags: 0x0}, + 1156: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1157: {region: 0x166, script: 0x5b, flags: 0x0}, + 1158: {region: 0xe7, script: 0x5b, flags: 0x0}, + 1159: {region: 0x166, script: 0x5b, flags: 0x0}, + 1160: {region: 0x166, script: 0x5b, flags: 0x0}, + 1161: {region: 0x166, script: 0x5b, flags: 0x0}, + 1162: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1163: {region: 0x12c, script: 0x5b, flags: 0x0}, + 1164: {region: 0x12f, script: 0x5b, flags: 0x0}, + 1165: {region: 0x166, script: 0x5, flags: 0x0}, + 1166: {region: 0x162, script: 0x5b, flags: 0x0}, + 1167: {region: 0x88, script: 0x34, flags: 0x0}, + 1168: {region: 0xdc, script: 0x22, flags: 0x0}, + 1169: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1170: {region: 0x43, script: 0xef, flags: 0x0}, + 1171: {region: 0x166, script: 0x5b, flags: 0x0}, + 1172: {region: 0x107, script: 0x20, flags: 0x0}, + 1173: {region: 0x166, script: 0x5b, flags: 0x0}, + 1174: {region: 0x166, script: 0x5b, flags: 0x0}, + 1175: {region: 0x132, script: 0x5b, flags: 0x0}, + 1176: {region: 0x166, script: 0x5b, flags: 0x0}, + 1177: {region: 0x124, script: 0xee, flags: 0x0}, + 1178: {region: 0x32, script: 0x5b, flags: 0x0}, + 1179: {region: 0x166, script: 0x5b, flags: 0x0}, + 1180: {region: 0x166, script: 0x5b, flags: 0x0}, + 1181: {region: 0xcf, script: 0x5b, flags: 0x0}, + 1182: {region: 0x166, script: 0x5b, flags: 0x0}, + 1183: {region: 0x166, script: 0x5b, flags: 0x0}, + 1184: {region: 0x12e, script: 0x5b, flags: 0x0}, + 1185: {region: 0x166, script: 0x5b, flags: 0x0}, + 1187: {region: 0x166, script: 0x5b, flags: 0x0}, + 1188: {region: 0xd5, script: 0x5b, flags: 0x0}, + 1189: {region: 0x53, script: 0xe7, flags: 0x0}, + 1190: {region: 0xe6, script: 0x5b, flags: 0x0}, + 1191: {region: 0x166, script: 0x5b, flags: 0x0}, + 1192: {region: 0x107, script: 0x20, flags: 0x0}, + 1193: {region: 0xbb, script: 0x5b, flags: 0x0}, + 1194: {region: 0x166, script: 0x5b, flags: 0x0}, + 1195: {region: 0x107, script: 0x20, flags: 0x0}, 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xf0, flags: 0x0}, - 1198: {region: 0x130, script: 0x20, flags: 0x0}, - 1199: {region: 0x75, script: 0x5a, flags: 0x0}, - 1200: {region: 0x2a, script: 0x5a, flags: 0x0}, + 1197: {region: 0x11d, script: 0xf3, flags: 0x0}, + 1198: {region: 0x131, script: 0x20, flags: 0x0}, + 1199: {region: 0x76, script: 0x5b, flags: 0x0}, + 1200: {region: 0x2a, script: 0x5b, flags: 0x0}, 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x5a, flags: 0x0}, - 1206: {region: 0x165, script: 0x5a, flags: 0x0}, - 1207: {region: 0x165, script: 0x5a, flags: 0x0}, - 1208: {region: 0x165, script: 0x5a, flags: 0x0}, - 1209: {region: 0x165, script: 0x5a, flags: 0x0}, - 1210: {region: 0x165, script: 0x5a, flags: 0x0}, - 1211: {region: 0x165, script: 0x5a, flags: 0x0}, + 1203: {region: 0x9a, script: 0xe, flags: 0x0}, + 1204: {region: 0xe9, script: 0x5, flags: 0x0}, + 1205: {region: 0x166, script: 0x5b, flags: 0x0}, + 1206: {region: 0x166, script: 0x5b, flags: 0x0}, + 1207: {region: 0x166, script: 0x5b, flags: 0x0}, + 1208: {region: 0x166, script: 0x5b, flags: 0x0}, + 1209: {region: 0x166, script: 0x5b, flags: 0x0}, + 1210: {region: 0x166, script: 0x5b, flags: 0x0}, + 1211: {region: 0x166, script: 0x5b, flags: 0x0}, 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x5a, flags: 0x0}, - 1214: {region: 0xb4, script: 0xf1, flags: 0x0}, - 1215: {region: 0x165, script: 0x5a, flags: 0x0}, - 1216: {region: 0x161, script: 0x5a, flags: 0x0}, - 1217: {region: 0x9e, script: 0x5a, flags: 0x0}, - 1218: {region: 0x106, script: 0x5a, flags: 0x0}, - 1219: {region: 0x13e, script: 0x5a, flags: 0x0}, - 1220: {region: 0x11b, script: 0x5a, flags: 0x0}, - 1221: {region: 0x165, script: 0x5a, flags: 0x0}, - 1222: {region: 0x36, script: 0x5a, flags: 0x0}, - 1223: {region: 0x60, script: 0x5a, flags: 0x0}, - 1224: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1225: {region: 0x1, script: 0x5a, flags: 0x0}, - 1226: {region: 0x106, script: 0x5a, flags: 0x0}, - 1227: {region: 0x6a, script: 0x5a, flags: 0x0}, - 1228: {region: 0x12f, script: 0x5a, flags: 0x0}, - 1229: {region: 0x165, script: 0x5a, flags: 0x0}, - 1230: {region: 0x36, script: 0x5a, flags: 0x0}, - 1231: {region: 0x4e, script: 0x5a, flags: 0x0}, - 1232: {region: 0x165, script: 0x5a, flags: 0x0}, - 1233: {region: 0x6f, script: 0x2c, flags: 0x0}, - 1234: {region: 0x165, script: 0x5a, flags: 0x0}, - 1235: {region: 0xe7, script: 0x5a, flags: 0x0}, - 1236: {region: 0x2f, script: 0x5a, flags: 0x0}, - 1237: {region: 0x99, script: 0xe6, flags: 0x0}, - 1238: {region: 0x99, script: 0x22, flags: 0x0}, - 1239: {region: 0x165, script: 0x5a, flags: 0x0}, - 1240: {region: 0x165, script: 0x5a, flags: 0x0}, - 1241: {region: 0x165, script: 0x5a, flags: 0x0}, - 1242: {region: 0x165, script: 0x5a, flags: 0x0}, - 1243: {region: 0x165, script: 0x5a, flags: 0x0}, - 1244: {region: 0x165, script: 0x5a, flags: 0x0}, - 1245: {region: 0x165, script: 0x5a, flags: 0x0}, - 1246: {region: 0x165, script: 0x5a, flags: 0x0}, - 1247: {region: 0x165, script: 0x5a, flags: 0x0}, - 1248: {region: 0x140, script: 0x5a, flags: 0x0}, - 1249: {region: 0x165, script: 0x5a, flags: 0x0}, - 1250: {region: 0x165, script: 0x5a, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x5a, flags: 0x0}, - 1253: {region: 0x114, script: 0x5a, flags: 0x0}, - 1254: {region: 0x165, script: 0x5a, flags: 0x0}, - 1255: {region: 0x165, script: 0x5a, flags: 0x0}, - 1256: {region: 0x165, script: 0x5a, flags: 0x0}, - 1257: {region: 0x165, script: 0x5a, flags: 0x0}, - 1258: {region: 0x99, script: 0x22, flags: 0x0}, + 1213: {region: 0x166, script: 0x5b, flags: 0x0}, + 1214: {region: 0xb5, script: 0xf4, flags: 0x0}, + 1215: {region: 0x166, script: 0x5b, flags: 0x0}, + 1216: {region: 0x162, script: 0x5b, flags: 0x0}, + 1217: {region: 0x9f, script: 0x5b, flags: 0x0}, + 1218: {region: 0x107, script: 0x5b, flags: 0x0}, + 1219: {region: 0x13f, script: 0x5b, flags: 0x0}, + 1220: {region: 0x11c, script: 0x5b, flags: 0x0}, + 1221: {region: 0x166, script: 0x5b, flags: 0x0}, + 1222: {region: 0x36, script: 0x5b, flags: 0x0}, + 1223: {region: 0x61, script: 0x5b, flags: 0x0}, + 1224: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1225: {region: 0x1, script: 0x5b, flags: 0x0}, + 1226: {region: 0x107, script: 0x5b, flags: 0x0}, + 1227: {region: 0x6b, script: 0x5b, flags: 0x0}, + 1228: {region: 0x130, script: 0x5b, flags: 0x0}, + 1229: {region: 0x166, script: 0x5b, flags: 0x0}, + 1230: {region: 0x36, script: 0x5b, flags: 0x0}, + 1231: {region: 0x4e, script: 0x5b, flags: 0x0}, + 1232: {region: 0x166, script: 0x5b, flags: 0x0}, + 1233: {region: 0x70, script: 0x2c, flags: 0x0}, + 1234: {region: 0x166, script: 0x5b, flags: 0x0}, + 1235: {region: 0xe8, script: 0x5b, flags: 0x0}, + 1236: {region: 0x2f, script: 0x5b, flags: 0x0}, + 1237: {region: 0x9a, script: 0xe9, flags: 0x0}, + 1238: {region: 0x9a, script: 0x22, flags: 0x0}, + 1239: {region: 0x166, script: 0x5b, flags: 0x0}, + 1240: {region: 0x166, script: 0x5b, flags: 0x0}, + 1241: {region: 0x166, script: 0x5b, flags: 0x0}, + 1242: {region: 0x166, script: 0x5b, flags: 0x0}, + 1243: {region: 0x166, script: 0x5b, flags: 0x0}, + 1244: {region: 0x166, script: 0x5b, flags: 0x0}, + 1245: {region: 0x166, script: 0x5b, flags: 0x0}, + 1246: {region: 0x166, script: 0x5b, flags: 0x0}, + 1247: {region: 0x166, script: 0x5b, flags: 0x0}, + 1248: {region: 0x141, script: 0x5b, flags: 0x0}, + 1249: {region: 0x166, script: 0x5b, flags: 0x0}, + 1250: {region: 0x166, script: 0x5b, flags: 0x0}, + 1251: {region: 0xa9, script: 0x5, flags: 0x0}, + 1252: {region: 0x166, script: 0x5b, flags: 0x0}, + 1253: {region: 0x115, script: 0x5b, flags: 0x0}, + 1254: {region: 0x166, script: 0x5b, flags: 0x0}, + 1255: {region: 0x166, script: 0x5b, flags: 0x0}, + 1256: {region: 0x166, script: 0x5b, flags: 0x0}, + 1257: {region: 0x166, script: 0x5b, flags: 0x0}, + 1258: {region: 0x9a, script: 0x22, flags: 0x0}, 1259: {region: 0x53, script: 0x3b, flags: 0x0}, - 1260: {region: 0x165, script: 0x5a, flags: 0x0}, - 1261: {region: 0x165, script: 0x5a, flags: 0x0}, - 1262: {region: 0x41, script: 0x5a, flags: 0x0}, - 1263: {region: 0x165, script: 0x5a, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x5a, flags: 0x0}, - 1266: {region: 0x161, script: 0x5a, flags: 0x0}, - 1267: {region: 0x165, script: 0x5a, flags: 0x0}, - 1268: {region: 0x12b, script: 0x62, flags: 0x0}, - 1269: {region: 0x12b, script: 0x63, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2e, flags: 0x0}, - 1271: {region: 0x53, script: 0x67, flags: 0x0}, - 1272: {region: 0x10b, script: 0x6c, flags: 0x0}, - 1273: {region: 0x108, script: 0x77, flags: 0x0}, - 1274: {region: 0x99, script: 0x22, flags: 0x0}, - 1275: {region: 0x131, script: 0x5a, flags: 0x0}, - 1276: {region: 0x165, script: 0x5a, flags: 0x0}, - 1277: {region: 0x9c, script: 0x91, flags: 0x0}, - 1278: {region: 0x165, script: 0x5a, flags: 0x0}, - 1279: {region: 0x15e, script: 0xcc, flags: 0x0}, - 1280: {region: 0x165, script: 0x5a, flags: 0x0}, - 1281: {region: 0x165, script: 0x5a, flags: 0x0}, - 1282: {region: 0xdb, script: 0x22, flags: 0x0}, - 1283: {region: 0x165, script: 0x5a, flags: 0x0}, - 1284: {region: 0x165, script: 0x5a, flags: 0x0}, - 1285: {region: 0xd1, script: 0x5a, flags: 0x0}, - 1286: {region: 0x75, script: 0x5a, flags: 0x0}, - 1287: {region: 0x165, script: 0x5a, flags: 0x0}, - 1288: {region: 0x165, script: 0x5a, flags: 0x0}, - 1289: {region: 0x52, script: 0x5a, flags: 0x0}, - 1290: {region: 0x165, script: 0x5a, flags: 0x0}, - 1291: {region: 0x165, script: 0x5a, flags: 0x0}, - 1292: {region: 0x165, script: 0x5a, flags: 0x0}, - 1293: {region: 0x52, script: 0x5a, flags: 0x0}, - 1294: {region: 0x165, script: 0x5a, flags: 0x0}, - 1295: {region: 0x165, script: 0x5a, flags: 0x0}, - 1296: {region: 0x165, script: 0x5a, flags: 0x0}, - 1297: {region: 0x165, script: 0x5a, flags: 0x0}, + 1260: {region: 0x166, script: 0x5b, flags: 0x0}, + 1261: {region: 0x166, script: 0x5b, flags: 0x0}, + 1262: {region: 0x41, script: 0x5b, flags: 0x0}, + 1263: {region: 0x166, script: 0x5b, flags: 0x0}, + 1264: {region: 0x12c, script: 0x18, flags: 0x0}, + 1265: {region: 0x166, script: 0x5b, flags: 0x0}, + 1266: {region: 0x162, script: 0x5b, flags: 0x0}, + 1267: {region: 0x166, script: 0x5b, flags: 0x0}, + 1268: {region: 0x12c, script: 0x63, flags: 0x0}, + 1269: {region: 0x12c, script: 0x64, flags: 0x0}, + 1270: {region: 0x7e, script: 0x2e, flags: 0x0}, + 1271: {region: 0x53, script: 0x68, flags: 0x0}, + 1272: {region: 0x10c, script: 0x6d, flags: 0x0}, + 1273: {region: 0x109, script: 0x79, flags: 0x0}, + 1274: {region: 0x9a, script: 0x22, flags: 0x0}, + 1275: {region: 0x132, script: 0x5b, flags: 0x0}, + 1276: {region: 0x166, script: 0x5b, flags: 0x0}, + 1277: {region: 0x9d, script: 0x93, flags: 0x0}, + 1278: {region: 0x166, script: 0x5b, flags: 0x0}, + 1279: {region: 0x15f, script: 0xce, flags: 0x0}, + 1280: {region: 0x166, script: 0x5b, flags: 0x0}, + 1281: {region: 0x166, script: 0x5b, flags: 0x0}, + 1282: {region: 0xdc, script: 0x22, flags: 0x0}, + 1283: {region: 0x166, script: 0x5b, flags: 0x0}, + 1284: {region: 0x166, script: 0x5b, flags: 0x0}, + 1285: {region: 0xd2, script: 0x5b, flags: 0x0}, + 1286: {region: 0x76, script: 0x5b, flags: 0x0}, + 1287: {region: 0x166, script: 0x5b, flags: 0x0}, + 1288: {region: 0x166, script: 0x5b, flags: 0x0}, + 1289: {region: 0x52, script: 0x5b, flags: 0x0}, + 1290: {region: 0x166, script: 0x5b, flags: 0x0}, + 1291: {region: 0x166, script: 0x5b, flags: 0x0}, + 1292: {region: 0x166, script: 0x5b, flags: 0x0}, + 1293: {region: 0x52, script: 0x5b, flags: 0x0}, + 1294: {region: 0x166, script: 0x5b, flags: 0x0}, + 1295: {region: 0x166, script: 0x5b, flags: 0x0}, + 1296: {region: 0x166, script: 0x5b, flags: 0x0}, + 1297: {region: 0x166, script: 0x5b, flags: 0x0}, 1298: {region: 0x1, script: 0x3e, flags: 0x0}, - 1299: {region: 0x165, script: 0x5a, flags: 0x0}, - 1300: {region: 0x165, script: 0x5a, flags: 0x0}, - 1301: {region: 0x165, script: 0x5a, flags: 0x0}, - 1302: {region: 0x165, script: 0x5a, flags: 0x0}, - 1303: {region: 0x165, script: 0x5a, flags: 0x0}, - 1304: {region: 0xd6, script: 0x5a, flags: 0x0}, - 1305: {region: 0x165, script: 0x5a, flags: 0x0}, - 1306: {region: 0x165, script: 0x5a, flags: 0x0}, - 1307: {region: 0x165, script: 0x5a, flags: 0x0}, - 1308: {region: 0x41, script: 0x5a, flags: 0x0}, - 1309: {region: 0x165, script: 0x5a, flags: 0x0}, - 1310: {region: 0xcf, script: 0x5a, flags: 0x0}, + 1299: {region: 0x166, script: 0x5b, flags: 0x0}, + 1300: {region: 0x166, script: 0x5b, flags: 0x0}, + 1301: {region: 0x166, script: 0x5b, flags: 0x0}, + 1302: {region: 0x166, script: 0x5b, flags: 0x0}, + 1303: {region: 0x166, script: 0x5b, flags: 0x0}, + 1304: {region: 0xd7, script: 0x5b, flags: 0x0}, + 1305: {region: 0x166, script: 0x5b, flags: 0x0}, + 1306: {region: 0x166, script: 0x5b, flags: 0x0}, + 1307: {region: 0x166, script: 0x5b, flags: 0x0}, + 1308: {region: 0x41, script: 0x5b, flags: 0x0}, + 1309: {region: 0x166, script: 0x5b, flags: 0x0}, + 1310: {region: 0xd0, script: 0x5b, flags: 0x0}, 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x5a, flags: 0x0}, - 1313: {region: 0x165, script: 0x5a, flags: 0x0}, - 1314: {region: 0x165, script: 0x5a, flags: 0x0}, - 1315: {region: 0x53, script: 0x5a, flags: 0x0}, - 1316: {region: 0x10b, script: 0x5a, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x5a, flags: 0x0}, - 1320: {region: 0xba, script: 0xe8, flags: 0x0}, + 1312: {region: 0x166, script: 0x5b, flags: 0x0}, + 1313: {region: 0x166, script: 0x5b, flags: 0x0}, + 1314: {region: 0x166, script: 0x5b, flags: 0x0}, + 1315: {region: 0x53, script: 0x5b, flags: 0x0}, + 1316: {region: 0x10c, script: 0x5b, flags: 0x0}, + 1318: {region: 0xa9, script: 0x5, flags: 0x0}, + 1319: {region: 0xda, script: 0x5b, flags: 0x0}, + 1320: {region: 0xbb, script: 0xeb, flags: 0x0}, 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x7d, flags: 0x0}, - 1323: {region: 0x165, script: 0x5a, flags: 0x0}, - 1324: {region: 0x122, script: 0x5a, flags: 0x0}, - 1325: {region: 0xd0, script: 0x5a, flags: 0x0}, - 1326: {region: 0x165, script: 0x5a, flags: 0x0}, - 1327: {region: 0x161, script: 0x5a, flags: 0x0}, - 1329: {region: 0x12b, script: 0x5a, flags: 0x0}, + 1322: {region: 0x53, script: 0x7f, flags: 0x0}, + 1323: {region: 0x166, script: 0x5b, flags: 0x0}, + 1324: {region: 0x123, script: 0x5b, flags: 0x0}, + 1325: {region: 0xd1, script: 0x5b, flags: 0x0}, + 1326: {region: 0x166, script: 0x5b, flags: 0x0}, + 1327: {region: 0x162, script: 0x5b, flags: 0x0}, + 1329: {region: 0x12c, script: 0x5b, flags: 0x0}, } // likelyLangList holds lists info associated with likelyLang. // Size: 582 bytes, 97 elements var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x78, flags: 0x2}, - 2: {region: 0x11c, script: 0x85, flags: 0x2}, - 3: {region: 0x32, script: 0x5a, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x20, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x20, flags: 0x0}, + 0: {region: 0x9d, script: 0x7, flags: 0x0}, + 1: {region: 0xa2, script: 0x7a, flags: 0x2}, + 2: {region: 0x11d, script: 0x87, flags: 0x2}, + 3: {region: 0x32, script: 0x5b, flags: 0x0}, + 4: {region: 0x9c, script: 0x5, flags: 0x4}, + 5: {region: 0x9d, script: 0x5, flags: 0x4}, + 6: {region: 0x107, script: 0x20, flags: 0x4}, + 7: {region: 0x9d, script: 0x5, flags: 0x2}, + 8: {region: 0x107, script: 0x20, flags: 0x0}, 9: {region: 0x38, script: 0x2f, flags: 0x2}, - 10: {region: 0x135, script: 0x5a, flags: 0x0}, - 11: {region: 0x7b, script: 0xcf, flags: 0x2}, - 12: {region: 0x114, script: 0x5a, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1f, flags: 0x0}, - 15: {region: 0x87, script: 0x5f, flags: 0x2}, - 16: {region: 0xd6, script: 0x5a, flags: 0x0}, + 10: {region: 0x136, script: 0x5b, flags: 0x0}, + 11: {region: 0x7c, script: 0xd1, flags: 0x2}, + 12: {region: 0x115, script: 0x5b, flags: 0x0}, + 13: {region: 0x85, script: 0x1, flags: 0x2}, + 14: {region: 0x5e, script: 0x1f, flags: 0x0}, + 15: {region: 0x88, script: 0x60, flags: 0x2}, + 16: {region: 0xd7, script: 0x5b, flags: 0x0}, 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x20, flags: 0x0}, + 18: {region: 0x10c, script: 0x5, flags: 0x4}, + 19: {region: 0xaf, script: 0x20, flags: 0x0}, 20: {region: 0x24, script: 0x5, flags: 0x4}, 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 22: {region: 0x9d, script: 0x5, flags: 0x4}, + 23: {region: 0xc6, script: 0x5, flags: 0x4}, 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x5a, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x20, flags: 0x0}, + 25: {region: 0x12c, script: 0x5b, flags: 0x0}, + 26: {region: 0xb1, script: 0x5, flags: 0x4}, + 27: {region: 0x9c, script: 0x5, flags: 0x2}, + 28: {region: 0xa6, script: 0x20, flags: 0x0}, 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x5a, flags: 0x4}, + 30: {region: 0x12c, script: 0x5b, flags: 0x4}, 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x5a, flags: 0x2}, - 33: {region: 0xdb, script: 0x22, flags: 0x0}, - 34: {region: 0x99, script: 0x5d, flags: 0x2}, - 35: {region: 0x83, script: 0x5a, flags: 0x0}, - 36: {region: 0x84, script: 0x7c, flags: 0x4}, - 37: {region: 0x84, script: 0x7c, flags: 0x2}, - 38: {region: 0xc5, script: 0x20, flags: 0x0}, - 39: {region: 0x53, script: 0x70, flags: 0x4}, - 40: {region: 0x53, script: 0x70, flags: 0x2}, - 41: {region: 0xd0, script: 0x5a, flags: 0x0}, + 32: {region: 0x12c, script: 0x5b, flags: 0x2}, + 33: {region: 0xdc, script: 0x22, flags: 0x0}, + 34: {region: 0x9a, script: 0x5e, flags: 0x2}, + 35: {region: 0x84, script: 0x5b, flags: 0x0}, + 36: {region: 0x85, script: 0x7e, flags: 0x4}, + 37: {region: 0x85, script: 0x7e, flags: 0x2}, + 38: {region: 0xc6, script: 0x20, flags: 0x0}, + 39: {region: 0x53, script: 0x71, flags: 0x4}, + 40: {region: 0x53, script: 0x71, flags: 0x2}, + 41: {region: 0xd1, script: 0x5b, flags: 0x0}, 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x36, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x8b, flags: 0x0}, - 48: {region: 0x53, script: 0x8c, flags: 0x2}, - 49: {region: 0xba, script: 0xe8, flags: 0x0}, - 50: {region: 0xd9, script: 0x5a, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x22, flags: 0x2}, - 53: {region: 0x99, script: 0x4f, flags: 0x2}, - 54: {region: 0x99, script: 0xd3, flags: 0x2}, - 55: {region: 0x105, script: 0x20, flags: 0x0}, - 56: {region: 0xbd, script: 0x5a, flags: 0x4}, - 57: {region: 0x104, script: 0x5a, flags: 0x4}, - 58: {region: 0x106, script: 0x5a, flags: 0x4}, - 59: {region: 0x12b, script: 0x5a, flags: 0x4}, - 60: {region: 0x124, script: 0x20, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 43: {region: 0x96, script: 0x5, flags: 0x4}, + 44: {region: 0x9a, script: 0x36, flags: 0x0}, + 45: {region: 0xe9, script: 0x5, flags: 0x4}, + 46: {region: 0xe9, script: 0x5, flags: 0x2}, + 47: {region: 0x9d, script: 0x8d, flags: 0x0}, + 48: {region: 0x53, script: 0x8e, flags: 0x2}, + 49: {region: 0xbb, script: 0xeb, flags: 0x0}, + 50: {region: 0xda, script: 0x5b, flags: 0x4}, + 51: {region: 0xe9, script: 0x5, flags: 0x0}, + 52: {region: 0x9a, script: 0x22, flags: 0x2}, + 53: {region: 0x9a, script: 0x50, flags: 0x2}, + 54: {region: 0x9a, script: 0xd5, flags: 0x2}, + 55: {region: 0x106, script: 0x20, flags: 0x0}, + 56: {region: 0xbe, script: 0x5b, flags: 0x4}, + 57: {region: 0x105, script: 0x5b, flags: 0x4}, + 58: {region: 0x107, script: 0x5b, flags: 0x4}, + 59: {region: 0x12c, script: 0x5b, flags: 0x4}, + 60: {region: 0x125, script: 0x20, flags: 0x0}, + 61: {region: 0xe9, script: 0x5, flags: 0x4}, + 62: {region: 0xe9, script: 0x5, flags: 0x2}, 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x20, flags: 0x4}, - 65: {region: 0xc5, script: 0x20, flags: 0x4}, - 66: {region: 0xae, script: 0x20, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x22, flags: 0x4}, - 69: {region: 0xdb, script: 0x22, flags: 0x2}, - 70: {region: 0x137, script: 0x5a, flags: 0x0}, + 64: {region: 0xaf, script: 0x20, flags: 0x4}, + 65: {region: 0xc6, script: 0x20, flags: 0x4}, + 66: {region: 0xaf, script: 0x20, flags: 0x2}, + 67: {region: 0x9a, script: 0xe, flags: 0x0}, + 68: {region: 0xdc, script: 0x22, flags: 0x4}, + 69: {region: 0xdc, script: 0x22, flags: 0x2}, + 70: {region: 0x138, script: 0x5b, flags: 0x0}, 71: {region: 0x24, script: 0x5, flags: 0x4}, 72: {region: 0x53, script: 0x20, flags: 0x4}, 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x3c, flags: 0x0}, + 74: {region: 0x8e, script: 0x3c, flags: 0x0}, 75: {region: 0x53, script: 0x3b, flags: 0x4}, 76: {region: 0x53, script: 0x3b, flags: 0x2}, 77: {region: 0x53, script: 0x3b, flags: 0x0}, 78: {region: 0x2f, script: 0x3c, flags: 0x4}, 79: {region: 0x3e, script: 0x3c, flags: 0x4}, - 80: {region: 0x7b, script: 0x3c, flags: 0x4}, - 81: {region: 0x7e, script: 0x3c, flags: 0x4}, - 82: {region: 0x8d, script: 0x3c, flags: 0x4}, - 83: {region: 0x95, script: 0x3c, flags: 0x4}, - 84: {region: 0xc6, script: 0x3c, flags: 0x4}, - 85: {region: 0xd0, script: 0x3c, flags: 0x4}, - 86: {region: 0xe2, script: 0x3c, flags: 0x4}, - 87: {region: 0xe5, script: 0x3c, flags: 0x4}, - 88: {region: 0xe7, script: 0x3c, flags: 0x4}, - 89: {region: 0x116, script: 0x3c, flags: 0x4}, - 90: {region: 0x123, script: 0x3c, flags: 0x4}, - 91: {region: 0x12e, script: 0x3c, flags: 0x4}, - 92: {region: 0x135, script: 0x3c, flags: 0x4}, - 93: {region: 0x13e, script: 0x3c, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x37, flags: 0x2}, - 96: {region: 0x12e, script: 0x3c, flags: 0x2}, + 80: {region: 0x7c, script: 0x3c, flags: 0x4}, + 81: {region: 0x7f, script: 0x3c, flags: 0x4}, + 82: {region: 0x8e, script: 0x3c, flags: 0x4}, + 83: {region: 0x96, script: 0x3c, flags: 0x4}, + 84: {region: 0xc7, script: 0x3c, flags: 0x4}, + 85: {region: 0xd1, script: 0x3c, flags: 0x4}, + 86: {region: 0xe3, script: 0x3c, flags: 0x4}, + 87: {region: 0xe6, script: 0x3c, flags: 0x4}, + 88: {region: 0xe8, script: 0x3c, flags: 0x4}, + 89: {region: 0x117, script: 0x3c, flags: 0x4}, + 90: {region: 0x124, script: 0x3c, flags: 0x4}, + 91: {region: 0x12f, script: 0x3c, flags: 0x4}, + 92: {region: 0x136, script: 0x3c, flags: 0x4}, + 93: {region: 0x13f, script: 0x3c, flags: 0x4}, + 94: {region: 0x12f, script: 0x11, flags: 0x2}, + 95: {region: 0x12f, script: 0x37, flags: 0x2}, + 96: {region: 0x12f, script: 0x3c, flags: 0x2}, } type likelyLangScript struct { @@ -2987,306 +3009,306 @@ type likelyLangScript struct { // for a given regionID, lang and script are the index and size respectively // of the list in likelyRegionList. // TODO: exclude containers and user-definable regions from the list. -// Size: 2148 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x5a, flags: 0x0}, +// Size: 2154 bytes, 359 elements +var likelyRegion = [359]likelyLangScript{ + 34: {lang: 0xd7, script: 0x5b, flags: 0x0}, 35: {lang: 0x3a, script: 0x5, flags: 0x0}, 36: {lang: 0x0, script: 0x2, flags: 0x1}, 39: {lang: 0x2, script: 0x2, flags: 0x1}, 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 43: {lang: 0x0, script: 0x5a, flags: 0x0}, - 44: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 45: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 46: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 48: {lang: 0x367, script: 0x5a, flags: 0x0}, - 49: {lang: 0x444, script: 0x5a, flags: 0x0}, - 50: {lang: 0x58, script: 0x5a, flags: 0x0}, + 42: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 43: {lang: 0x0, script: 0x5b, flags: 0x0}, + 44: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 45: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 46: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 48: {lang: 0x367, script: 0x5b, flags: 0x0}, + 49: {lang: 0x444, script: 0x5b, flags: 0x0}, + 50: {lang: 0x58, script: 0x5b, flags: 0x0}, 51: {lang: 0x6, script: 0x2, flags: 0x1}, 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x5a, flags: 0x0}, - 55: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 54: {lang: 0x367, script: 0x5b, flags: 0x0}, + 55: {lang: 0x15e, script: 0x5b, flags: 0x0}, 56: {lang: 0x7e, script: 0x20, flags: 0x0}, 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x5a, flags: 0x0}, - 59: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 60: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 62: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 63: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x5b, flags: 0x0}, + 59: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 60: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 62: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 63: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x5a, flags: 0x0}, + 69: {lang: 0x0, script: 0x5b, flags: 0x0}, 71: {lang: 0x71, script: 0x20, flags: 0x0}, 73: {lang: 0x512, script: 0x3e, flags: 0x2}, 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x5a, flags: 0x0}, - 76: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 77: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 78: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 81: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 82: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 75: {lang: 0x445, script: 0x5b, flags: 0x0}, + 76: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 77: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 78: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 81: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 82: {lang: 0x15e, script: 0x5b, flags: 0x0}, 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 85: {lang: 0x0, script: 0x5a, flags: 0x0}, - 86: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 89: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x5a, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x5a, flags: 0x0}, - 96: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 98: {lang: 0x1, script: 0x5a, flags: 0x0}, - 99: {lang: 0x101, script: 0x5a, flags: 0x0}, - 101: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 105: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 106: {lang: 0x140, script: 0x5a, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 84: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 85: {lang: 0x0, script: 0x5b, flags: 0x0}, + 87: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 90: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 91: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 92: {lang: 0x3a1, script: 0x5b, flags: 0x0}, + 94: {lang: 0xe, script: 0x2, flags: 0x1}, + 95: {lang: 0xfa, script: 0x5b, flags: 0x0}, + 97: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 99: {lang: 0x1, script: 0x5b, flags: 0x0}, + 100: {lang: 0x101, script: 0x5b, flags: 0x0}, + 102: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 104: {lang: 0x10, script: 0x2, flags: 0x1}, + 105: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 106: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 107: {lang: 0x140, script: 0x5b, flags: 0x0}, 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x2c, flags: 0x0}, - 110: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 114: {lang: 0x151, script: 0x5a, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x22, flags: 0x2}, - 118: {lang: 0x158, script: 0x5a, flags: 0x0}, - 120: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 122: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 128: {lang: 0x21, script: 0x5a, flags: 0x0}, - 130: {lang: 0x245, script: 0x5a, flags: 0x0}, - 132: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 133: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 134: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x5a, flags: 0x0}, - 137: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 141: {lang: 0x529, script: 0x3c, flags: 0x0}, - 142: {lang: 0x0, script: 0x5a, flags: 0x0}, - 143: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x5a, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x5a, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x5a, flags: 0x0}, - 148: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3e, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x5a, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x49, flags: 0x0}, - 164: {lang: 0x445, script: 0x5a, flags: 0x0}, - 165: {lang: 0x28a, script: 0x20, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x53, flags: 0x0}, - 171: {lang: 0x254, script: 0x53, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x5a, flags: 0x0}, - 179: {lang: 0x40c, script: 0xd4, flags: 0x0}, - 181: {lang: 0x43b, script: 0x5a, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x5a, flags: 0x0}, - 183: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x5a, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x5a, flags: 0x0}, - 190: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x5a, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x5a, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x5a, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xea, flags: 0x0}, - 207: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 208: {lang: 0x31f, script: 0x5a, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 210: {lang: 0x16, script: 0x5a, flags: 0x0}, - 211: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x5a, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 217: {lang: 0x367, script: 0x5a, flags: 0x0}, - 218: {lang: 0x347, script: 0x5a, flags: 0x0}, - 219: {lang: 0x351, script: 0x22, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 228: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 229: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 230: {lang: 0x486, script: 0x5a, flags: 0x0}, - 231: {lang: 0x153, script: 0x5a, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 234: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 236: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x5a, flags: 0x0}, - 241: {lang: 0x194, script: 0x5a, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x20, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x5a, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x5a, flags: 0x0}, - 272: {lang: 0x347, script: 0x5a, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 276: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 277: {lang: 0x429, script: 0x5a, flags: 0x0}, - 278: {lang: 0x367, script: 0x5a, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 282: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 289: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x5a, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x5a, flags: 0x0}, - 295: {lang: 0x476, script: 0x5a, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x5a, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x5a, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x5a, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x5a, flags: 0x0}, - 309: {lang: 0x512, script: 0x3e, flags: 0x2}, - 310: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x5a, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x5a, flags: 0x0}, - 315: {lang: 0x13e, script: 0x5a, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x5a, flags: 0x0}, - 319: {lang: 0x8a, script: 0x5a, flags: 0x0}, - 320: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 322: {lang: 0x41b, script: 0x5a, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x5a, flags: 0x0}, + 109: {lang: 0x3a, script: 0x5, flags: 0x0}, + 110: {lang: 0x46f, script: 0x2c, flags: 0x0}, + 111: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 112: {lang: 0x12, script: 0x2, flags: 0x1}, + 114: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 115: {lang: 0x151, script: 0x5b, flags: 0x0}, + 116: {lang: 0x1c0, script: 0x22, flags: 0x2}, + 119: {lang: 0x158, script: 0x5b, flags: 0x0}, + 121: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 123: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 124: {lang: 0x14, script: 0x2, flags: 0x1}, + 126: {lang: 0x16, script: 0x3, flags: 0x1}, + 127: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 129: {lang: 0x21, script: 0x5b, flags: 0x0}, + 131: {lang: 0x245, script: 0x5b, flags: 0x0}, + 133: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 134: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 135: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 136: {lang: 0x19, script: 0x2, flags: 0x1}, + 137: {lang: 0x0, script: 0x5b, flags: 0x0}, + 138: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 140: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 142: {lang: 0x529, script: 0x3c, flags: 0x0}, + 143: {lang: 0x0, script: 0x5b, flags: 0x0}, + 144: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 145: {lang: 0x1d1, script: 0x5b, flags: 0x0}, + 146: {lang: 0x1d4, script: 0x5b, flags: 0x0}, + 147: {lang: 0x1d5, script: 0x5b, flags: 0x0}, + 149: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 150: {lang: 0x1b, script: 0x2, flags: 0x1}, + 152: {lang: 0x1bc, script: 0x3e, flags: 0x0}, + 154: {lang: 0x1d, script: 0x3, flags: 0x1}, + 156: {lang: 0x3a, script: 0x5, flags: 0x0}, + 157: {lang: 0x20, script: 0x2, flags: 0x1}, + 158: {lang: 0x1f8, script: 0x5b, flags: 0x0}, + 159: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 162: {lang: 0x3a, script: 0x5, flags: 0x0}, + 163: {lang: 0x200, script: 0x49, flags: 0x0}, + 165: {lang: 0x445, script: 0x5b, flags: 0x0}, + 166: {lang: 0x28a, script: 0x20, flags: 0x0}, + 167: {lang: 0x22, script: 0x3, flags: 0x1}, + 169: {lang: 0x25, script: 0x2, flags: 0x1}, + 171: {lang: 0x254, script: 0x54, flags: 0x0}, + 172: {lang: 0x254, script: 0x54, flags: 0x0}, + 173: {lang: 0x3a, script: 0x5, flags: 0x0}, + 175: {lang: 0x3e2, script: 0x20, flags: 0x0}, + 176: {lang: 0x27, script: 0x2, flags: 0x1}, + 177: {lang: 0x3a, script: 0x5, flags: 0x0}, + 179: {lang: 0x10d, script: 0x5b, flags: 0x0}, + 180: {lang: 0x40c, script: 0xd6, flags: 0x0}, + 182: {lang: 0x43b, script: 0x5b, flags: 0x0}, + 183: {lang: 0x2c0, script: 0x5b, flags: 0x0}, + 184: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 185: {lang: 0x2c7, script: 0x5b, flags: 0x0}, + 186: {lang: 0x3a, script: 0x5, flags: 0x0}, + 187: {lang: 0x29, script: 0x2, flags: 0x1}, + 188: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 189: {lang: 0x2b, script: 0x2, flags: 0x1}, + 190: {lang: 0x432, script: 0x5b, flags: 0x0}, + 191: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 192: {lang: 0x2f1, script: 0x5b, flags: 0x0}, + 195: {lang: 0x2d, script: 0x2, flags: 0x1}, + 196: {lang: 0xa0, script: 0x5b, flags: 0x0}, + 197: {lang: 0x2f, script: 0x2, flags: 0x1}, + 198: {lang: 0x31, script: 0x2, flags: 0x1}, + 199: {lang: 0x33, script: 0x2, flags: 0x1}, + 201: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 202: {lang: 0x35, script: 0x2, flags: 0x1}, + 204: {lang: 0x320, script: 0x5b, flags: 0x0}, + 205: {lang: 0x37, script: 0x3, flags: 0x1}, + 206: {lang: 0x128, script: 0xed, flags: 0x0}, + 208: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 209: {lang: 0x31f, script: 0x5b, flags: 0x0}, + 210: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 211: {lang: 0x16, script: 0x5b, flags: 0x0}, + 212: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 213: {lang: 0x1b4, script: 0x5b, flags: 0x0}, + 215: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 217: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 218: {lang: 0x367, script: 0x5b, flags: 0x0}, + 219: {lang: 0x347, script: 0x5b, flags: 0x0}, + 220: {lang: 0x351, script: 0x22, flags: 0x0}, + 226: {lang: 0x3a, script: 0x5, flags: 0x0}, + 227: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 229: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 230: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 231: {lang: 0x486, script: 0x5b, flags: 0x0}, + 232: {lang: 0x153, script: 0x5b, flags: 0x0}, + 233: {lang: 0x3a, script: 0x3, flags: 0x1}, + 234: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 235: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 237: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 238: {lang: 0x3a, script: 0x5, flags: 0x0}, + 239: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 241: {lang: 0x3a2, script: 0x5b, flags: 0x0}, + 242: {lang: 0x194, script: 0x5b, flags: 0x0}, + 244: {lang: 0x3a, script: 0x5, flags: 0x0}, + 259: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 261: {lang: 0x3d, script: 0x2, flags: 0x1}, + 262: {lang: 0x432, script: 0x20, flags: 0x0}, + 263: {lang: 0x3f, script: 0x2, flags: 0x1}, + 264: {lang: 0x3e5, script: 0x5b, flags: 0x0}, + 265: {lang: 0x3a, script: 0x5, flags: 0x0}, + 267: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 268: {lang: 0x3a, script: 0x5, flags: 0x0}, + 269: {lang: 0x41, script: 0x2, flags: 0x1}, + 272: {lang: 0x416, script: 0x5b, flags: 0x0}, + 273: {lang: 0x347, script: 0x5b, flags: 0x0}, + 274: {lang: 0x43, script: 0x2, flags: 0x1}, + 276: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 277: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 278: {lang: 0x429, script: 0x5b, flags: 0x0}, + 279: {lang: 0x367, script: 0x5b, flags: 0x0}, + 281: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 283: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 285: {lang: 0x45, script: 0x2, flags: 0x1}, + 289: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 290: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 291: {lang: 0x47, script: 0x2, flags: 0x1}, + 292: {lang: 0x49, script: 0x3, flags: 0x1}, + 293: {lang: 0x4c, script: 0x2, flags: 0x1}, + 294: {lang: 0x477, script: 0x5b, flags: 0x0}, + 295: {lang: 0x3c0, script: 0x5b, flags: 0x0}, + 296: {lang: 0x476, script: 0x5b, flags: 0x0}, + 297: {lang: 0x4e, script: 0x2, flags: 0x1}, + 298: {lang: 0x482, script: 0x5b, flags: 0x0}, + 300: {lang: 0x50, script: 0x4, flags: 0x1}, + 302: {lang: 0x4a0, script: 0x5b, flags: 0x0}, + 303: {lang: 0x54, script: 0x2, flags: 0x1}, + 304: {lang: 0x445, script: 0x5b, flags: 0x0}, + 305: {lang: 0x56, script: 0x3, flags: 0x1}, + 306: {lang: 0x445, script: 0x5b, flags: 0x0}, + 310: {lang: 0x512, script: 0x3e, flags: 0x2}, + 311: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 312: {lang: 0x4bc, script: 0x5b, flags: 0x0}, + 313: {lang: 0x1f9, script: 0x5b, flags: 0x0}, + 316: {lang: 0x13e, script: 0x5b, flags: 0x0}, + 319: {lang: 0x4c3, script: 0x5b, flags: 0x0}, + 320: {lang: 0x8a, script: 0x5b, flags: 0x0}, + 321: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 323: {lang: 0x41b, script: 0x5b, flags: 0x0}, + 334: {lang: 0x59, script: 0x2, flags: 0x1}, + 351: {lang: 0x3a, script: 0x5, flags: 0x0}, + 352: {lang: 0x5b, script: 0x2, flags: 0x1}, + 357: {lang: 0x423, script: 0x5b, flags: 0x0}, } // likelyRegionList holds lists info associated with likelyRegion. // Size: 558 bytes, 93 elements var likelyRegionList = [93]likelyLangScript{ 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x5a, flags: 0x0}, - 2: {lang: 0x431, script: 0x5a, flags: 0x0}, + 1: {lang: 0x476, script: 0x5b, flags: 0x0}, + 2: {lang: 0x431, script: 0x5b, flags: 0x0}, 3: {lang: 0x2ff, script: 0x20, flags: 0x0}, 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x5a, flags: 0x0}, - 6: {lang: 0xb7, script: 0x5a, flags: 0x0}, + 5: {lang: 0x274, script: 0x5b, flags: 0x0}, + 6: {lang: 0xb7, script: 0x5b, flags: 0x0}, 7: {lang: 0x432, script: 0x20, flags: 0x0}, - 8: {lang: 0x12d, script: 0xec, flags: 0x0}, + 8: {lang: 0x12d, script: 0xef, flags: 0x0}, 9: {lang: 0x351, script: 0x22, flags: 0x0}, 10: {lang: 0x529, script: 0x3b, flags: 0x0}, 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x5a, flags: 0x0}, - 13: {lang: 0x29a, script: 0xeb, flags: 0x0}, + 12: {lang: 0x523, script: 0x5b, flags: 0x0}, + 13: {lang: 0x29a, script: 0xee, flags: 0x0}, 14: {lang: 0x136, script: 0x34, flags: 0x0}, - 15: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 15: {lang: 0x48a, script: 0x5b, flags: 0x0}, 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 17: {lang: 0x15e, script: 0x5b, flags: 0x0}, 18: {lang: 0x27, script: 0x2c, flags: 0x0}, - 19: {lang: 0x139, script: 0x5a, flags: 0x0}, + 19: {lang: 0x139, script: 0x5b, flags: 0x0}, 20: {lang: 0x26a, script: 0x5, flags: 0x2}, 21: {lang: 0x512, script: 0x3e, flags: 0x2}, 22: {lang: 0x210, script: 0x2e, flags: 0x0}, 23: {lang: 0x5, script: 0x20, flags: 0x0}, - 24: {lang: 0x274, script: 0x5a, flags: 0x0}, + 24: {lang: 0x274, script: 0x5b, flags: 0x0}, 25: {lang: 0x136, script: 0x34, flags: 0x0}, 26: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x5a, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x5b, flags: 0x0}, 28: {lang: 0x31f, script: 0x5, flags: 0x0}, 29: {lang: 0x1be, script: 0x22, flags: 0x0}, 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x75, flags: 0x0}, + 31: {lang: 0x236, script: 0x76, flags: 0x0}, 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x5a, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4e, flags: 0x0}, + 33: {lang: 0x476, script: 0x5b, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4f, flags: 0x0}, 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xeb, flags: 0x0}, + 36: {lang: 0x226, script: 0xee, flags: 0x0}, 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x57, flags: 0x0}, - 40: {lang: 0x226, script: 0xeb, flags: 0x0}, + 38: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x58, flags: 0x0}, + 40: {lang: 0x226, script: 0xee, flags: 0x0}, 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 42: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 44: {lang: 0x4ae, script: 0x20, flags: 0x0}, 45: {lang: 0x2ff, script: 0x20, flags: 0x0}, - 46: {lang: 0x431, script: 0x5a, flags: 0x0}, - 47: {lang: 0x331, script: 0x75, flags: 0x0}, - 48: {lang: 0x213, script: 0x5a, flags: 0x0}, + 46: {lang: 0x431, script: 0x5b, flags: 0x0}, + 47: {lang: 0x331, script: 0x76, flags: 0x0}, + 48: {lang: 0x213, script: 0x5b, flags: 0x0}, 49: {lang: 0x30b, script: 0x20, flags: 0x0}, 50: {lang: 0x242, script: 0x5, flags: 0x0}, 51: {lang: 0x529, script: 0x3c, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x5a, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x5b, flags: 0x0}, 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x5a, flags: 0x0}, + 54: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x5b, flags: 0x0}, 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, 57: {lang: 0x88, script: 0x22, flags: 0x0}, 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, 60: {lang: 0xbe, script: 0x22, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x5a, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x5b, flags: 0x0}, 62: {lang: 0x7e, script: 0x20, flags: 0x0}, 63: {lang: 0x3e2, script: 0x20, flags: 0x0}, - 64: {lang: 0x267, script: 0x5a, flags: 0x0}, - 65: {lang: 0x444, script: 0x5a, flags: 0x0}, + 64: {lang: 0x267, script: 0x5b, flags: 0x0}, + 65: {lang: 0x444, script: 0x5b, flags: 0x0}, 66: {lang: 0x512, script: 0x3e, flags: 0x0}, - 67: {lang: 0x412, script: 0x5a, flags: 0x0}, + 67: {lang: 0x412, script: 0x5b, flags: 0x0}, 68: {lang: 0x4ae, script: 0x20, flags: 0x0}, 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 71: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 70: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 71: {lang: 0x15e, script: 0x5b, flags: 0x0}, 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xeb, flags: 0x0}, + 73: {lang: 0x46b, script: 0xee, flags: 0x0}, 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x75, flags: 0x0}, + 75: {lang: 0x30f, script: 0x76, flags: 0x0}, 76: {lang: 0x467, script: 0x20, flags: 0x0}, 77: {lang: 0x148, script: 0x5, flags: 0x0}, 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x5a, flags: 0x0}, - 80: {lang: 0x48a, script: 0x5a, flags: 0x0}, + 79: {lang: 0x15e, script: 0x5b, flags: 0x0}, + 80: {lang: 0x48a, script: 0x5b, flags: 0x0}, 81: {lang: 0x58, script: 0x5, flags: 0x0}, 82: {lang: 0x219, script: 0x20, flags: 0x0}, 83: {lang: 0x81, script: 0x34, flags: 0x0}, 84: {lang: 0x529, script: 0x3c, flags: 0x0}, - 85: {lang: 0x48c, script: 0x5a, flags: 0x0}, + 85: {lang: 0x48c, script: 0x5b, flags: 0x0}, 86: {lang: 0x4ae, script: 0x20, flags: 0x0}, 87: {lang: 0x512, script: 0x3e, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x5a, flags: 0x0}, - 89: {lang: 0x431, script: 0x5a, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x5b, flags: 0x0}, + 89: {lang: 0x431, script: 0x5b, flags: 0x0}, 90: {lang: 0x432, script: 0x20, flags: 0x0}, - 91: {lang: 0x15e, script: 0x5a, flags: 0x0}, + 91: {lang: 0x15e, script: 0x5b, flags: 0x0}, 92: {lang: 0x446, script: 0x5, flags: 0x0}, } @@ -3298,38 +3320,38 @@ type likelyTag struct { // Size: 198 bytes, 33 elements var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x5a}, - 2: {lang: 0x139, region: 0x135, script: 0x5a}, - 3: {lang: 0x3c0, region: 0x41, script: 0x5a}, - 4: {lang: 0x139, region: 0x2f, script: 0x5a}, - 5: {lang: 0x139, region: 0xd6, script: 0x5a}, - 6: {lang: 0x13e, region: 0xcf, script: 0x5a}, - 7: {lang: 0x445, region: 0x12f, script: 0x5a}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x5a}, - 10: {lang: 0x139, region: 0x161, script: 0x5a}, - 11: {lang: 0x139, region: 0x135, script: 0x5a}, - 12: {lang: 0x139, region: 0x135, script: 0x5a}, - 13: {lang: 0x13e, region: 0x59, script: 0x5a}, + 1: {lang: 0x139, region: 0xd7, script: 0x5b}, + 2: {lang: 0x139, region: 0x136, script: 0x5b}, + 3: {lang: 0x3c0, region: 0x41, script: 0x5b}, + 4: {lang: 0x139, region: 0x2f, script: 0x5b}, + 5: {lang: 0x139, region: 0xd7, script: 0x5b}, + 6: {lang: 0x13e, region: 0xd0, script: 0x5b}, + 7: {lang: 0x445, region: 0x130, script: 0x5b}, + 8: {lang: 0x3a, region: 0x6c, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x5b}, + 10: {lang: 0x139, region: 0x162, script: 0x5b}, + 11: {lang: 0x139, region: 0x136, script: 0x5b}, + 12: {lang: 0x139, region: 0x136, script: 0x5b}, + 13: {lang: 0x13e, region: 0x5a, script: 0x5b}, 14: {lang: 0x529, region: 0x53, script: 0x3b}, - 15: {lang: 0x1be, region: 0x99, script: 0x22}, - 16: {lang: 0x1e1, region: 0x95, script: 0x5a}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x5a}, - 18: {lang: 0x139, region: 0x2f, script: 0x5a}, - 19: {lang: 0x139, region: 0xe6, script: 0x5a}, - 20: {lang: 0x139, region: 0x8a, script: 0x5a}, - 21: {lang: 0x41b, region: 0x142, script: 0x5a}, + 15: {lang: 0x1be, region: 0x9a, script: 0x22}, + 16: {lang: 0x1e1, region: 0x96, script: 0x5b}, + 17: {lang: 0x1f9, region: 0x9f, script: 0x5b}, + 18: {lang: 0x139, region: 0x2f, script: 0x5b}, + 19: {lang: 0x139, region: 0xe7, script: 0x5b}, + 20: {lang: 0x139, region: 0x8b, script: 0x5b}, + 21: {lang: 0x41b, region: 0x143, script: 0x5b}, 22: {lang: 0x529, region: 0x53, script: 0x3b}, - 23: {lang: 0x4bc, region: 0x137, script: 0x5a}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x20}, - 26: {lang: 0x3e2, region: 0x106, script: 0x20}, - 27: {lang: 0x139, region: 0x7b, script: 0x5a}, - 28: {lang: 0x10d, region: 0x60, script: 0x5a}, - 29: {lang: 0x139, region: 0xd6, script: 0x5a}, - 30: {lang: 0x13e, region: 0x1f, script: 0x5a}, - 31: {lang: 0x139, region: 0x9a, script: 0x5a}, - 32: {lang: 0x139, region: 0x7b, script: 0x5a}, + 23: {lang: 0x4bc, region: 0x138, script: 0x5b}, + 24: {lang: 0x3a, region: 0x109, script: 0x5}, + 25: {lang: 0x3e2, region: 0x107, script: 0x20}, + 26: {lang: 0x3e2, region: 0x107, script: 0x20}, + 27: {lang: 0x139, region: 0x7c, script: 0x5b}, + 28: {lang: 0x10d, region: 0x61, script: 0x5b}, + 29: {lang: 0x139, region: 0xd7, script: 0x5b}, + 30: {lang: 0x13e, region: 0x1f, script: 0x5b}, + 31: {lang: 0x139, region: 0x9b, script: 0x5b}, + 32: {lang: 0x139, region: 0x7c, script: 0x5b}, } // Size: 264 bytes, 33 elements @@ -3350,8 +3372,8 @@ var regionContainment = [33]uint64{ // regionInclusion maps region identifiers to sets of regions in regionInclusionBits, // where each set holds all groupings that are directly connected in a region // containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ +// Size: 359 bytes, 359 elements +var regionInclusion = [359]uint8{ // Entry 0 - 3F 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, @@ -3364,45 +3386,45 @@ var regionInclusion = [358]uint8{ // Entry 40 - 7F 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x21, 0x34, + 0x23, 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, + 0x35, 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, + 0x39, 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, + 0x2f, 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, + 0x21, 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + 0x2c, 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, + 0x3a, 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, + 0x34, 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, + 0x24, 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, + 0x2c, 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, + 0x3c, 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, + 0x31, 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, + 0x2a, 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x2f, 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, + 0x3c, 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, + 0x34, 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, + 0x21, 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, + 0x29, 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, + 0x31, 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, + 0x21, 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + 0x21, 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, + 0x2f, 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, + 0x3a, 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, + 0x2f, 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, + 0x26, 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, + 0x3d, 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, + 0x2f, 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, + 0x3d, 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x3b, 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, + 0x2f, 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, } // regionInclusionBits is an array of bit vectors where every vector represents @@ -3462,11 +3484,11 @@ type parentRel struct { // Size: 414 bytes, 5 elements var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x5a, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x5a, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5a, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, + 0: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5d, 0x5e, 0x62, 0x65, 0x6e, 0x74, 0x75, 0x76, 0x7c, 0x7d, 0x80, 0x81, 0x82, 0x84, 0x8d, 0x8e, 0x97, 0x98, 0x99, 0x9a, 0x9b, 0xa0, 0xa1, 0xa5, 0xa8, 0xaa, 0xae, 0xb2, 0xb5, 0xb6, 0xc0, 0xc7, 0xcb, 0xcc, 0xcd, 0xcf, 0xd1, 0xd3, 0xd6, 0xd7, 0xde, 0xe0, 0xe1, 0xe7, 0xe8, 0xe9, 0xec, 0xf1, 0x108, 0x10a, 0x10b, 0x10c, 0x10e, 0x10f, 0x113, 0x118, 0x11c, 0x11e, 0x120, 0x126, 0x12a, 0x12d, 0x12e, 0x130, 0x132, 0x13a, 0x13d, 0x140, 0x143, 0x162, 0x163, 0x165}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x5b, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x61, 0x64, 0x73, 0xda, 0x10d, 0x110}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x5b, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x57, 0x5a, 0x66, 0x6a, 0x8a, 0x90, 0xd0, 0xd9, 0xe3, 0xe5, 0xed, 0xf2, 0x11b, 0x136, 0x137, 0x13c}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x5b, toRegion: 0xef, fromRegion: []uint16{0x2a, 0x4e, 0x5b, 0x87, 0x8c, 0xb8, 0xc7, 0xd2, 0x119, 0x127}}, + 4: {lang: 0x529, script: 0x3c, maxScript: 0x3c, toRegion: 0x8e, fromRegion: []uint16{0xc7}}, } -// Total table size 30244 bytes (29KiB); checksum: B6B15F30 +// Total table size 30466 bytes (29KiB); checksum: 7544152B diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index 34a732b..a6573dc 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -23,31 +23,31 @@ const ( _419 = 31 _BR = 65 _CA = 73 - _ES = 110 - _GB = 123 - _MD = 188 - _PT = 238 - _UK = 306 - _US = 309 - _ZZ = 357 - _XA = 323 - _XC = 325 - _XK = 333 + _ES = 111 + _GB = 124 + _MD = 189 + _PT = 239 + _UK = 307 + _US = 310 + _ZZ = 358 + _XA = 324 + _XC = 326 + _XK = 334 ) const ( - _Latn = 90 + _Latn = 91 _Hani = 57 _Hans = 59 _Hant = 60 - _Qaaa = 147 - _Qaai = 155 - _Qabx = 196 - _Zinh = 252 - _Zyyy = 257 - _Zzzz = 258 + _Qaaa = 149 + _Qaai = 157 + _Qabx = 198 + _Zinh = 255 + _Zyyy = 260 + _Zzzz = 261 ) -var regionToGroups = []uint8{ // 358 elements +var regionToGroups = []uint8{ // 359 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -60,51 +60,51 @@ var regionToGroups = []uint8{ // 358 elements // Entry 40 - 7F 0x04, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, - 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, + 0x08, 0x00, 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, // Entry 80 - BF - 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, + 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, // Entry C0 - FF - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, - 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, + 0x01, 0x04, 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, // Entry 100 - 13F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, + 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, + 0x00, 0x00, 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, // Entry 140 - 17F 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} // Size: 382 bytes + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 383 bytes var paradigmLocales = [][3]uint16{ // 3 elements - 0: [3]uint16{0x139, 0x0, 0x7b}, + 0: [3]uint16{0x139, 0x0, 0x7c}, 1: [3]uint16{0x13e, 0x0, 0x1f}, - 2: [3]uint16{0x3c0, 0x41, 0xee}, + 2: [3]uint16{0x3c0, 0x41, 0xef}, } // Size: 42 bytes type mutualIntelligibility struct { @@ -249,30 +249,30 @@ var matchLang = []mutualIntelligibility{ // 113 elements // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. var matchScript = []scriptIntelligibility{ // 26 elements - 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5a, haveScript: 0x20, distance: 0x5}, - 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5a, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5a, distance: 0xa}, + 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x5b, haveScript: 0x20, distance: 0x5}, + 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x20, haveScript: 0x5b, distance: 0x5}, + 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 3: {wantLang: 0xa5, haveLang: 0x139, wantScript: 0xe, haveScript: 0x5b, distance: 0xa}, 4: {wantLang: 0x1d7, haveLang: 0x3e2, wantScript: 0x8, haveScript: 0x20, distance: 0xa}, - 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5a, distance: 0xa}, - 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4e, haveScript: 0x5a, distance: 0xa}, - 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x52, haveScript: 0x5a, distance: 0xa}, - 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x57, haveScript: 0x5a, distance: 0xa}, - 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6e, haveScript: 0x5a, distance: 0xa}, - 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x75, haveScript: 0x5a, distance: 0xa}, - 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5a, distance: 0xa}, - 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x81, haveScript: 0x5a, distance: 0xa}, - 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5a, distance: 0xa}, - 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd4, haveScript: 0x5a, distance: 0xa}, - 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe3, haveScript: 0x5a, distance: 0xa}, - 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5a, distance: 0xa}, - 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5a, distance: 0xa}, - 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5a, distance: 0xa}, - 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5a, haveScript: 0x20, distance: 0xa}, - 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5a, distance: 0xa}, + 5: {wantLang: 0x210, haveLang: 0x139, wantScript: 0x2e, haveScript: 0x5b, distance: 0xa}, + 6: {wantLang: 0x24a, haveLang: 0x139, wantScript: 0x4f, haveScript: 0x5b, distance: 0xa}, + 7: {wantLang: 0x251, haveLang: 0x139, wantScript: 0x53, haveScript: 0x5b, distance: 0xa}, + 8: {wantLang: 0x2b8, haveLang: 0x139, wantScript: 0x58, haveScript: 0x5b, distance: 0xa}, + 9: {wantLang: 0x304, haveLang: 0x139, wantScript: 0x6f, haveScript: 0x5b, distance: 0xa}, + 10: {wantLang: 0x331, haveLang: 0x139, wantScript: 0x76, haveScript: 0x5b, distance: 0xa}, + 11: {wantLang: 0x351, haveLang: 0x139, wantScript: 0x22, haveScript: 0x5b, distance: 0xa}, + 12: {wantLang: 0x395, haveLang: 0x139, wantScript: 0x83, haveScript: 0x5b, distance: 0xa}, + 13: {wantLang: 0x39d, haveLang: 0x139, wantScript: 0x36, haveScript: 0x5b, distance: 0xa}, + 14: {wantLang: 0x3be, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 15: {wantLang: 0x3fa, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 16: {wantLang: 0x40c, haveLang: 0x139, wantScript: 0xd6, haveScript: 0x5b, distance: 0xa}, + 17: {wantLang: 0x450, haveLang: 0x139, wantScript: 0xe6, haveScript: 0x5b, distance: 0xa}, + 18: {wantLang: 0x461, haveLang: 0x139, wantScript: 0xe9, haveScript: 0x5b, distance: 0xa}, + 19: {wantLang: 0x46f, haveLang: 0x139, wantScript: 0x2c, haveScript: 0x5b, distance: 0xa}, + 20: {wantLang: 0x476, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 21: {wantLang: 0x4b4, haveLang: 0x139, wantScript: 0x5, haveScript: 0x5b, distance: 0xa}, + 22: {wantLang: 0x4bc, haveLang: 0x3e2, wantScript: 0x5b, haveScript: 0x20, distance: 0xa}, + 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3e, haveScript: 0x5b, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3b, haveScript: 0x3c, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x3c, haveScript: 0x3b, distance: 0x13}, } // Size: 232 bytes @@ -295,4 +295,4 @@ var matchRegion = []regionIntelligibility{ // 15 elements 14: {lang: 0x529, script: 0x3c, group: 0x80, distance: 0x5}, } // Size: 114 bytes -// Total table size 1472 bytes (1KiB); checksum: F86C669 +// Total table size 1473 bytes (1KiB); checksum: 7BB90B5C diff --git a/vendor/modules.txt b/vendor/modules.txt index 9dc3b24..5230aad 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -8,7 +8,7 @@ github.com/alecthomas/template/parse # github.com/alecthomas/units v0.0.0-20211218093645-b94a6e3cc137 ## explicit; go 1.15 github.com/alecthomas/units -# github.com/armon/go-metrics v0.3.10 +# github.com/armon/go-metrics v0.4.1 ## explicit; go 1.12 github.com/armon/go-metrics # github.com/beorn7/perks v1.0.1 @@ -17,8 +17,8 @@ github.com/beorn7/perks/quantile # github.com/cespare/xxhash/v2 v2.2.0 ## explicit; go 1.11 github.com/cespare/xxhash/v2 -# github.com/fatih/color v1.9.0 -## explicit; go 1.13 +# github.com/fatih/color v1.14.1 +## explicit; go 1.17 github.com/fatih/color # github.com/felixge/httpsnoop v1.0.2 ## explicit; go 1.13 @@ -42,16 +42,16 @@ github.com/gorilla/handlers # github.com/gorilla/mux v1.8.0 ## explicit; go 1.12 github.com/gorilla/mux -# github.com/hashicorp/consul/api v1.21.0 +# github.com/hashicorp/consul/api v1.25.1 ## explicit; go 1.19 github.com/hashicorp/consul/api -# github.com/hashicorp/go-cleanhttp v0.5.1 -## explicit +# github.com/hashicorp/go-cleanhttp v0.5.2 +## explicit; go 1.13 github.com/hashicorp/go-cleanhttp -# github.com/hashicorp/go-hclog v0.14.1 +# github.com/hashicorp/go-hclog v1.5.0 ## explicit; go 1.13 github.com/hashicorp/go-hclog -# github.com/hashicorp/go-immutable-radix v1.3.0 +# github.com/hashicorp/go-immutable-radix v1.3.1 ## explicit github.com/hashicorp/go-immutable-radix # github.com/hashicorp/go-rootcerts v1.0.2 @@ -63,11 +63,11 @@ github.com/hashicorp/golang-lru/simplelru # github.com/hashicorp/serf v0.10.1 ## explicit; go 1.12 github.com/hashicorp/serf/coordinate -# github.com/mattn/go-colorable v0.1.6 -## explicit; go 1.13 +# github.com/mattn/go-colorable v0.1.13 +## explicit; go 1.15 github.com/mattn/go-colorable -# github.com/mattn/go-isatty v0.0.12 -## explicit; go 1.12 +# github.com/mattn/go-isatty v0.0.17 +## explicit; go 1.15 github.com/mattn/go-isatty # github.com/matttproud/golang_protobuf_extensions v1.0.4 ## explicit; go 1.9 @@ -81,7 +81,7 @@ github.com/maxbrunsfeld/counterfeiter/v6/generator # github.com/mitchellh/go-homedir v1.1.0 ## explicit github.com/mitchellh/go-homedir -# github.com/mitchellh/mapstructure v1.4.1 +# github.com/mitchellh/mapstructure v1.5.0 ## explicit; go 1.14 github.com/mitchellh/mapstructure # github.com/nxadm/tail v1.4.8 @@ -154,12 +154,16 @@ github.com/russross/blackfriday/v2 # github.com/sirupsen/logrus v1.9.3 ## explicit; go 1.13 github.com/sirupsen/logrus +# golang.org/x/exp v0.0.0-20230321023759-10a507213a29 +## explicit; go 1.18 +golang.org/x/exp/constraints +golang.org/x/exp/slices # golang.org/x/mod v0.8.0 ## explicit; go 1.17 golang.org/x/mod/internal/lazyregexp golang.org/x/mod/module golang.org/x/mod/semver -# golang.org/x/net v0.10.0 +# golang.org/x/net v0.13.0 ## explicit; go 1.17 golang.org/x/net/html golang.org/x/net/html/atom @@ -170,7 +174,7 @@ golang.org/x/sys/execabs golang.org/x/sys/internal/unsafeheader golang.org/x/sys/unix golang.org/x/sys/windows -# golang.org/x/text v0.9.0 +# golang.org/x/text v0.11.0 ## explicit; go 1.17 golang.org/x/text/encoding golang.org/x/text/encoding/charmap