diff --git a/nexus_constructor/common_attrs.py b/nexus_constructor/common_attrs.py index cbedf1a70..a3dfe1fa6 100644 --- a/nexus_constructor/common_attrs.py +++ b/nexus_constructor/common_attrs.py @@ -7,6 +7,7 @@ class CommonAttrs: NX_CLASS = "NX_class" DEPENDS_ON = "depends_on" TRANSFORMATION_TYPE = "transformation_type" + OFFSET_UNITS = "offset_units" VECTOR = "vector" UNITS = "units" VERTICES = "vertices" diff --git a/nexus_constructor/field_widget.py b/nexus_constructor/field_widget.py index 0eda46af7..292aa1edf 100644 --- a/nexus_constructor/field_widget.py +++ b/nexus_constructor/field_widget.py @@ -95,6 +95,9 @@ def __init__( ): super(FieldWidget, self).__init__(parent) + fix_horizontal_size = QSizePolicy() + fix_horizontal_size.setHorizontalPolicy(QSizePolicy.Fixed) + possible_field_names = [] self.default_field_types_dict = {} self.streams_widget: StreamFieldsWidget = None @@ -123,12 +126,10 @@ def __init__( self.unit_validator = UnitValidator() self.units_line_edit.setValidator(self.unit_validator) self.units_line_edit.setMinimumWidth(20) - self.units_line_edit.setMaximumWidth(50) unit_size_policy = QSizePolicy() unit_size_policy.setHorizontalPolicy(QSizePolicy.Preferred) unit_size_policy.setHorizontalStretch(1) self.units_line_edit.setSizePolicy(unit_size_policy) - self.unit_validator.is_valid.connect( partial(validate_line_edit, self.units_line_edit) ) @@ -140,9 +141,6 @@ def __init__( self.field_type_combo.currentTextChanged.connect( self._open_edit_dialog_if_stream ) - - fix_horizontal_size = QSizePolicy() - fix_horizontal_size.setHorizontalPolicy(QSizePolicy.Fixed) self.field_type_combo.setSizePolicy(fix_horizontal_size) self.value_type_combo: QComboBox = QComboBox() @@ -179,14 +177,17 @@ def __init__( self.attrs_button.clicked.connect(self.show_attrs_dialog) self.layout = QHBoxLayout() - self.layout.addWidget(self.field_name_edit) - self.layout.addWidget(self.field_type_combo) - self.layout.addWidget(self.value_line_edit) - self.layout.addWidget(self.nx_class_combo) - self.layout.addWidget(self.edit_button) - self.layout.addWidget(self.value_type_combo) - self.layout.addWidget(self.units_line_edit) - self.layout.addWidget(self.attrs_button) + for widget in [ + self.field_name_edit, + self.field_type_combo, + self.value_line_edit, + self.nx_class_combo, + self.edit_button, + self.value_type_combo, + self.units_line_edit, + self.attrs_button, + ]: + self.layout.addWidget(widget) self.layout.setAlignment(Qt.AlignLeft) self.setLayout(self.layout) @@ -437,7 +438,11 @@ def field_type_changed(self): self.edit_dialog = QDialog(parent=self) self.edit_dialog.setModal(True) self._set_up_value_validator(False) - if self.streams_widget and self.streams_widget._old_schema: + if ( + self._node_parent + and self.streams_widget + and self.streams_widget._old_schema + ): self._node_parent.add_stream_module(self.streams_widget._old_schema) if self.field_type == FieldType.scalar_dataset: self.set_visibility(True, False, False, True) diff --git a/nexus_constructor/json/transformation_reader.py b/nexus_constructor/json/transformation_reader.py index c41260d17..2d8a810f0 100644 --- a/nexus_constructor/json/transformation_reader.py +++ b/nexus_constructor/json/transformation_reader.py @@ -30,7 +30,7 @@ create_fw_module_object, ) from nexus_constructor.model.transformation import Transformation -from nexus_constructor.model.value_type import VALUE_TYPE_TO_NP, ValueTypes +from nexus_constructor.model.value_type import VALUE_TYPE_TO_NP from nexus_constructor.transformations_list import TransformationsList TRANSFORMATION_MAP = { @@ -176,7 +176,7 @@ def _find_attribute_in_list( :return: The value of the attribute if is is found in the list, otherwise the failure value is returned. """ attribute = _find_attribute_from_list_or_dict(attribute_name, attributes_list) - if not attribute and attribute_name not in [CommonAttrs.OFFSET]: + if not attribute: self.warnings.append( TransformDependencyMissing( f"Unable to find {attribute_name} attribute in transformation" @@ -301,6 +301,19 @@ def _create_transformations(self, json_transformations: list): vector = self._find_attribute_in_list( CommonAttrs.VECTOR, name, attributes, [0.0, 0.0, 0.0] ) + offset_vector = self._find_attribute_in_list( + CommonAttrs.OFFSET, name, attributes, [0.0, 0.0, 0.0] + ) + + offset_units = self._find_attribute_in_list( + CommonAttrs.OFFSET_UNITS, name, attributes + ) + if not offset_units: + if offset_vector is [0.0, 0.0, 0.0]: + continue + else: + offset_units = "" + # This attribute is allowed to be missing, missing is equivalent to the value "." which means # depends on origin (end of dependency chain) depends_on = _find_attribute_from_list_or_dict( @@ -337,12 +350,9 @@ def _create_transformations(self, json_transformations: list): vector=QVector3D(*vector), depends_on=None, values=values, + offset_vector=QVector3D(*offset_vector), + offset_units=offset_units, ) - offset = self._find_attribute_in_list(CommonAttrs.OFFSET, name, attributes) - if offset: - transform.attributes.set_attribute_value( - CommonAttrs.OFFSET, offset, ValueTypes.FLOAT - ) if depends_on not in DEPENDS_ON_IGNORE: depends_on_id = TransformId( *get_component_and_transform_name(depends_on) diff --git a/nexus_constructor/model/component.py b/nexus_constructor/model/component.py index 01bcf0737..680f154af 100644 --- a/nexus_constructor/model/component.py +++ b/nexus_constructor/model/component.py @@ -243,6 +243,8 @@ def add_rotation( type=ValueTypes.DOUBLE, ), target_pos: int = -1, + offset_vector: Optional[QVector3D] = None, + offset_units: str = "" ) -> Transformation: """ Note, currently assumes angle is in degrees @@ -263,6 +265,8 @@ def add_rotation( depends_on, values, target_pos, + offset_vector if offset_vector is not None else QVector3D(0.0, 0.0, 0.0), + offset_units ) def _create_and_add_transform( @@ -275,6 +279,8 @@ def _create_and_add_transform( depends_on: Transformation, values: Union[Dataset, Group, StreamModule], target_pos: int = -1, + offset_vector: Optional[QVector3D] = None, + offset_units: str = "", ) -> Transformation: if name is None: name = _generate_incremental_name(transformation_type, self.transforms) @@ -296,7 +302,10 @@ def _create_and_add_transform( transform.transform_type = transformation_type transform.ui_value = angle_or_magnitude transform.units = units + if offset_units != "": + transform.offset_units = offset_units transform.vector = vector + transform.offset_vector = offset_vector transform.depends_on = depends_on transform.parent_component = self if target_pos: diff --git a/nexus_constructor/model/transformation.py b/nexus_constructor/model/transformation.py index 1be0047b5..32fc30726 100644 --- a/nexus_constructor/model/transformation.py +++ b/nexus_constructor/model/transformation.py @@ -4,6 +4,7 @@ import numpy as np from PySide6.Qt3DCore import Qt3DCore from PySide6.QtGui import QMatrix4x4, QVector3D +from typing import Optional from nexus_constructor.common_attrs import ( CommonAttrs, @@ -38,6 +39,7 @@ class Transformation(Dataset): _dependents = attr.ib(type=list, init=False) _ui_value = attr.ib(type=float, default=None) _ui_scale_factor = attr.ib(type=float, default=1.0, init=False) + _ui_offset_scale_factor = attr.ib(type=float, default=1.0, init=False) @property def absolute_path(self): @@ -67,6 +69,23 @@ def vector(self, new_vector: QVector3D): vector_as_np_array = np.array([new_vector.x(), new_vector.y(), new_vector.z()]) self.attributes.set_attribute_value(CommonAttrs.VECTOR, vector_as_np_array) + @property + def offset_vector(self) -> QVector3D: + vector = self.attributes.get_attribute_value(CommonAttrs.OFFSET) + return ( + QVector3D(vector[0], vector[1], vector[2]) + if vector is not None + else QVector3D(0.0, 0.0, 0.0) + ) + + @offset_vector.setter + def offset_vector(self, new_vector: Optional[QVector3D]): + if new_vector: + vector_as_np_array = np.array( + [new_vector.x(), new_vector.y(), new_vector.z()] + ) + self.attributes.set_attribute_value(CommonAttrs.OFFSET, vector_as_np_array) + @property def ui_value(self) -> float: try: @@ -103,19 +122,18 @@ def qmatrix(self) -> QMatrix4x4: """ transform = Qt3DCore.QTransform() transform.matrix() - offset = self.attributes.get_attribute_value(CommonAttrs.OFFSET) - if not offset: - offset = 0.0 if self.transform_type == TransformationType.ROTATION: + # apply offset first to translate it, and then apply rotation + transform.setTranslation(self.offset_vector * self._ui_offset_scale_factor) quaternion = transform.fromAxisAndAngle( - self.vector, (self.ui_value + offset) * self._ui_scale_factor + self.vector, self.ui_value * self._ui_scale_factor ) + transform.setRotation(quaternion) elif self.transform_type == TransformationType.TRANSLATION: transform.setTranslation( - self.vector.normalized() - * (self.ui_value + offset) - * self._ui_scale_factor + self.vector.normalized() * self.ui_value * self._ui_scale_factor + + self.offset_vector * self._ui_offset_scale_factor ) else: raise ( @@ -132,6 +150,15 @@ def units(self, new_units): self._evaluate_ui_scale_factor(new_units) self.attributes.set_attribute_value(CommonAttrs.UNITS, new_units) + @property + def offset_units(self): + return self.attributes.get_attribute_value(CommonAttrs.OFFSET_UNITS) + + @offset_units.setter + def offset_units(self, new_units): + self._evaluate_ui_offset_scale_factor(new_units) + self.attributes.set_attribute_value(CommonAttrs.OFFSET_UNITS, new_units) + def _evaluate_ui_scale_factor(self, units): try: if self.transform_type == TransformationType.TRANSLATION: @@ -141,6 +168,9 @@ def _evaluate_ui_scale_factor(self, units): except Exception: pass + def _evaluate_ui_offset_scale_factor(self, units): + self._ui_offset_scale_factor = calculate_unit_conversion_factor(units, METRES) + @property def depends_on(self) -> "Transformation": return self.attributes.get_attribute_value(CommonAttrs.DEPENDS_ON) diff --git a/nexus_constructor/transformation_view.py b/nexus_constructor/transformation_view.py index 491be0514..dd7bb2d52 100644 --- a/nexus_constructor/transformation_view.py +++ b/nexus_constructor/transformation_view.py @@ -26,8 +26,7 @@ def __init__(self, parent: QWidget, transformation: Transformation, model: Model self.transformation_frame = UiTransformation(self) self.transformation = transformation self.transformation_parent = transformation.parent_component - current_vector = self.transformation.vector - self._fill_in_existing_fields(current_vector) + self._fill_in_existing_fields() self.transformation_frame.depends_on_text_box.setEnabled(False) self.disable() self._init_connections() @@ -37,23 +36,29 @@ def _init_connections(self): self.save_transformation_name ) - for box in self.transformation_frame.spinboxes[:-1]: + for box in self.transformation_frame.spinboxes: box.textChanged.connect(self.save_transformation_vector) + for box in self.transformation_frame.offset_spinboxes: + box.textChanged.connect(self.save_offset) + self.transformation_frame.magnitude_widget.value_line_edit.textChanged.connect( self.save_magnitude ) self.transformation_frame.magnitude_widget.units_line_edit.textChanged.connect( self.save_magnitude ) + self.transformation_frame.offset_units_line_edit.textChanged.connect( + self.save_offset + ) if self.model: self.model.signals.transformation_changed.connect(self.update_depends_on_ui) - def _fill_in_existing_fields(self, current_vector): + def _fill_in_existing_fields(self): self.transformation_frame.name_line_edit.setText(self.transformation.name) - self.transformation_frame.x_spinbox.setValue(current_vector.x()) - self.transformation_frame.y_spinbox.setValue(current_vector.y()) - self.transformation_frame.z_spinbox.setValue(current_vector.z()) + self.transformation_frame.x_spinbox.setValue(self.transformation.vector.x()) + self.transformation_frame.y_spinbox.setValue(self.transformation.vector.y()) + self.transformation_frame.z_spinbox.setValue(self.transformation.vector.z()) update_function = find_field_type(self.transformation.values) if update_function is not None: update_function( @@ -61,8 +66,14 @@ def _fill_in_existing_fields(self, current_vector): ) self.transformation_frame.magnitude_widget.units = self.transformation.units offset = self.transformation.attributes.get_attribute_value(CommonAttrs.OFFSET) - if offset: - self.transformation_frame.offset_box.setValue(offset) + if offset is not None: + self.transformation_frame.x_spinbox_offset.setValue(offset[0]) + self.transformation_frame.y_spinbox_offset.setValue(offset[1]) + self.transformation_frame.z_spinbox_offset.setValue(offset[2]) + if self.transformation.offset_units: + self.transformation_frame.offset_units_line_edit.setText( + self.transformation.offset_units + ) self.update_depends_on_ui() def disable(self): @@ -110,11 +121,12 @@ def save_transformation_name(self): self.model.signals.transformation_changed.emit() def save_offset(self): - offset_value = self.transformation_frame.offset_box.value() - if offset_value is not None: - self.transformation.attributes.set_attribute_value( - CommonAttrs.OFFSET, offset_value - ) + self.transformation.offset_vector = QVector3D( + *[spinbox.value() for spinbox in self.transformation_frame.offset_spinboxes] + ) + if self.transformation_frame.offset_units: + self.transformation.offset_units = self.transformation_frame.offset_units + self.model.signals.transformation_changed.emit() def save_all_changes(self): self.save_transformation_name() @@ -122,6 +134,12 @@ def save_all_changes(self): self.save_offset() self.save_magnitude() + def transformation_text(self, transformation_type): + self.transformation_frame.vector_label.setText("Vector") + self.transformation_frame.value_label.setText("Magnitude") + self.transformation_frame.offset_label.setText("Offset") + self.setTitle(transformation_type) + class EditTranslation(EditTransformation): def __init__(self, parent: QWidget, transformation: Transformation, model: Model): @@ -129,10 +147,7 @@ def __init__(self, parent: QWidget, transformation: Transformation, model: Model self.transformation_frame.magnitude_widget.unit_validator.expected_dimensionality = ( METRES ) - self.transformation_frame.vector_label.setText("Direction") - self.transformation_frame.value_label.setText("Distance (m)") - self.transformation_frame.offset_label.setText("Offset (m)") - self.setTitle(TransformationType.TRANSLATION) + self.transformation_text(TransformationType.TRANSLATION) class EditRotation(EditTransformation): @@ -141,10 +156,7 @@ def __init__(self, parent: QWidget, transformation: Transformation, model: Model self.transformation_frame.magnitude_widget.unit_validator.expected_dimensionality = ( RADIANS ) - self.transformation_frame.vector_label.setText("Rotation Axis") - self.transformation_frame.value_label.setText("Angle (°)") - self.transformation_frame.offset_label.setText("Offset (°)") - self.setTitle(TransformationType.ROTATION) + self.transformation_text(TransformationType.ROTATION) def links_back_to_component(reference: Component, comparison: Component): diff --git a/nx-class-documentation/html/index.html b/nx-class-documentation/html/index.html index 5eca86784..1c0524cf4 100644 --- a/nx-class-documentation/html/index.html +++ b/nx-class-documentation/html/index.html @@ -109,7 +109,7 @@

User Manual and Reference Documentation

Publishing Information

-

This manual built Oct 12, 2023.

+

This manual built Oct 25, 2023.

See also

This document is available in these formats online:

diff --git a/nx-class-documentation/html/searchindex.js b/nx-class-documentation/html/searchindex.js index b9bd229a7..23e23de7a 100644 --- a/nx-class-documentation/html/searchindex.js +++ b/nx-class-documentation/html/searchindex.js @@ -1 +1 @@ -Search.setIndex({"docnames": ["applying-nexus", "authorgroup", "classes/applications/NXarchive", "classes/applications/NXarpes", "classes/applications/NXcanSAS", "classes/applications/NXdirecttof", "classes/applications/NXfluo", "classes/applications/NXindirecttof", "classes/applications/NXiqproc", "classes/applications/NXlauetof", "classes/applications/NXmonopd", "classes/applications/NXmx", "classes/applications/NXrefscan", "classes/applications/NXreftof", "classes/applications/NXsas", "classes/applications/NXsastof", "classes/applications/NXscan", "classes/applications/NXspe", "classes/applications/NXsqom", "classes/applications/NXstxm", "classes/applications/NXtas", "classes/applications/NXtofnpd", "classes/applications/NXtofraw", "classes/applications/NXtofsingle", "classes/applications/NXtomo", "classes/applications/NXtomophase", "classes/applications/NXtomoproc", "classes/applications/NXxas", "classes/applications/NXxasproc", "classes/applications/NXxbase", "classes/applications/NXxeuler", "classes/applications/NXxkappa", "classes/applications/NXxlaue", "classes/applications/NXxlaueplate", "classes/applications/NXxnb", "classes/applications/NXxrot", "classes/applications/index", "classes/base_classes/NXaperture", "classes/base_classes/NXattenuator", "classes/base_classes/NXbeam", "classes/base_classes/NXbeam_stop", "classes/base_classes/NXbending_magnet", "classes/base_classes/NXcapillary", "classes/base_classes/NXcite", "classes/base_classes/NXcollection", "classes/base_classes/NXcollimator", "classes/base_classes/NXcrystal", "classes/base_classes/NXcylindrical_geometry", "classes/base_classes/NXdata", "classes/base_classes/NXdetector", "classes/base_classes/NXdetector_group", "classes/base_classes/NXdetector_module", "classes/base_classes/NXdisk_chopper", "classes/base_classes/NXentry", "classes/base_classes/NXenvironment", "classes/base_classes/NXevent_data", "classes/base_classes/NXfermi_chopper", "classes/base_classes/NXfilter", "classes/base_classes/NXflipper", "classes/base_classes/NXfresnel_zone_plate", "classes/base_classes/NXgeometry", "classes/base_classes/NXgrating", "classes/base_classes/NXguide", "classes/base_classes/NXinsertion_device", "classes/base_classes/NXinstrument", "classes/base_classes/NXlog", "classes/base_classes/NXmirror", "classes/base_classes/NXmoderator", "classes/base_classes/NXmonitor", "classes/base_classes/NXmonochromator", "classes/base_classes/NXnote", "classes/base_classes/NXobject", "classes/base_classes/NXoff_geometry", "classes/base_classes/NXorientation", "classes/base_classes/NXparameters", "classes/base_classes/NXpdb", "classes/base_classes/NXpinhole", "classes/base_classes/NXpolarizer", "classes/base_classes/NXpositioner", "classes/base_classes/NXprocess", "classes/base_classes/NXreflections", "classes/base_classes/NXroot", "classes/base_classes/NXsample", "classes/base_classes/NXsample_component", "classes/base_classes/NXsensor", "classes/base_classes/NXshape", "classes/base_classes/NXslit", "classes/base_classes/NXsource", "classes/base_classes/NXsubentry", "classes/base_classes/NXtransformations", "classes/base_classes/NXtranslation", "classes/base_classes/NXuser", "classes/base_classes/NXvelocity_selector", "classes/base_classes/NXxraylens", "classes/base_classes/index", "classes/contributed_definitions/NXcontainer", "classes/contributed_definitions/NXcsg", "classes/contributed_definitions/NXcxi_ptycho", "classes/contributed_definitions/NXelectrostatic_kicker", "classes/contributed_definitions/NXmagnetic_kicker", "classes/contributed_definitions/NXquadric", "classes/contributed_definitions/NXquadrupole_magnet", "classes/contributed_definitions/NXseparator", "classes/contributed_definitions/NXsnsevent", "classes/contributed_definitions/NXsnshisto", "classes/contributed_definitions/NXsolenoid_magnet", "classes/contributed_definitions/NXsolid_geometry", "classes/contributed_definitions/NXspecdata", "classes/contributed_definitions/NXspin_rotator", "classes/contributed_definitions/index", "classes/index", "colophon", "community", "copyright", "datarules", "defs_intro", "design", "docs_about", "examples/code_napi", "examples/code_native", "examples/epics/index", "examples/h5py/index", "examples/h5py/writer_1_3", "examples/h5py/writer_2_1", "examples/index", "examples/lrmecs/index", "examples/matlab/index", "faq", "fileformat", "github", "history", "index", "installation", "introduction", "introduction-napi", "issues", "mailinglist", "motivations", "napi", "napi-c", "napi-f77", "napi-f90", "napi-idl", "napi-java", "niac", "nxdl", "nxdl-types", "nxdl_desc", "preface", "ref_doc", "revhistory", "rules", "strategies", "user_manual", "utilities", "validation"], "filenames": ["applying-nexus.rst", "authorgroup.rst", "classes/applications/NXarchive.rst", "classes/applications/NXarpes.rst", "classes/applications/NXcanSAS.rst", "classes/applications/NXdirecttof.rst", "classes/applications/NXfluo.rst", "classes/applications/NXindirecttof.rst", "classes/applications/NXiqproc.rst", "classes/applications/NXlauetof.rst", "classes/applications/NXmonopd.rst", "classes/applications/NXmx.rst", "classes/applications/NXrefscan.rst", "classes/applications/NXreftof.rst", "classes/applications/NXsas.rst", "classes/applications/NXsastof.rst", "classes/applications/NXscan.rst", "classes/applications/NXspe.rst", "classes/applications/NXsqom.rst", "classes/applications/NXstxm.rst", "classes/applications/NXtas.rst", "classes/applications/NXtofnpd.rst", "classes/applications/NXtofraw.rst", "classes/applications/NXtofsingle.rst", "classes/applications/NXtomo.rst", "classes/applications/NXtomophase.rst", "classes/applications/NXtomoproc.rst", "classes/applications/NXxas.rst", "classes/applications/NXxasproc.rst", "classes/applications/NXxbase.rst", "classes/applications/NXxeuler.rst", "classes/applications/NXxkappa.rst", "classes/applications/NXxlaue.rst", "classes/applications/NXxlaueplate.rst", "classes/applications/NXxnb.rst", "classes/applications/NXxrot.rst", "classes/applications/index.rst", "classes/base_classes/NXaperture.rst", "classes/base_classes/NXattenuator.rst", "classes/base_classes/NXbeam.rst", "classes/base_classes/NXbeam_stop.rst", "classes/base_classes/NXbending_magnet.rst", "classes/base_classes/NXcapillary.rst", "classes/base_classes/NXcite.rst", "classes/base_classes/NXcollection.rst", "classes/base_classes/NXcollimator.rst", "classes/base_classes/NXcrystal.rst", "classes/base_classes/NXcylindrical_geometry.rst", "classes/base_classes/NXdata.rst", "classes/base_classes/NXdetector.rst", "classes/base_classes/NXdetector_group.rst", "classes/base_classes/NXdetector_module.rst", "classes/base_classes/NXdisk_chopper.rst", "classes/base_classes/NXentry.rst", "classes/base_classes/NXenvironment.rst", "classes/base_classes/NXevent_data.rst", "classes/base_classes/NXfermi_chopper.rst", "classes/base_classes/NXfilter.rst", "classes/base_classes/NXflipper.rst", "classes/base_classes/NXfresnel_zone_plate.rst", "classes/base_classes/NXgeometry.rst", "classes/base_classes/NXgrating.rst", "classes/base_classes/NXguide.rst", "classes/base_classes/NXinsertion_device.rst", "classes/base_classes/NXinstrument.rst", "classes/base_classes/NXlog.rst", "classes/base_classes/NXmirror.rst", "classes/base_classes/NXmoderator.rst", "classes/base_classes/NXmonitor.rst", "classes/base_classes/NXmonochromator.rst", "classes/base_classes/NXnote.rst", "classes/base_classes/NXobject.rst", "classes/base_classes/NXoff_geometry.rst", "classes/base_classes/NXorientation.rst", "classes/base_classes/NXparameters.rst", "classes/base_classes/NXpdb.rst", "classes/base_classes/NXpinhole.rst", "classes/base_classes/NXpolarizer.rst", "classes/base_classes/NXpositioner.rst", "classes/base_classes/NXprocess.rst", "classes/base_classes/NXreflections.rst", "classes/base_classes/NXroot.rst", "classes/base_classes/NXsample.rst", "classes/base_classes/NXsample_component.rst", "classes/base_classes/NXsensor.rst", "classes/base_classes/NXshape.rst", "classes/base_classes/NXslit.rst", "classes/base_classes/NXsource.rst", "classes/base_classes/NXsubentry.rst", "classes/base_classes/NXtransformations.rst", "classes/base_classes/NXtranslation.rst", "classes/base_classes/NXuser.rst", "classes/base_classes/NXvelocity_selector.rst", "classes/base_classes/NXxraylens.rst", "classes/base_classes/index.rst", "classes/contributed_definitions/NXcontainer.rst", "classes/contributed_definitions/NXcsg.rst", "classes/contributed_definitions/NXcxi_ptycho.rst", "classes/contributed_definitions/NXelectrostatic_kicker.rst", "classes/contributed_definitions/NXmagnetic_kicker.rst", "classes/contributed_definitions/NXquadric.rst", "classes/contributed_definitions/NXquadrupole_magnet.rst", "classes/contributed_definitions/NXseparator.rst", "classes/contributed_definitions/NXsnsevent.rst", "classes/contributed_definitions/NXsnshisto.rst", "classes/contributed_definitions/NXsolenoid_magnet.rst", "classes/contributed_definitions/NXsolid_geometry.rst", "classes/contributed_definitions/NXspecdata.rst", "classes/contributed_definitions/NXspin_rotator.rst", "classes/contributed_definitions/index.rst", "classes/index.rst", "colophon.rst", "community.rst", "copyright.rst", "datarules.rst", "defs_intro.rst", "design.rst", "docs_about.rst", "examples/code_napi.rst", "examples/code_native.rst", "examples/epics/index.rst", "examples/h5py/index.rst", "examples/h5py/writer_1_3.rst", "examples/h5py/writer_2_1.rst", "examples/index.rst", "examples/lrmecs/index.rst", "examples/matlab/index.rst", "faq.rst", "fileformat.rst", "github.rst", "history.rst", "index.rst", "installation.rst", "introduction.rst", "introduction-napi.rst", "issues.rst", "mailinglist.rst", "motivations.rst", "napi.rst", "napi-c.rst", "napi-f77.rst", "napi-f90.rst", "napi-idl.rst", "napi-java.rst", "niac.rst", "nxdl.rst", "nxdl-types.rst", "nxdl_desc.rst", "preface.rst", "ref_doc.rst", "revhistory.rst", "rules.rst", "strategies.rst", "user_manual.rst", "utilities.rst", "validation.rst"], "titles": ["1.3. Constructing NeXus Files and Application Definitions", "9.1. Authors", "3.3.2.1. NXarchive", "3.3.2.2. NXarpes", "3.3.2.3. NXcanSAS", "3.3.2.4. NXdirecttof", "3.3.2.5. NXfluo", "3.3.2.6. NXindirecttof", "3.3.2.7. NXiqproc", "3.3.2.8. NXlauetof", "3.3.2.9. NXmonopd", "3.3.2.10. NXmx", "3.3.2.11. NXrefscan", "3.3.2.12. NXreftof", "3.3.2.13. NXsas", "3.3.2.14. NXsastof", "3.3.2.15. NXscan", "3.3.2.16. NXspe", "3.3.2.17. NXsqom", "3.3.2.18. NXstxm", "3.3.2.19. NXtas", "3.3.2.20. NXtofnpd", "3.3.2.21. NXtofraw", "3.3.2.22. NXtofsingle", "3.3.2.23. NXtomo", "3.3.2.24. NXtomophase", "3.3.2.25. NXtomoproc", "3.3.2.26. NXxas", "3.3.2.27. NXxasproc", "3.3.2.28. NXxbase", "3.3.2.29. NXxeuler", "3.3.2.30. NXxkappa", "3.3.2.31. NXxlaue", "3.3.2.32. NXxlaueplate", "3.3.2.33. NXxnb", "3.3.2.34. NXxrot", "3.3.2. Application Definitions", "3.3.1.1. NXaperture", "3.3.1.2. NXattenuator", "3.3.1.3. NXbeam", "3.3.1.4. NXbeam_stop", "3.3.1.5. NXbending_magnet", "3.3.1.6. NXcapillary", "3.3.1.7. NXcite", "3.3.1.8. NXcollection", "3.3.1.9. NXcollimator", "3.3.1.10. NXcrystal", "3.3.1.11. NXcylindrical_geometry", "3.3.1.12. NXdata", "3.3.1.13. NXdetector", "3.3.1.14. NXdetector_group", "3.3.1.15. NXdetector_module", "3.3.1.16. NXdisk_chopper", "3.3.1.17. NXentry", "3.3.1.18. NXenvironment", "3.3.1.19. NXevent_data", "3.3.1.20. NXfermi_chopper", "3.3.1.21. NXfilter", "3.3.1.22. NXflipper", "3.3.1.23. NXfresnel_zone_plate", "3.3.1.24. NXgeometry", "3.3.1.25. NXgrating", "3.3.1.26. NXguide", "3.3.1.27. NXinsertion_device", "3.3.1.28. NXinstrument", "3.3.1.29. NXlog", "3.3.1.30. NXmirror", "3.3.1.31. NXmoderator", "3.3.1.32. NXmonitor", "3.3.1.33. NXmonochromator", "3.3.1.34. NXnote", "3.3.1.35. NXobject", "3.3.1.36. NXoff_geometry", "3.3.1.37. NXorientation", "3.3.1.38. NXparameters", "3.3.1.39. NXpdb", "3.3.1.40. NXpinhole", "3.3.1.41. NXpolarizer", "3.3.1.42. NXpositioner", "3.3.1.43. NXprocess", "3.3.1.44. NXreflections", "3.3.1.45. NXroot", "3.3.1.46. NXsample", "3.3.1.47. NXsample_component", "3.3.1.48. NXsensor", "3.3.1.49. NXshape", "3.3.1.50. NXslit", "3.3.1.51. NXsource", "3.3.1.52. NXsubentry", "3.3.1.53. NXtransformations", "3.3.1.54. NXtranslation", "3.3.1.55. NXuser", "3.3.1.56. NXvelocity_selector", "3.3.1.57. NXxraylens", "3.3.1. Base Class Definitions", "3.3.3.1. NXcontainer", "3.3.3.2. NXcsg", "3.3.3.3. NXcxi_ptycho", "3.3.3.4. NXelectrostatic_kicker", "3.3.3.5. NXmagnetic_kicker", "3.3.3.6. NXquadric", "3.3.3.7. NXquadrupole_magnet", "3.3.3.8. NXseparator", "3.3.3.9. NXsnsevent", "3.3.3.10. NXsnshisto", "3.3.3.11. NXsolenoid_magnet", "3.3.3.12. NXsolid_geometry", "3.3.3.13. NXspecdata", "3.3.3.14. NXspin_rotator", "3.3.3. Contributed Definitions", "3.3. NeXus Class Definitions", "9.2. Colophon", "5. NeXus Community", "9.4. Copyright and Licenses", "1.2.3.2. Rules for Storing Data Items in NeXus Files", "3.1. Introduction to NeXus definitions", "1.2. NeXus Design", "9. About these docs", "2.2.1. Example NeXus programs using NAPI", "2.1.1. Example NeXus C programs using native HDF5 commands", "2.1.5. EPICS Area Detector Examples", "2.1.2. Python Examples using h5py", "h5py example writing the simplest NeXus data file", "h5py example writing a simple NeXus data file with links", "2. Examples of writing and reading NeXus data files", "2.1.4. Viewing 2-D Data from LRMECS", "2.1.3. MATLAB Examples", "1.6. Frequently Asked Questions", "1.2.3.3. Physical File format", "5.3.6. NeXus Repositories", "8. Brief history of NeXus", "User Manual and Reference Documentation", "6. Installation", "1.1. NeXus Introduction", "NAPI: The NeXus Application Programming Interface", "5.3.7. NeXus Issue Reporting", "5.3.2. NeXus Mailing List", "Motivations for the NeXus standard in the Scientific Community", "4. NAPI: NeXus Application Programmer Interface (frozen)", "4.3.1. NAPI C and C++ Interface", "4.3.2. NAPI Fortran 77 Interface", "4.3.3. NAPI Fortran 90 Interface", "4.3.5. NAPI IDL Interface", "4.3.4. NAPI Java Interface", "5.3.1. NIAC: The NeXus International Advisory Committee", "3.2. NXDL: The NeXus Definition Language", "3.2.1.2. NXDL Field Types and Units", "3.2.1.1. NXDL Elements and Field Types", "Representation of data examples", "3. NeXus: Reference Documentation", "9.3. Revision History", "1.2.3.1. Rules for Structuring Information in NeXus Files", "1.4. Strategies for storing information in NeXus data files", "1. NeXus: User Manual", "7. NeXus Utilities", "1.5. Verification and validation of files"], "terms": {"In": [0, 4, 11, 16, 21, 22, 23, 24, 25, 29, 36, 37, 38, 47, 49, 53, 55, 65, 72, 75, 82, 83, 88, 89, 95, 110, 114, 115, 116, 119, 120, 121, 122, 123, 124, 125, 127, 128, 130, 132, 133, 134, 136, 137, 138, 143, 144, 145, 146, 147, 148, 151, 152, 154], "design": [0, 4, 48, 89, 112, 114, 115, 123, 126, 128, 130, 131, 136, 137, 145, 146, 153, 154], "we": [0, 4, 5, 11, 50, 52, 60, 73, 82, 83, 90, 114, 116, 118, 120, 121, 123, 124, 125, 126, 127, 128, 130, 133, 134, 136, 147, 148, 151, 152], "discuss": [0, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 112, 114, 116, 130, 133, 136, 152, 154], "format": [0, 2, 4, 17, 36, 43, 53, 65, 72, 88, 91, 97, 107, 112, 114, 115, 118, 120, 121, 124, 125, 127, 130, 131, 133, 136, 138, 143, 144, 147, 148, 152, 154, 155], "gener": [0, 2, 4, 8, 11, 16, 18, 19, 22, 23, 36, 44, 49, 53, 60, 62, 73, 78, 85, 88, 89, 90, 94, 109, 110, 113, 114, 115, 116, 119, 120, 122, 123, 124, 129, 132, 133, 136, 137, 138, 145, 146, 147, 154], "term": [0, 4, 36, 44, 46, 49, 74, 89, 94, 109, 110, 113, 114, 115, 127, 132, 133, 145, 146, 147, 152], "section": [0, 4, 11, 38, 48, 50, 53, 62, 88, 107, 114, 115, 116, 118, 120, 121, 122, 123, 124, 127, 128, 132, 133, 134, 137, 143, 146, 147, 151, 152, 154], "more": [0, 3, 4, 11, 16, 19, 29, 48, 49, 52, 53, 62, 75, 76, 81, 86, 88, 89, 91, 107, 110, 114, 115, 116, 120, 121, 122, 125, 127, 133, 134, 137, 143, 144, 145, 146, 147, 151, 154, 155], "tutori": [0, 127, 143, 145], "style": [0, 97, 107, 116, 126, 134, 154], "introduct": [0, 11, 116, 119, 121, 122, 124, 131, 143, 149, 153], "how": [0, 4, 11, 46, 48, 49, 53, 59, 79, 85, 88, 95, 107, 111, 112, 114, 116, 118, 119, 120, 121, 122, 127, 128, 132, 133, 137, 143, 145, 147, 148, 152], "i": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 100, 103, 104, 107, 109, 110, 111, 112, 113, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 135, 136, 137, 138, 139, 141, 142, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "given": [0, 11, 16, 36, 39, 49, 50, 51, 62, 66, 82, 89, 94, 100, 109, 114, 115, 116, 119, 120, 121, 127, 133, 147, 154, 155], "As": [0, 11, 18, 55, 82, 83, 95, 110, 112, 114, 116, 121, 122, 125, 127, 133, 137, 141, 143, 148, 151], "exampl": [0, 4, 11, 16, 43, 46, 47, 48, 49, 50, 53, 62, 65, 72, 75, 84, 87, 88, 89, 95, 97, 107, 110, 111, 113, 115, 116, 125, 127, 128, 131, 134, 137, 138, 143, 145, 146, 147, 151, 152, 154], "hypothet": [0, 88, 95, 123, 152], "name": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 45, 48, 49, 50, 53, 54, 60, 64, 70, 75, 78, 79, 80, 81, 82, 83, 84, 87, 88, 89, 91, 95, 97, 103, 104, 107, 110, 116, 118, 119, 120, 121, 122, 125, 126, 127, 128, 130, 133, 134, 137, 138, 141, 143, 145, 148, 151, 154], "If": [0, 4, 11, 19, 21, 22, 23, 38, 46, 47, 48, 49, 53, 55, 57, 59, 65, 72, 75, 76, 80, 82, 83, 86, 88, 89, 95, 110, 111, 114, 115, 116, 120, 127, 129, 132, 133, 134, 138, 143, 145, 146, 147, 148, 151, 152], "you": [0, 4, 110, 111, 114, 116, 118, 119, 120, 122, 125, 127, 129, 132, 133, 134, 136, 138, 143, 145, 147, 148, 151, 152, 154], "ar": [0, 4, 8, 10, 11, 16, 19, 24, 25, 29, 30, 34, 36, 40, 46, 47, 48, 49, 50, 52, 55, 57, 60, 62, 64, 65, 68, 69, 72, 73, 75, 80, 82, 83, 84, 85, 88, 89, 90, 91, 94, 95, 97, 107, 110, 112, 113, 115, 116, 118, 119, 120, 121, 122, 123, 124, 126, 127, 128, 129, 132, 133, 134, 135, 136, 137, 138, 140, 141, 142, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "look": [0, 48, 116, 123, 127, 128, 143, 145, 152], "read": [0, 4, 11, 48, 49, 55, 68, 70, 82, 84, 98, 99, 101, 102, 105, 108, 114, 116, 118, 120, 127, 128, 130, 131, 133, 138, 145, 148, 151, 154], "write": [0, 4, 11, 16, 36, 48, 81, 107, 110, 114, 116, 127, 128, 130, 131, 133, 137, 138, 152, 154], "api": [0, 81, 114, 119, 123, 128, 130, 131, 132, 133, 134, 137, 140, 141, 142], "consult": [0, 114, 125, 127, 143], "napi": [0, 81, 112, 114, 116, 119, 121, 122, 127, 128, 130, 131, 132, 133, 146, 147, 154, 155], "programm": [0, 112, 114, 116, 124, 127, 128, 130, 131, 133, 134, 143, 147], "interfac": [0, 112, 116, 118, 119, 124, 126, 128, 130, 131, 133, 136, 144, 154], "frozen": [0, 107, 124, 131, 134], "chapter": [0, 114, 116, 119, 121, 122, 123, 124, 126, 128, 133, 134, 145, 152], "For": [0, 4, 11, 16, 20, 24, 43, 44, 47, 48, 49, 50, 53, 57, 62, 69, 75, 76, 83, 84, 85, 86, 87, 88, 89, 90, 94, 95, 97, 107, 110, 114, 115, 116, 118, 121, 125, 127, 128, 132, 133, 134, 137, 142, 143, 144, 145, 147, 148, 151, 152], "code": [0, 50, 54, 60, 79, 84, 91, 112, 113, 114, 118, 119, 122, 123, 129, 131, 134, 137, 138, 139, 140, 141, 142, 143, 152, 154], "refer": [0, 4, 9, 37, 38, 40, 43, 45, 48, 49, 52, 60, 62, 66, 67, 68, 73, 76, 80, 86, 87, 94, 95, 107, 111, 114, 115, 116, 120, 121, 122, 123, 124, 127, 128, 133, 143, 144, 147, 148, 151], "altern": [0, 4, 11, 48, 50, 51, 53, 54, 114, 116, 120, 132, 147], "c": [0, 9, 29, 46, 47, 57, 67, 82, 83, 87, 95, 107, 113, 115, 116, 124, 125, 128, 130, 134, 138, 141, 143, 146, 147, 154, 155], "program": [0, 2, 8, 17, 18, 26, 28, 36, 53, 54, 79, 81, 84, 88, 114, 115, 116, 120, 121, 122, 124, 125, 127, 130, 131, 133, 136, 137, 141, 144, 145, 148, 151, 154, 155], "nativ": [0, 118, 124, 128, 134, 137, 138, 143], "hdf5": [0, 4, 81, 89, 97, 107, 110, 114, 115, 116, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 133, 134, 137, 138, 143, 147, 148, 152, 155], "command": [0, 78, 103, 104, 107, 118, 121, 122, 124, 125, 128, 132, 134, 138, 143, 154], "further": [0, 4, 8, 11, 48, 50, 114, 116, 121, 133, 134, 142, 145, 147, 151, 154], "also": [0, 4, 11, 36, 48, 60, 62, 64, 65, 68, 74, 76, 86, 89, 95, 110, 114, 115, 116, 119, 120, 121, 124, 125, 126, 127, 131, 133, 134, 137, 138, 143, 145, 147, 148, 151, 152, 154], "some": [0, 4, 11, 24, 25, 26, 29, 36, 46, 49, 53, 65, 88, 107, 112, 114, 115, 116, 119, 120, 121, 122, 123, 127, 128, 133, 134, 143, 147, 148, 151, 152, 154, 155], "python": [0, 81, 107, 114, 122, 123, 124, 126, 128, 130, 133, 134, 137, 138, 155], "h5py": [0, 81, 107, 114, 124, 126, 128, 133, 137, 154], "packag": [0, 4, 81, 107, 121, 122, 124, 125, 127, 132, 133, 154], "consid": [0, 4, 36, 46, 62, 87, 94, 109, 110, 114, 116, 127, 147, 148, 151, 152], "yourself": [0, 127, 134, 143], "respons": [0, 48, 91, 116, 133, 152], "task": [0, 18, 137], "ensur": [0, 97, 114, 138, 144, 145, 155], "record": [0, 4, 11, 24, 46, 52, 55, 65, 78, 80, 82, 83, 94, 133, 137, 138, 151], "accord": [0, 2, 9, 16, 29, 85, 97, 110, 112, 114, 122, 123, 126, 127, 144, 154], "sake": 0, "simplic": [0, 121], "bear": 0, "strong": [0, 80], "resembl": 0, "simpl": [0, 46, 57, 76, 79, 80, 82, 86, 94, 114, 115, 121, 122, 124, 125, 126, 127, 128, 134, 138, 145, 147, 148, 152, 154], "powder": [0, 10, 21, 22, 23, 36, 82, 116, 151], "diffractomet": [0, 9, 10, 21, 30, 31, 34, 36, 64, 82, 89, 107, 116, 151], "let": [0, 9, 29, 52, 120, 121, 143, 151, 152], "": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 36, 48, 49, 57, 62, 82, 84, 87, 95, 107, 110, 114, 116, 119, 120, 121, 126, 127, 130, 132, 143, 146, 147, 148, 151], "pretend": 0, "cannot": [0, 4, 110, 114, 118, 143, 146, 147, 151], "ani": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 36, 37, 38, 40, 42, 44, 45, 46, 47, 48, 49, 52, 53, 57, 58, 59, 61, 62, 63, 66, 67, 68, 70, 72, 81, 82, 83, 84, 85, 87, 88, 89, 93, 94, 95, 96, 97, 100, 107, 109, 111, 114, 116, 120, 125, 127, 129, 133, 134, 136, 137, 138, 141, 145, 146, 147, 151, 152, 154, 155], "exist": [0, 4, 16, 48, 53, 62, 81, 88, 107, 114, 116, 121, 123, 126, 137, 138, 147, 154], "fiction": 0, "collim": [0, 4, 14, 15, 45, 64, 94, 133], "monochrom": [0, 3, 6, 12, 14, 19, 20, 27, 29, 46, 61, 64, 69, 94, 116, 147, 151, 152], "illumin": 0, "sampl": [0, 2, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 38, 39, 46, 49, 53, 60, 64, 68, 75, 82, 83, 84, 87, 88, 89, 90, 94, 95, 97, 103, 104, 107, 109, 114, 116, 127, 133, 134, 143, 147, 148, 151, 152], "neutron": [0, 1, 2, 4, 8, 10, 11, 12, 14, 15, 18, 20, 21, 24, 25, 26, 29, 36, 39, 47, 52, 53, 55, 58, 62, 67, 68, 87, 92, 94, 103, 104, 109, 112, 116, 127, 128, 130, 133, 134, 136, 137, 144, 145, 146, 152, 154], "select": [0, 3, 5, 11, 48, 56, 69, 84, 104, 114, 115, 125, 137, 147, 148, 151, 152], "wavelength": [0, 4, 6, 10, 11, 12, 14, 29, 32, 39, 46, 49, 52, 56, 57, 62, 63, 66, 68, 69, 82, 83, 87, 92, 94, 95, 103, 104, 116, 127, 133, 146, 147, 148], "diffract": [0, 10, 46, 61, 69, 80, 94, 107, 116, 151], "beam": [0, 4, 10, 11, 14, 15, 19, 24, 25, 27, 32, 34, 35, 36, 38, 39, 40, 41, 42, 44, 46, 49, 52, 53, 56, 57, 60, 61, 62, 63, 64, 68, 76, 82, 84, 87, 88, 92, 93, 94, 95, 97, 107, 114, 116, 121, 152], "collect": [0, 2, 4, 11, 14, 49, 53, 64, 84, 88, 89, 94, 95, 103, 104, 107, 116, 120, 121, 151, 152, 154], "larg": [0, 116, 127, 128, 147, 152, 154], "banana": 0, "shape": [0, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 40, 45, 46, 47, 48, 49, 52, 60, 61, 62, 66, 67, 72, 85, 87, 94, 95, 97, 103, 104, 114, 115, 147], "posit": [0, 4, 10, 11, 14, 15, 18, 19, 21, 22, 23, 24, 35, 37, 38, 40, 41, 42, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 72, 73, 76, 77, 78, 80, 82, 84, 86, 87, 88, 89, 90, 92, 93, 95, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116, 123, 138, 146, 147, 151, 152], "sensit": [0, 10, 121], "detector": [0, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 29, 30, 31, 33, 34, 35, 36, 40, 43, 47, 49, 50, 51, 53, 55, 64, 68, 72, 80, 82, 88, 89, 94, 97, 103, 104, 107, 115, 118, 121, 123, 124, 126, 133, 137, 147, 148, 152], "typic": [0, 4, 11, 19, 46, 49, 93, 94, 107, 115, 116, 133], "like": [0, 4, 10, 11, 16, 18, 39, 49, 54, 82, 83, 94, 114, 116, 119, 126, 127, 129, 133, 143, 146, 151, 152], "plot": [0, 4, 19, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 114, 120, 123, 126, 127, 130, 133, 147, 148, 151, 152, 154], "from": [0, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 41, 46, 48, 49, 52, 53, 55, 57, 64, 68, 70, 74, 75, 80, 81, 82, 83, 87, 88, 89, 94, 95, 97, 98, 99, 101, 102, 103, 104, 105, 107, 108, 109, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 126, 127, 130, 131, 132, 133, 134, 137, 138, 141, 142, 143, 145, 146, 147, 151, 152, 154, 155], "hyne": 0, "There": [0, 4, 24, 48, 55, 65, 88, 89, 97, 112, 114, 116, 120, 127, 130, 133, 134, 136, 145, 146, 148, 151, 154], "background": [0, 11, 49, 80, 133], "plu": [0, 18, 30, 31, 34, 35, 41], "quit": [0, 114, 121, 127, 130, 134, 145, 152], "number": [0, 3, 4, 6, 7, 8, 9, 10, 11, 12, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 41, 46, 47, 48, 49, 50, 51, 52, 53, 54, 56, 57, 58, 62, 63, 72, 73, 79, 80, 81, 82, 83, 84, 87, 88, 91, 92, 93, 95, 97, 103, 104, 107, 112, 116, 122, 124, 127, 128, 130, 133, 138, 141, 143, 146, 147, 148, 151, 152], "peak": [0, 63, 80], "start": [0, 2, 3, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 35, 49, 50, 52, 53, 55, 65, 68, 70, 72, 79, 88, 89, 97, 103, 104, 107, 110, 114, 116, 120, 121, 122, 125, 127, 130, 132, 134, 143, 147, 151, 154], "point": [0, 4, 11, 12, 16, 18, 19, 20, 25, 27, 28, 29, 30, 31, 34, 35, 36, 37, 38, 40, 41, 42, 45, 46, 47, 49, 51, 52, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 83, 84, 86, 87, 89, 90, 92, 93, 97, 107, 114, 115, 116, 120, 121, 122, 123, 127, 137, 143, 146, 147, 148, 151], "empti": [0, 95, 120, 147], "basic": [0, 48, 114, 115, 116, 121, 127, 128, 130, 134, 137, 138, 143, 144, 147, 151, 154], "document": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 113, 114, 115, 116, 124, 125, 126, 130, 132, 133, 134, 137, 138, 139, 144, 147, 148, 151, 154, 155], "next": [0, 51, 114, 116, 118, 120, 121, 122, 123, 125, 127, 134, 141, 151], "figur": [0, 4, 61, 66, 95, 107, 110, 116, 121, 122, 123, 125, 126, 147, 151], "order": [0, 11, 19, 24, 25, 30, 34, 46, 48, 49, 51, 55, 57, 61, 65, 70, 72, 79, 82, 83, 95, 100, 112, 115, 116, 118, 119, 121, 137, 138, 141, 143, 147, 151], "arriv": [0, 65, 130], "follow": [0, 4, 11, 16, 24, 46, 49, 57, 75, 76, 80, 82, 83, 86, 89, 95, 114, 115, 116, 118, 121, 122, 123, 125, 127, 133, 134, 138, 141, 142, 143, 144, 146, 147, 148, 151], "requir": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 46, 47, 48, 49, 53, 75, 89, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 110, 114, 115, 116, 122, 126, 127, 132, 133, 137, 138, 145, 146, 151, 152, 155], "each": [0, 3, 4, 11, 12, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 27, 28, 29, 30, 31, 34, 35, 36, 37, 39, 46, 47, 48, 49, 50, 51, 52, 53, 55, 57, 61, 62, 64, 66, 72, 75, 82, 83, 88, 89, 94, 95, 97, 107, 109, 110, 114, 115, 116, 118, 119, 120, 121, 122, 124, 132, 133, 134, 137, 141, 143, 146, 147, 148, 151, 152, 154], "compon": [0, 4, 21, 22, 23, 37, 38, 39, 40, 41, 42, 45, 46, 47, 49, 51, 52, 53, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 72, 73, 75, 76, 77, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93, 94, 96, 110, 114, 116, 122, 128, 133, 137, 138, 145, 147, 151], "group": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 112, 118, 119, 120, 121, 122, 123, 125, 126, 127, 128, 130, 133, 134, 137, 138, 143, 144, 145, 148, 154], "add": [0, 4, 114, 116, 120, 121, 123, 126, 133, 134, 143, 146, 147], "nxinstrument": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 53, 88, 89, 94, 97, 103, 104, 107, 110, 114, 116, 120, 121, 123, 126, 127, 133, 134, 147, 148, 151, 152], "what": [0, 4, 26, 62, 114, 120, 122, 127, 147, 148, 151], "go": [0, 55, 116, 119, 127, 132, 136, 145, 147], "while": [0, 4, 19, 48, 64, 110, 114, 115, 121, 125, 127, 130, 137, 143, 147, 148, 151, 154], "option": [0, 4, 5, 10, 11, 19, 24, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 115, 116, 118, 120, 122, 125, 127, 132, 142, 143, 145, 151, 154], "urg": 0, "strongli": [0, 11, 53, 127, 137], "provid": [0, 2, 4, 11, 19, 21, 22, 23, 36, 37, 38, 42, 48, 49, 50, 53, 75, 88, 93, 96, 109, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 127, 128, 130, 133, 134, 137, 138, 139, 145, 147, 151, 154], "support": [0, 11, 30, 34, 59, 81, 114, 116, 120, 121, 122, 123, 124, 126, 127, 128, 130, 134, 137, 138, 147, 151, 152, 154], "default": [0, 4, 11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 114, 115, 116, 120, 123, 125, 126, 127, 130, 132, 133, 137, 143, 146, 147, 148, 151, 152, 154], "nxsampl": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 39, 53, 75, 83, 88, 94, 97, 103, 104, 116, 127, 133, 134, 148, 151, 152], "nxmonitor": [0, 6, 9, 10, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 53, 88, 94, 97, 103, 104, 107, 127, 133, 134, 151], "structur": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 111, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 133, 134, 137, 138, 144, 145, 147, 148, 152, 154, 155], "entri": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 48, 49, 53, 55, 62, 65, 66, 68, 72, 75, 81, 82, 86, 88, 89, 91, 97, 103, 104, 107, 110, 114, 116, 118, 120, 121, 122, 123, 126, 127, 128, 133, 143, 147, 148, 151, 152], "nxentri": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 48, 75, 81, 88, 94, 95, 97, 103, 104, 107, 110, 114, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 133, 134, 143, 147, 148, 152], "now": [0, 24, 48, 60, 73, 94, 114, 116, 120, 121, 128, 130, 132, 136, 154], "variou": [0, 4, 8, 64, 82, 83, 107, 116, 122, 127, 130, 131, 137, 138, 145, 147, 151, 154], "shell": [0, 143], "draw": [0, 4, 116, 137], "identifi": [0, 2, 4, 11, 48, 49, 50, 53, 61, 88, 91, 103, 104, 114, 115, 116, 120, 121, 123, 127, 128, 130, 133, 134, 138, 147, 148, 154], "all": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 112, 114, 115, 116, 119, 121, 122, 124, 126, 127, 130, 132, 133, 134, 136, 137, 138, 143, 144, 145, 147, 151, 154], "etc": [0, 2, 8, 11, 39, 43, 49, 50, 54, 68, 84, 91, 95, 107, 114, 116, 127, 133, 151, 152], "valu": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 38, 39, 40, 42, 45, 46, 48, 49, 51, 52, 53, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 73, 75, 77, 78, 80, 81, 82, 83, 84, 85, 87, 88, 89, 93, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 114, 115, 116, 118, 119, 120, 121, 126, 127, 128, 133, 137, 141, 143, 146, 148, 152, 154], "aim": [0, 110], "experi": [0, 2, 4, 6, 11, 14, 15, 24, 26, 27, 36, 40, 49, 53, 80, 87, 88, 94, 95, 97, 103, 104, 107, 109, 114, 116, 127, 133, 137, 151, 152, 154], "good": [0, 4, 11, 48, 114, 120, 122, 130, 137, 143, 151, 154], "possibl": [0, 4, 18, 49, 53, 60, 89, 110, 114, 115, 116, 122, 127, 133, 137, 147, 151], "strive": [0, 116, 130, 151], "captur": [0, 116, 151], "much": [0, 116, 127, 133, 136, 137, 138, 143, 151], "practic": [0, 4, 24, 52, 53, 60, 116, 137, 143, 147, 151], "With": [0, 4, 49, 55, 88, 114, 122, 134, 137, 145], "manual": [0, 43, 111, 113, 115, 116, 118, 120, 123, 124, 125, 134, 139, 147, 152, 154], "base": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 97, 104, 107, 109, 110, 112, 114, 115, 121, 122, 127, 129, 130, 132, 133, 134, 137, 145, 146, 147, 148, 152, 154, 155], "class": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 112, 114, 115, 121, 122, 127, 128, 129, 130, 131, 134, 138, 143, 144, 145, 146, 147, 149, 151, 152], "find": [0, 48, 53, 88, 110, 116, 120, 127, 133, 137, 138, 143, 148, 151], "your": [0, 20, 29, 110, 114, 116, 120, 124, 127, 132, 133, 143, 151, 152, 154], "suitabl": [0, 14, 107, 147, 151], "togeth": [0, 4, 11, 44, 49, 50, 55, 73, 90, 114, 116, 121, 133, 147, 151], "under": [0, 11, 49, 52, 65, 80, 95, 109, 113, 115, 116, 125, 126, 132, 154, 155], "Then": [0, 110, 114, 116, 121, 134, 143, 147, 151, 152], "match": [0, 48, 52, 55, 65, 72, 114, 143, 147], "them": [0, 24, 95, 107, 112, 114, 120, 121, 129, 130, 133, 138, 143, 151], "wish": [0, 120, 123, 128, 136, 145, 146, 152], "mai": [0, 2, 4, 11, 36, 42, 46, 48, 50, 52, 53, 55, 57, 62, 68, 75, 78, 82, 83, 84, 85, 89, 95, 107, 110, 111, 114, 115, 116, 118, 120, 121, 122, 123, 125, 127, 133, 134, 141, 143, 144, 145, 147, 148, 151, 152, 154, 155], "d": [0, 4, 14, 15, 36, 46, 48, 49, 80, 107, 114, 116, 120, 121, 122, 124, 126, 128, 134, 137, 147, 148, 151, 152], "reflect": [0, 46, 62, 66, 77, 80, 94, 107, 114, 127, 147], "type": [0, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 16, 18, 19, 24, 25, 26, 27, 29, 38, 42, 45, 46, 49, 50, 51, 52, 53, 54, 56, 57, 58, 63, 66, 67, 68, 70, 75, 77, 80, 82, 84, 85, 87, 88, 89, 92, 93, 97, 100, 103, 104, 116, 118, 120, 121, 122, 127, 132, 133, 134, 137, 141, 143, 145, 148, 151, 154], "its": [0, 2, 4, 11, 16, 36, 37, 38, 39, 40, 41, 42, 45, 46, 48, 49, 50, 52, 53, 56, 57, 58, 59, 61, 62, 63, 64, 66, 67, 68, 69, 76, 77, 78, 82, 84, 85, 86, 87, 88, 89, 92, 93, 114, 115, 116, 120, 123, 127, 128, 133, 138, 144, 147, 151, 154, 155], "angl": [0, 3, 4, 7, 9, 10, 12, 13, 14, 15, 16, 17, 19, 20, 21, 22, 23, 24, 25, 30, 31, 34, 35, 36, 42, 45, 46, 48, 49, 52, 57, 61, 62, 66, 73, 80, 82, 85, 89, 92, 95, 103, 104, 107, 114, 116, 118, 121, 123, 127, 133, 145, 146, 147], "toward": [0, 7, 37, 38, 40, 49, 67, 76], "incom": [0, 27, 28, 36], "tell": [0, 120, 122, 125], "nxcrystal": [0, 10, 20, 64, 69, 94, 103, 104, 107, 115, 116, 147, 148, 152], "right": [0, 72, 73, 89, 90, 95, 116, 120, 122, 125, 127], "field": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 118, 121, 122, 127, 128, 133, 134, 137, 144, 145, 148, 151, 152, 154], "can": [0, 2, 4, 8, 9, 11, 14, 15, 16, 19, 21, 22, 23, 26, 29, 35, 37, 38, 46, 47, 48, 49, 50, 53, 57, 61, 62, 65, 68, 70, 72, 75, 76, 79, 82, 83, 84, 86, 88, 94, 95, 97, 114, 115, 116, 118, 120, 121, 122, 124, 125, 127, 129, 132, 133, 134, 137, 138, 140, 141, 143, 145, 147, 151, 152, 154, 155], "found": [0, 11, 48, 107, 114, 116, 132, 133, 134, 143, 147, 154], "after": [0, 2, 18, 48, 49, 64, 85, 103, 104, 107, 115, 119, 125, 127, 130, 133, 141, 142, 151], "ad": [0, 4, 48, 70, 89, 110, 114, 115, 116, 118, 121, 127, 128, 134, 147, 152], "d_space": [0, 46], "rotation_angl": [0, 10, 12, 13, 14, 15, 16, 17, 19, 20, 24, 25, 30, 31, 34, 35, 82, 116, 151], "even": [0, 11, 62, 66, 114, 116, 120, 127, 133, 134, 138, 143, 145, 151, 154, 155], "whole": [0, 11, 47, 49, 72, 114, 116, 151], "miss": [0, 4, 48, 65, 114], "do": [0, 11, 48, 53, 61, 89, 114, 115, 116, 120, 125, 127, 128, 132, 133, 138, 143, 147, 151, 154], "despair": 0, "contact": [0, 91, 94, 111, 127, 132], "suggest": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 34, 35, 44, 48, 62, 75, 84, 91, 95, 97, 103, 104, 114, 115, 116, 121, 137, 147, 152], "give": [0, 11, 16, 21, 22, 23, 29, 41, 49, 51, 53, 75, 88, 107, 114, 116, 121, 133, 143], "littl": [0, 114, 116, 143, 152], "check": [0, 49, 119, 120, 121, 126, 134, 138, 143, 145, 147, 155], "duplic": [0, 36, 97, 110, 114, 123, 127], "suffici": [0, 95, 114, 127, 144], "proce": [0, 114, 143], "enhanc": [0, 116], "A": [0, 4, 11, 36, 37, 38, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 61, 62, 66, 67, 68, 69, 74, 75, 76, 77, 78, 82, 83, 84, 86, 88, 89, 92, 94, 95, 109, 114, 115, 116, 118, 120, 121, 123, 126, 127, 128, 130, 131, 132, 137, 143, 146, 147, 148, 151, 154], "elabor": 0, "suppos": [0, 76, 86, 114, 116, 120, 127, 143], "contain": [0, 4, 11, 16, 19, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 107, 109, 114, 115, 116, 118, 121, 122, 124, 125, 127, 132, 133, 134, 136, 137, 138, 145, 147, 148, 151, 152, 154], "put": [0, 97, 120, 121, 127, 138, 141, 143, 151], "up": [0, 3, 48, 78, 85, 87, 90, 93, 95, 96, 106, 114, 116, 124, 125, 127, 133, 138, 147, 151, 152], "quick": [0, 121, 151], "count": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 24, 25, 27, 29, 46, 48, 49, 57, 68, 82, 83, 95, 103, 104, 107, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 151], "versu": [0, 14, 15, 27, 28, 36, 46], "two": [0, 4, 9, 11, 30, 31, 35, 48, 49, 51, 65, 75, 88, 97, 107, 110, 114, 115, 116, 118, 120, 121, 125, 126, 127, 128, 130, 134, 138, 143, 144, 145, 147, 148, 151], "theta": [0, 4, 9, 30, 31, 35, 107, 116, 134], "polar_angl": [0, 7, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 30, 31, 34, 35, 46, 49, 80, 103, 104, 114, 116, 118, 125, 134, 147, 151], "seen": [0, 49, 67, 87, 116, 154], "link": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 119, 124, 127, 128, 130, 133, 138, 145, 148, 151, 154], "appropri": [0, 11, 19, 26, 48, 75, 89, 104, 114, 116, 120, 123, 127, 138, 143, 146, 147, 151, 152], "item": [0, 4, 11, 46, 48, 57, 60, 110, 115, 116, 120, 121, 122, 125, 127, 133, 138, 143, 144, 145, 151, 154], "case": [0, 4, 10, 11, 36, 38, 47, 49, 52, 62, 65, 72, 75, 82, 83, 89, 107, 109, 110, 114, 115, 116, 121, 122, 123, 127, 128, 132, 133, 134, 137, 138, 146, 147, 148], "both": [0, 4, 10, 14, 19, 48, 64, 65, 68, 73, 103, 104, 114, 115, 116, 123, 127, 129, 133, 137, 138, 143, 144, 145, 146, 148, 151, 152, 154, 155], "live": [0, 107, 116], "nxdetector": [0, 3, 4, 6, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 33, 34, 35, 43, 47, 50, 51, 55, 64, 72, 94, 97, 103, 104, 114, 116, 120, 121, 123, 126, 133, 147, 148, 151, 152], "choos": [0, 38, 116, 123, 125, 127, 128, 147], "probabl": [0, 60, 62], "least": [0, 4, 48, 53, 115, 116, 120, 121, 122, 127, 144, 147, 151], "normal": [0, 3, 9, 11, 29, 34, 49, 72, 89, 107, 114, 116, 119, 123, 129, 147, 151, 152], "experiment": [0, 11, 95, 112, 114, 116, 133, 137, 151], "run": [0, 2, 4, 22, 53, 65, 84, 88, 103, 104, 122, 126, 127, 132, 133, 138, 151, 154], "against": [0, 48, 65, 107, 114, 116, 130, 147, 151, 152, 154, 155], "other": [0, 4, 11, 19, 21, 22, 23, 46, 47, 48, 49, 52, 53, 57, 59, 65, 70, 75, 81, 82, 83, 88, 90, 94, 95, 107, 109, 110, 114, 115, 116, 120, 121, 126, 127, 128, 131, 133, 134, 136, 137, 138, 144, 145, 147, 151, 152, 154], "necessari": [0, 4, 9, 14, 15, 29, 48, 49, 62, 69, 95, 114, 115, 116, 121, 123, 133, 134, 137, 138, 141, 145, 147], "know": [0, 11, 49, 51, 82, 83, 95, 120, 123, 133, 138], "condit": [0, 8, 54, 84, 94, 116, 137], "especi": [0, 39, 49, 116, 143, 151], "monitor": [0, 6, 9, 10, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 52, 53, 57, 68, 82, 84, 88, 94, 97, 103, 104, 107, 116, 127, 133, 151], "convent": [0, 2, 3, 9, 14, 15, 27, 28, 29, 46, 57, 80, 82, 83, 95, 97, 107, 116, 123, 154], "control": [0, 9, 11, 12, 13, 14, 15, 19, 24, 25, 29, 36, 54, 78, 84, 94, 107, 114, 116, 120, 147, 151, 154], "level": [0, 11, 50, 53, 97, 110, 114, 115, 116, 118, 121, 122, 127, 130, 133, 137, 143, 147, 148, 151, 154], "addit": [0, 4, 11, 37, 48, 49, 53, 54, 60, 70, 82, 88, 89, 94, 110, 114, 115, 116, 121, 122, 123, 126, 130, 133, 136, 145, 146, 147, 152, 154], "within": [0, 4, 11, 16, 19, 39, 46, 57, 82, 83, 88, 89, 95, 114, 115, 116, 118, 120, 123, 127, 133, 134, 137, 138, 142, 145, 147], "thei": [0, 11, 49, 55, 62, 65, 68, 84, 91, 95, 107, 114, 116, 126, 127, 133, 137, 138, 142, 143, 145, 146, 147, 151, 152, 154, 155], "out": [0, 4, 34, 38, 40, 48, 53, 55, 57, 88, 103, 104, 107, 114, 116, 119, 121, 122, 126, 127, 132, 143, 146, 147, 148, 151, 154], "titl": [0, 2, 3, 4, 5, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 48, 49, 53, 70, 82, 87, 88, 97, 103, 104, 107, 114, 116, 121, 125, 131, 133, 134, 137, 145, 146, 148, 151], "user": [0, 2, 4, 11, 21, 22, 23, 49, 53, 82, 88, 89, 91, 94, 103, 104, 107, 110, 115, 116, 118, 123, 125, 127, 128, 130, 133, 134, 137, 138, 144, 147, 151, 154, 155], "time": [0, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 36, 38, 39, 46, 48, 49, 52, 53, 55, 57, 65, 68, 78, 79, 81, 82, 84, 87, 88, 94, 95, 97, 98, 99, 103, 104, 107, 115, 116, 118, 120, 121, 122, 123, 130, 133, 134, 137, 143, 146, 147, 151, 154, 155], "desir": [0, 76, 86, 114, 116, 121], "sourc": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 111, 115, 116, 120, 126, 127, 129, 131, 134, 135, 136, 137, 142, 143, 145, 146, 147, 148, 151, 154], "anoth": [0, 4, 19, 21, 22, 23, 48, 53, 73, 75, 88, 114, 116, 120, 121, 123, 125, 127, 130, 134, 137, 138, 143, 145, 146, 147, 151, 152, 154], "descript": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 114, 120, 121, 122, 123, 126, 130, 134, 137, 138, 141, 147, 148, 152, 154], "verifi": 0, "conform": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 107, 115, 116, 118, 121, 144, 145, 147, 148, 155], "encapsul": [0, 133], "similar": [0, 4, 68, 120, 121, 133, 134, 138, 147, 151], "one": [0, 4, 11, 19, 24, 29, 48, 49, 51, 52, 53, 75, 77, 78, 81, 82, 87, 88, 89, 91, 107, 114, 115, 116, 120, 121, 122, 124, 127, 130, 133, 138, 143, 146, 147, 148, 151, 152, 154], "abov": [0, 4, 11, 16, 49, 82, 97, 110, 114, 115, 116, 118, 120, 121, 122, 125, 132, 133, 134, 137, 148, 151, 154], "One": [0, 4, 20, 48, 82, 83, 89, 94, 96, 114, 116, 120, 121, 122, 123, 125, 130, 132, 143, 147], "easi": [0, 116, 120, 127, 130, 133, 134, 152, 154], "wai": [0, 11, 16, 18, 19, 24, 48, 64, 82, 114, 116, 121, 125, 126, 127, 128, 131, 133, 134, 137, 143, 145, 147, 151, 155], "work": [0, 11, 42, 49, 107, 114, 116, 120, 121, 127, 130, 132, 133, 134, 137, 138, 143, 144, 147, 154, 155], "through": [0, 10, 11, 19, 38, 48, 51, 52, 55, 62, 76, 82, 86, 89, 95, 112, 114, 116, 133, 134, 138, 143, 147, 152, 154], "along": [0, 4, 11, 19, 24, 29, 38, 51, 58, 60, 61, 62, 82, 84, 85, 89, 92, 114, 116, 120, 144, 151], "kei": [0, 24, 53, 88, 107, 120, 121, 143], "decis": [0, 53, 138], "influenc": [0, 11, 49], "our": [0, 121, 123, 125, 138, 152], "particular": [0, 4, 48, 55, 62, 75, 89, 110, 114, 115, 116, 133, 138, 144, 145, 146, 147, 151], "choic": [0, 4, 19, 46, 57, 81, 114, 116, 120, 127, 143, 145], "metadata": [0, 4, 107, 114, 115, 120, 121, 126, 127, 145, 154, 155], "organ": [0, 53, 88, 129, 133, 137, 144, 147, 154], "so": [0, 4, 24, 28, 30, 31, 34, 35, 53, 97, 114, 116, 127, 132, 133, 136, 137, 138, 141, 143, 146, 147, 151, 152, 154], "introductori": 0, "stuff": [0, 121], "u": [0, 1, 4, 9, 29, 107, 114, 116, 118, 121, 122, 123, 130, 143, 146, 151, 152], "defin": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 112, 114, 115, 116, 119, 120, 123, 127, 130, 133, 134, 138, 141, 143, 145, 146, 147, 152, 154], "ha": [0, 3, 4, 8, 10, 11, 17, 34, 49, 50, 52, 62, 65, 75, 81, 82, 89, 100, 107, 114, 115, 116, 120, 121, 122, 123, 125, 127, 130, 133, 134, 137, 138, 143, 147, 148, 151, 152, 154, 155], "commun": [0, 4, 109, 110, 116, 124, 127, 128, 130, 131, 132, 136, 144, 151, 154], "actual": [0, 4, 11, 14, 15, 35, 42, 48, 49, 53, 68, 88, 89, 95, 114, 115, 116, 118, 121, 123, 127, 132, 133, 146, 148, 152], "bit": [0, 11, 49, 80, 114, 120, 123, 125, 137, 143, 151], "thing": [0, 26, 49, 116, 119, 130, 145, 146, 151], "first": [0, 4, 8, 11, 16, 18, 25, 29, 46, 47, 48, 49, 52, 61, 72, 84, 86, 96, 107, 112, 114, 115, 116, 118, 120, 121, 123, 125, 126, 127, 130, 137, 143, 147, 151, 152, 154, 155], "part": [0, 11, 29, 36, 49, 62, 67, 95, 107, 114, 115, 118, 121, 128, 133, 134, 137, 140, 141, 143, 145, 147, 148, 151, 154], "guid": [0, 58, 62, 64, 114, 128, 133, 135, 147], "principl": [0, 115, 145], "guidanc": [0, 11, 121], "must": [0, 4, 11, 19, 26, 36, 46, 48, 49, 52, 57, 60, 72, 80, 82, 83, 88, 95, 97, 107, 110, 114, 115, 116, 120, 121, 127, 134, 137, 143, 147, 155], "analysi": [0, 3, 4, 11, 14, 15, 27, 28, 36, 43, 49, 53, 74, 79, 88, 94, 116, 120, 121, 122, 123, 125, 127, 130, 131, 133, 134, 145, 151], "Not": [0, 107, 109, 116, 123, 138], "less": [0, 11, 49, 147], "Of": [0, 114, 121, 152], "cours": [0, 24, 25, 114, 121], "depend": [0, 4, 11, 37, 38, 40, 41, 42, 45, 46, 48, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 83, 84, 86, 87, 89, 92, 93, 95, 97, 100, 107, 114, 116, 132, 137, 154, 155], "scienc": [0, 1, 112, 128, 133, 136, 137, 144, 154], "being": [0, 4, 19, 97, 114, 115, 116, 118, 122, 130, 137, 142, 147, 152, 154], "senior": 0, "scientist": [0, 112, 116, 133, 137, 145, 151, 152, 154, 155], "unsur": [0, 120], "perhap": [0, 11, 54, 64, 87, 120, 128, 152], "call": [0, 46, 62, 73, 88, 104, 114, 116, 118, 119, 121, 123, 125, 128, 130, 133, 134, 138, 143, 148, 154], "intern": [0, 49, 62, 75, 109, 112, 113, 114, 116, 130, 133, 134, 138, 145, 152], "meet": [0, 53, 60, 112, 130, 136, 137, 144, 154], "domain": [0, 115, 133, 137, 154], "expert": [0, 151], "haggl": 0, "when": [0, 2, 4, 10, 11, 19, 47, 48, 49, 50, 51, 52, 53, 62, 65, 68, 75, 76, 81, 82, 86, 88, 89, 94, 107, 114, 115, 116, 120, 121, 122, 123, 127, 130, 133, 134, 137, 138, 142, 143, 145, 146, 147, 148, 152, 154], "peopl": [0, 127, 128, 130, 133, 151], "tend": 0, "everyth": [0, 69, 125, 143], "might": [0, 11, 48, 49, 60, 62, 94, 95, 107, 110, 114, 115, 116, 120, 121, 127, 133, 143, 147, 148, 152, 155], "come": [0, 55, 116], "test": [0, 118, 120, 134, 136, 138, 143, 147], "question": [0, 24, 111, 116, 131, 152, 153, 154], "common": [0, 4, 9, 11, 29, 36, 46, 49, 55, 57, 62, 65, 89, 112, 114, 115, 116, 120, 121, 127, 128, 130, 133, 134, 137, 144, 145, 147], "onli": [0, 11, 29, 46, 48, 49, 51, 52, 53, 57, 59, 60, 61, 72, 75, 81, 82, 83, 94, 95, 97, 114, 115, 116, 120, 121, 122, 125, 127, 130, 132, 133, 136, 138, 143, 145, 146, 147, 148, 151, 152], "belong": [0, 115], "purpos": [0, 51, 68, 114, 118, 127, 133, 138, 144, 147, 154, 155], "author": [0, 70, 91, 103, 104, 109, 117, 126, 131, 145], "upstream": [0, 60, 61, 63, 87, 95], "softwar": [0, 3, 4, 11, 14, 15, 27, 28, 43, 48, 49, 72, 107, 114, 116, 120, 122, 124, 127, 128, 130, 133, 144, 145, 147, 152, 154, 155], "who": [0, 114, 121, 127, 128, 133, 134, 136, 151, 155], "consum": [0, 36, 116, 147], "expect": [0, 4, 17, 28, 32, 48, 69, 97, 103, 114, 116, 120, 121, 132, 137, 138, 146, 147], "certain": [0, 4, 11, 36, 48, 49, 53, 107, 114, 116, 121, 122, 123, 138, 145, 152, 154, 155], "well": [0, 107, 109, 110, 112, 114, 116, 127, 128, 132, 133, 135, 137, 143, 145, 147, 152, 154, 155], "place": [0, 4, 9, 30, 35, 44, 47, 70, 75, 76, 86, 107, 110, 112, 114, 116, 120, 122, 123, 127, 143, 148, 151, 152], "On": [0, 116, 125, 127, 138, 151], "hand": [0, 72, 73, 89, 90, 116, 127], "develop": [0, 112, 116, 118, 127, 128, 130, 132, 133, 134, 135, 137, 138, 142, 143, 144, 154, 155], "analyz": [0, 4, 7, 46, 94, 112, 116, 127, 133, 137, 143, 147, 152], "novel": 0, "better": [0, 114, 122, 127, 134, 137, 143, 154, 155], "err": 0, "side": [0, 46, 57, 76, 114], "either": [0, 4, 5, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 48, 49, 68, 96, 104, 107, 109, 110, 114, 115, 116, 120, 123, 124, 127, 132, 133, 145, 147, 148, 151, 152, 154], "rietveld": 0, "refin": 0, "profil": [0, 11, 39, 57, 80, 116], "kind": [0, 18, 55, 112, 116, 141], "radiat": [0, 4, 11, 14, 15, 49, 67, 87, 116, 127, 146, 152], "probe": [0, 2, 3, 4, 6, 8, 10, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 87, 97, 103, 104, 114], "long": [0, 4, 48, 49, 109, 110, 116, 127, 134, 151], "element": [0, 3, 4, 11, 21, 22, 23, 46, 48, 49, 51, 55, 57, 62, 76, 80, 82, 83, 85, 86, 94, 95, 98, 99, 101, 102, 105, 106, 108, 114, 115, 116, 120, 123, 127, 145, 152, 154], "usual": [0, 4, 10, 24, 40, 48, 59, 62, 67, 74, 89, 94, 114, 116, 143, 151, 154], "would": [0, 4, 8, 11, 14, 15, 24, 35, 43, 49, 65, 75, 87, 89, 90, 95, 114, 115, 116, 127, 129, 133, 137, 138, 143, 147, 148, 151, 152, 154], "nice": [0, 116], "temperatur": [0, 2, 3, 4, 8, 11, 17, 29, 46, 48, 53, 57, 65, 67, 82, 83, 84, 88, 103, 104, 107, 114, 116, 133, 146, 151, 152], "shown": [0, 4, 48, 53, 81, 88, 107, 114, 115, 116, 120, 121, 122, 123, 125, 133, 137, 147, 148, 151], "summar": [0, 4], "measur": [0, 2, 4, 8, 11, 13, 19, 24, 25, 26, 29, 34, 48, 49, 52, 53, 55, 62, 65, 67, 68, 80, 84, 88, 93, 94, 95, 114, 116, 122, 123, 127, 133, 154], "incid": [0, 4, 11, 14, 38, 39, 42, 46, 61, 62, 66, 68, 82, 94, 95, 97, 116], "lambda": [0, 4, 14, 107, 116, 133], "worri": 0, "too": [0, 16, 55, 114, 116, 151], "hold": [0, 19, 26, 30, 31, 34, 35, 48, 95, 109, 114, 121, 136, 143, 151], "reveal": 0, "secret": 0, "easier": [0, 121, 125, 133, 143], "were": [0, 65, 111, 116, 120, 121, 126, 127, 130, 137, 152], "At": [0, 11, 16, 49, 53, 55, 114, 115, 116, 128, 130, 138, 155], "stage": [0, 89, 130], "advis": [0, 53, 137], "pull": [0, 112, 127, 129], "studi": [0, 116, 134, 143], "notic": [0, 119, 120, 127], "quickli": [0, 152], "realiz": 0, "been": [0, 3, 4, 10, 11, 17, 34, 49, 62, 82, 89, 114, 116, 120, 122, 123, 125, 126, 127, 130, 133, 134, 138, 143, 145, 147, 148, 152, 154, 155], "just": [0, 4, 19, 65, 107, 110, 114, 116, 120, 121, 133, 134, 143, 151, 152], "path": [0, 3, 11, 21, 22, 23, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95, 96, 97, 100, 115, 116, 120, 121, 122, 123, 126, 127, 128, 133, 137, 142, 143, 147, 152, 154], "string": [0, 4, 19, 37, 38, 40, 41, 42, 45, 46, 48, 49, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 75, 77, 78, 82, 84, 87, 89, 92, 93, 103, 104, 107, 114, 115, 116, 119, 120, 121, 134, 138, 143, 146, 147, 148], "turn": [0, 58, 89, 132, 148], "syntax": [0, 111, 114, 116, 145, 147, 148], "conveni": [0, 19], "great": [0, 151], "confirm": 0, "view": [0, 116, 122, 124, 127, 128, 133, 134, 135, 137, 143, 145, 152, 154], "scan": [0, 4, 10, 11, 12, 16, 19, 20, 27, 29, 30, 31, 34, 35, 36, 49, 68, 78, 82, 97, 107, 114, 119, 121, 122, 127, 133, 134, 147, 154], "seem": [0, 121, 127, 143], "solut": [0, 143, 154], "But": [0, 4, 9, 11, 29, 49, 114, 116, 123, 127, 147, 154], "detail": [0, 4, 11, 43, 49, 70, 82, 95, 103, 104, 115, 116, 121, 132, 133, 134, 136, 138, 142, 143, 144, 147, 151, 154, 155], "branch": 0, "thu": [0, 4, 5, 11, 16, 48, 49, 51, 52, 55, 95, 114, 115, 116, 130, 133, 137, 143, 147, 151, 152, 154], "continu": [0, 112, 116, 124, 127, 133, 137, 154], "schemat": [0, 134], "inspect": [0, 127], "nxsourc": [0, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 32, 64, 94, 97, 103, 104, 151], "polar": [0, 7, 9, 10, 12, 13, 14, 15, 17, 20, 21, 22, 23, 30, 31, 34, 35, 39, 46, 49, 62, 64, 77, 80, 94, 103, 104, 114], "still": [0, 4, 116, 127, 134, 136, 137, 154], "done": [0, 16, 89, 120, 121, 138, 143], "upon": [0, 114, 116, 130], "content": [0, 4, 16, 30, 31, 34, 35, 70, 79, 107, 112, 114, 115, 116, 118, 120, 121, 122, 125, 126, 127, 128, 133, 134, 138, 143, 145, 147, 148, 154, 155], "make": [0, 4, 48, 53, 55, 65, 89, 93, 95, 96, 106, 107, 114, 119, 121, 127, 132, 133, 134, 138, 143, 147, 151, 152, 154], "tabl": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 121, 122, 123, 125, 141, 145, 146, 147, 152], "mxinstrument": 0, "get": [0, 20, 38, 48, 107, 116, 120, 121, 125, 127, 132, 143, 152, 154], "concern": [0, 127, 133, 136, 144], "stop": [0, 4, 40, 49, 59, 64, 118], "problem": [0, 4, 120, 122, 127, 129, 130, 135, 138], "solv": [0, 143, 151], "correspond": [0, 4, 11, 19, 29, 46, 48, 50, 55, 57, 65, 72, 75, 82, 83, 89, 95, 114, 116, 127, 151], "occur": [0, 55, 87, 116], "bewild": 0, "serv": [0, 133, 138, 143, 151, 154], "dictionari": [0, 11, 75, 114, 116, 120, 121, 133, 147], "most": [0, 4, 11, 39, 49, 72, 87, 110, 114, 116, 127, 132, 133, 138, 143, 145, 147, 148, 150, 152, 154], "possibli": [0, 4, 48, 53, 56, 88, 94, 147, 148, 151], "have": [0, 4, 11, 12, 19, 29, 42, 48, 49, 50, 51, 52, 53, 60, 61, 62, 80, 89, 91, 95, 97, 107, 111, 114, 115, 116, 119, 120, 121, 122, 125, 126, 127, 128, 130, 132, 133, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154, 155], "keep": [0, 4, 114, 119, 120, 127, 133, 138, 143], "altogeth": 0, "introduc": [0, 4, 116, 151], "pleas": [0, 26, 52, 65, 111, 114, 116, 124, 127, 129, 132, 138, 143, 147, 154], "feel": [0, 132, 143], "free": [0, 4, 87, 89, 113, 114, 132, 136, 145], "via": [0, 4, 97, 115, 129, 132, 137, 147, 154, 155], "mail": [0, 112, 127, 132], "xml": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 115, 116, 124, 130, 133, 134, 137, 138, 143, 145, 147, 154], "edit": [0, 120, 125, 130, 145, 147], "fire": 0, "editor": [0, 1, 111, 120, 126, 145, 147], "open": [0, 4, 24, 52, 62, 76, 86, 91, 114, 116, 118, 119, 121, 125, 126, 127, 133, 134, 137, 138, 143, 154], "schema": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 103, 104, 107, 114, 115, 145, 147], "worth": [0, 127], "load": [0, 121, 125, 126], "xsd": [0, 114, 120, 133, 145, 147], "help": [0, 29, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 116, 120, 121, 127, 132, 133, 134, 147, 152], "proper": [0, 11, 116, 119, 121], "alwai": [0, 4, 9, 24, 29, 44, 55, 75, 97, 112, 114, 116, 127, 147, 151], "templat": [0, 64], "below": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 52, 72, 97, 114, 116, 119, 120, 121, 122, 123, 135, 143, 147, 154], "It": [0, 3, 4, 12, 14, 15, 18, 20, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 107, 110, 114, 115, 116, 120, 121, 123, 127, 133, 134, 136, 138, 143, 146, 147, 151, 152, 154], "chang": [0, 4, 39, 46, 48, 49, 57, 81, 95, 116, 120, 127, 130, 132, 135, 143, 151, 152], "version": [0, 2, 4, 8, 11, 17, 18, 19, 26, 28, 46, 53, 57, 75, 79, 81, 82, 83, 88, 95, 97, 103, 104, 107, 109, 113, 115, 116, 118, 120, 121, 122, 126, 127, 130, 133, 138, 143, 147, 151, 154, 155], "0": [0, 4, 11, 24, 48, 49, 51, 53, 59, 60, 62, 68, 80, 84, 107, 113, 114, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 132, 133, 134, 141, 143, 146, 147, 148, 151, 154, 155], "encod": [0, 85, 95, 116, 137], "utf": [0, 114, 146], "8": [0, 11, 49, 80, 114, 116, 118, 119, 120, 121, 126, 133, 134, 138, 141, 146, 147, 148, 154, 155], "x": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 35, 36, 37, 38, 39, 40, 41, 42, 45, 47, 48, 49, 50, 52, 59, 61, 62, 66, 67, 68, 72, 73, 76, 80, 82, 86, 87, 89, 90, 93, 94, 97, 103, 104, 107, 112, 114, 116, 118, 120, 121, 126, 127, 128, 133, 136, 137, 144, 145, 147, 151, 154], "rai": [0, 1, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 36, 39, 42, 50, 59, 61, 87, 93, 94, 107, 112, 116, 127, 128, 130, 133, 136, 137, 144, 145, 147, 151, 154], "copyright": [0, 117, 131, 134, 143], "2008": [0, 130], "2022": [0, 107, 109, 113], "advisori": [0, 62, 109, 112, 113, 114, 130, 133, 152], "committe": [0, 62, 109, 112, 113, 114, 127, 130, 133, 152], "librari": [0, 4, 81, 107, 114, 116, 121, 122, 123, 128, 129, 132, 133, 138, 154, 155], "redistribut": 0, "modifi": [0, 4, 115, 120, 143, 154, 155], "gnu": [0, 113, 132], "lesser": [0, 113, 116, 132], "public": [0, 113, 132, 136, 137, 151, 154, 155], "licens": [0, 117, 131, 132], "publish": [0, 113, 131, 133], "foundat": 0, "later": [0, 65, 90, 114, 116, 128, 133, 148], "distribut": [0, 4, 32, 39, 48, 69, 87, 134, 138, 140, 141, 143, 154], "hope": 0, "without": [0, 4, 53, 68, 114, 116, 121, 126, 127, 128, 133, 134, 137, 143, 146, 147], "warranti": 0, "impli": [0, 134, 137], "merchant": 0, "fit": [0, 4, 19, 48, 80, 95, 114, 143, 151], "FOR": 0, "see": [0, 4, 11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 103, 104, 107, 110, 114, 115, 116, 120, 121, 122, 123, 126, 127, 128, 130, 132, 134, 135, 142, 143, 145, 146, 147, 148, 151, 152, 154, 155], "should": [0, 4, 11, 19, 20, 21, 22, 23, 43, 46, 48, 49, 52, 53, 57, 65, 72, 75, 76, 80, 82, 83, 86, 87, 88, 89, 91, 95, 97, 110, 114, 116, 118, 127, 129, 130, 132, 133, 134, 136, 137, 143, 145, 146, 147, 151, 152], "receiv": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 49, 68, 107, 130, 137, 144], "copi": [0, 121, 126, 127, 134, 143, 145], "inc": [0, 118], "59": [0, 114], "templ": 0, "suit": [0, 10], "330": [0, 147], "boston": 0, "ma": 0, "02111": 0, "1307": 0, "usa": [0, 1, 137], "http": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 112, 113, 114, 115, 116, 118, 120, 121, 122, 125, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 147, 150, 154, 155], "www": [0, 2, 4, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 112, 113, 114, 116, 120, 121, 125, 127, 128, 130, 131, 133, 136, 137, 138, 144, 147, 154], "nexusformat": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 113, 114, 115, 116, 125, 127, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 147, 150, 154, 155], "org": [0, 2, 4, 11, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 111, 112, 113, 114, 116, 120, 121, 125, 127, 128, 130, 131, 132, 133, 136, 137, 138, 139, 144, 145, 147, 154], "nx__template__": 0, "extend": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 133, 137, 154], "nxobject": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 133, 147], "categori": [0, 75, 133, 145], "xmln": [0, 120, 133], "xsi": [0, 120, 133], "w3": [0, 4, 114, 120, 133], "2001": [0, 120, 130, 133, 134], "xmlschema": [0, 120, 133], "instanc": [0, 4, 36, 49, 60, 62, 65, 94, 106, 107, 110, 115, 116, 120, 127, 133, 143, 147, 152], "schemaloc": [0, 133], "0b": 0, "doc": [0, 4, 111, 115, 116, 120, 121, 131, 133, 138, 145, 154], "renam": [0, 119, 143], "nxwoni": 0, "locat": [0, 3, 4, 11, 14, 15, 16, 27, 28, 36, 37, 38, 39, 40, 41, 42, 45, 46, 49, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 85, 86, 87, 88, 90, 92, 93, 94, 110, 114, 116, 120, 121, 123, 126, 127, 132, 133, 134, 147, 151, 152, 154, 155], "root": [0, 11, 54, 81, 94, 114, 116, 121, 122, 126, 130, 147, 148, 151], "attribut": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 118, 119, 121, 122, 123, 126, 127, 128, 130, 133, 134, 137, 138, 143, 145, 146, 148, 151, 154], "shorthand": 0, "includ": [0, 2, 4, 9, 11, 29, 43, 47, 49, 52, 53, 62, 68, 72, 75, 82, 86, 88, 95, 97, 109, 110, 112, 114, 115, 116, 118, 119, 127, 128, 130, 133, 134, 138, 143, 144, 145, 146, 147, 154, 155], "nx_float": [0, 2, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 38, 39, 40, 41, 42, 45, 46, 48, 49, 52, 53, 55, 56, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 69, 73, 77, 80, 82, 83, 84, 85, 87, 88, 90, 92, 93, 95, 97, 98, 99, 101, 102, 103, 104, 105, 107, 108, 114, 116, 133, 146, 152], "unit": [0, 2, 3, 4, 5, 7, 9, 10, 11, 12, 13, 14, 15, 17, 18, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 34, 35, 38, 39, 40, 41, 42, 45, 46, 47, 48, 49, 51, 52, 53, 55, 56, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 69, 72, 73, 74, 75, 76, 77, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93, 95, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 116, 118, 119, 120, 121, 122, 123, 126, 128, 133, 134, 138, 145], "nx_angl": [0, 3, 4, 7, 9, 10, 12, 13, 14, 15, 17, 20, 21, 22, 23, 24, 25, 30, 31, 34, 35, 39, 41, 42, 45, 46, 49, 52, 57, 61, 62, 63, 66, 80, 82, 83, 89, 92, 103, 104, 133, 146], "dimens": [0, 3, 4, 8, 11, 16, 18, 19, 29, 36, 46, 48, 49, 51, 65, 68, 82, 84, 85, 86, 94, 100, 107, 115, 116, 118, 121, 141, 145, 146, 148, 151], "rank": [0, 4, 11, 19, 48, 49, 114, 116, 119, 134, 143], "dim": [0, 8, 118, 119, 134], "index": [0, 2, 4, 11, 47, 48, 50, 55, 60, 62, 65, 70, 72, 79, 80, 103, 107, 114, 116, 120, 148, 151, 154], "ndet": [0, 7, 10, 21, 22, 23, 114], "mean": [0, 3, 4, 11, 16, 49, 62, 80, 85, 107, 110, 114, 116, 127, 133, 137, 143, 147, 148, 151, 152], "intuit": [0, 133], "relev": [0, 4, 36, 39, 43, 82, 110, 116, 127, 133, 151, 155], "specifi": [0, 4, 11, 39, 46, 48, 49, 51, 52, 53, 57, 65, 75, 80, 82, 83, 84, 88, 89, 95, 107, 114, 115, 116, 120, 121, 132, 133, 134, 138, 143, 146, 147, 148, 152, 154], "set": [0, 3, 4, 11, 16, 19, 25, 36, 44, 46, 48, 49, 53, 59, 78, 89, 94, 95, 96, 98, 99, 101, 102, 105, 107, 108, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 127, 128, 132, 134, 137, 138, 143, 145, 147, 148, 151, 154], "size": [0, 3, 4, 9, 11, 13, 14, 15, 24, 25, 29, 39, 40, 42, 45, 49, 51, 60, 68, 76, 85, 86, 87, 94, 97, 103, 104, 114, 116, 120, 121, 130, 133, 137, 138, 143, 146, 151], "tag": [0, 11, 49, 115, 130, 143, 154], "determin": [0, 4, 14, 15, 21, 22, 23, 48, 53, 79, 88, 95, 114, 138, 147, 148], "These": [0, 4, 11, 16, 19, 24, 25, 26, 46, 47, 48, 49, 57, 72, 97, 107, 110, 111, 112, 114, 116, 119, 120, 121, 124, 126, 128, 130, 133, 134, 137, 143, 145, 146, 147, 148, 151], "plain": [0, 70, 119], "integ": [0, 4, 11, 48, 49, 50, 80, 114, 116, 118, 125, 133, 138, 141, 146, 147, 148, 151], "variabl": [0, 4, 8, 16, 39, 48, 61, 65, 78, 82, 85, 107, 114, 115, 116, 120, 133, 141, 143, 146, 147, 151], "express": [0, 4, 89, 91, 114, 115, 116, 137, 145, 147, 148], "tof": [0, 5, 7, 9, 13, 21, 22, 23, 36, 49, 114], "clever": 0, "reader": [0, 48, 114, 116, 121, 134, 137, 154], "between": [0, 4, 13, 14, 15, 24, 25, 36, 46, 52, 59, 61, 63, 73, 78, 82, 83, 87, 97, 107, 114, 116, 122, 127, 130, 133, 137, 138, 143, 145, 152, 154], "nxmonopd": [0, 36], "sinc": [0, 4, 12, 14, 15, 44, 46, 48, 57, 65, 115, 116, 118, 120, 121, 122, 123, 127, 128, 130, 133, 137, 138, 145, 147, 151], "essenti": [0, 27, 116, 127], "ident": [0, 4, 88, 89, 116, 121, 137, 141], "yourselv": 0, "cooki": 0, "spot": 0, "send": 0, "review": [0, 109, 115, 130], "correct": [0, 10, 11, 24, 25, 28, 49, 80, 95, 112, 116, 127, 132, 138, 145], "per": [0, 3, 4, 11, 19, 24, 49, 78, 82, 83, 94, 114, 120, 146], "comment": [0, 53, 62, 88, 107, 137], "cure": 0, "year": [0, 127, 130, 143, 144], "final": [0, 26, 36, 39, 89, 116, 121, 125, 134, 143], "becom": [0, 107, 114, 116, 122, 133, 137, 147, 151, 154], "befor": [0, 11, 21, 22, 23, 46, 48, 51, 53, 64, 88, 89, 90, 95, 107, 109, 114, 116, 120, 125, 132, 133, 134, 143, 151, 154], "accept": [0, 41, 42, 49, 109, 110, 114, 120, 122, 125, 127, 137, 144, 147], "curat": [0, 112], "period": [0, 52, 61, 87, 94, 114, 146, 147], "gain": [0, 11, 42, 49, 62, 121, 137, 152], "sort": [0, 4, 25, 49, 114, 116, 133, 154], "bug": [0, 130, 131], "shall": [0, 133], "written": [0, 4, 9, 29, 48, 81, 114, 115, 118, 120, 121, 122, 123, 126, 127, 134, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154, 155], "stylesheet": 0, "text": [0, 4, 11, 48, 52, 70, 75, 79, 111, 114, 115, 120, 121, 126, 127, 145, 146, 147, 148, 151], "xsl": 0, "href": 0, "nxdlformat": 0, "symbol": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 116, 145, 148, 151, 152], "here": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 48, 62, 89, 97, 114, 115, 116, 120, 121, 122, 125, 127, 128, 133, 143, 147, 151, 154], "coordin": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 52, 72, 73, 76, 80, 82, 83, 86, 89, 97, 131, 144, 147, 151], "dataset": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 95, 97, 114, 116, 118, 119, 120, 121, 122, 123, 125, 126, 128, 133, 138, 143, 147, 148, 151, 152, 154], "same": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 51, 52, 53, 55, 60, 65, 72, 75, 80, 82, 84, 89, 91, 95, 107, 114, 115, 116, 118, 119, 120, 121, 123, 126, 127, 134, 138, 141, 143, 146, 147, 148, 151, 152, 154], "monochromat": [0, 10, 11, 12, 14, 29, 36, 116, 152], "singl": [0, 4, 10, 11, 19, 22, 23, 29, 31, 32, 33, 34, 36, 46, 47, 48, 49, 50, 52, 53, 57, 61, 65, 66, 72, 82, 83, 87, 107, 114, 116, 118, 120, 122, 127, 130, 137, 143, 147, 151, 152], "start_tim": [0, 2, 3, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 49, 53, 68, 88, 97, 103, 104, 114, 134, 146], "nx_date_tim": [0, 2, 3, 4, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 38, 49, 52, 53, 55, 65, 68, 70, 79, 81, 82, 87, 88, 97, 103, 104, 107, 114, 115, 146], "offici": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 103, 104, 107], "enumer": [0, 46, 52, 57, 87, 114, 143, 145, 146], "electron": [0, 2, 3, 4, 8, 10, 11, 12, 18, 19, 21, 22, 23, 24, 25, 26, 29, 36, 49, 53, 55, 59, 87, 88, 152], "nx_wavelength": [0, 4, 10, 11, 12, 14, 29, 32, 39, 46, 49, 52, 56, 62, 63, 69, 92, 103, 104, 146], "optimum": [0, 10, 46], "axi": [0, 3, 4, 11, 19, 20, 24, 26, 36, 37, 38, 40, 45, 47, 48, 49, 51, 52, 62, 66, 67, 68, 76, 85, 86, 87, 89, 90, 92, 93, 94, 100, 107, 116, 121, 133, 138, 146, 148, 151, 154], "nx_int": [0, 3, 4, 6, 8, 9, 10, 11, 12, 13, 15, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 29, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 60, 61, 62, 63, 65, 72, 77, 80, 82, 87, 88, 92, 93, 97, 103, 104, 107, 114, 116, 133, 146], "signal": [0, 4, 9, 10, 11, 21, 22, 23, 27, 28, 29, 32, 48, 49, 52, 53, 62, 84, 88, 97, 103, 107, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 138, 148, 151, 152], "alreadi": [0, 4, 10, 11, 49, 114, 116, 120, 121, 123, 125, 126, 128, 130, 137, 147], "effici": [0, 10, 48, 49, 68, 77, 127, 128, 137], "rotat": [0, 2, 4, 5, 10, 12, 13, 14, 15, 16, 17, 19, 20, 24, 25, 30, 31, 34, 35, 36, 46, 52, 56, 82, 87, 89, 92, 94, 103, 104, 108, 109, 116, 125, 133, 146, 151], "diagram": [0, 10, 82, 133], "obtain": [0, 4, 10, 82, 115, 132, 138, 147, 154], "omega": [0, 4, 10, 82], "2theta": [0, 10, 46, 82], "tradit": [0, 10, 49, 82, 116], "mode": [0, 3, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 34, 49, 55, 65, 68, 87, 103, 104, 107, 114, 120, 138, 147, 151], "preset": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 68, 107], "clock": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 49, 52, 65, 68, 107, 146], "timer": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 68, 107], "integr": [0, 10, 13, 14, 20, 22, 24, 25, 29, 49, 68, 80, 130, 154], "nx_ani": [0, 3, 10, 12, 13, 14, 20, 24, 25, 26, 29, 35, 39, 46, 48, 49, 62, 65, 68, 78, 82, 84, 116, 146], "total": [0, 10, 11, 13, 14, 19, 20, 24, 25, 29, 41, 49, 52, 63, 65, 68, 103, 104], "target": [0, 6, 9, 10, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 34, 35, 78, 87, 95, 97, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116, 119, 120, 123, 126, 127, 128], "far": [0, 116, 127], "capabl": [0, 116, 128, 137, 154], "handi": 0, "reli": [0, 133, 154], "retriev": [0, 133, 152, 154], "subject": 0, "regular": [0, 19, 114, 115, 147, 151], "pattern": [0, 4, 48, 52, 87, 94, 97, 114, 137, 147], "note": [0, 4, 11, 19, 37, 39, 41, 46, 48, 51, 52, 53, 54, 62, 65, 70, 72, 79, 81, 87, 88, 89, 103, 104, 107, 110, 114, 116, 121, 122, 126, 130, 133, 134, 138, 143, 146, 147, 148, 151, 154, 155], "length": [0, 4, 11, 14, 15, 16, 35, 46, 48, 49, 57, 59, 63, 80, 82, 83, 85, 87, 89, 92, 93, 100, 114, 116, 119, 126, 134, 141, 143, 146, 147, 148, 151, 152], "limit": [0, 4, 29, 78, 114, 116, 130, 136, 138, 143, 144, 147], "63": [0, 114, 147], "charact": [0, 82, 114, 115, 116, 133, 134, 138, 141, 147], "impos": [0, 114, 130], "sensibl": [0, 18, 114, 133, 155], "separ": [0, 46, 49, 52, 57, 61, 63, 82, 83, 85, 88, 95, 102, 107, 109, 114, 121, 131, 133, 136, 138, 143, 147, 151, 154], "multi": [0, 4, 46, 65, 66, 80, 87, 88, 94, 110, 116, 127, 128, 137, 147], "word": [0, 21, 22, 23, 53, 78, 88, 114, 137, 147, 148], "underscor": [0, 114], "someth": [0, 4, 29, 49, 119, 120, 143, 147, 152], "databas": [0, 2, 54, 91], "ahead": 0, "nxarchiv": [0, 36], "context": [0, 4, 147, 151], "mention": [0, 89, 116, 127, 154], "adher": [0, 110, 151], "second": [0, 4, 8, 11, 18, 29, 46, 47, 49, 72, 84, 86, 91, 96, 107, 114, 116, 120, 147, 152], "often": [0, 4, 8, 29, 49, 52, 65, 68, 116, 133, 137, 147], "want": [0, 5, 82, 83, 120, 121, 127, 133, 134, 138, 143, 147, 152], "complet": [0, 11, 40, 94, 95, 114, 115, 116, 120, 127, 132, 133, 144, 147, 151, 154], "state": [0, 58, 68, 82, 95, 107, 109, 116, 132, 134, 154], "abl": [0, 110, 114, 127, 143], "went": 0, "wrong": [0, 143, 146], "unsatisfactori": 0, "site": [0, 120, 132, 134], "polici": [0, 144], "boss": [0, 116], "current": [0, 19, 58, 87, 98, 99, 101, 102, 105, 108, 114, 115, 116, 121, 126, 127, 130, 132, 134, 135, 137, 138, 144, 146, 147, 154], "head": [0, 106, 109, 116], "mani": [0, 4, 11, 49, 51, 69, 85, 111, 116, 124, 125, 127, 130, 136, 137, 143, 145, 147, 151, 152, 154], "nxuser": [0, 2, 21, 22, 23, 53, 88, 94, 103, 104, 107, 151], "knock": 0, "silli": 0, "over": [0, 11, 17, 49, 68, 82, 114, 116, 138, 143, 147], "scientif": [0, 36, 125, 127, 128, 130, 131, 134, 144, 145, 147, 151, 154, 155], "account": [0, 8, 11, 49, 90, 95], "depart": 0, "sad": 0, "ask": [0, 116, 130, 131, 152, 153, 154], "preposter": 0, "bill": 0, "judgment": 0, "allow": [0, 4, 11, 16, 24, 25, 64, 65, 76, 78, 79, 81, 86, 91, 95, 114, 115, 116, 127, 130, 133, 134, 136, 137, 142, 143, 145, 147, 151, 152, 154], "prefix": [0, 114, 115, 116, 120, 132], "nx": [0, 19, 26, 48, 81, 114, 115, 116, 118, 120, 121, 125, 127, 133, 134, 147, 151, 152], "multipl": [0, 4, 8, 11, 19, 46, 48, 49, 50, 51, 62, 66, 70, 72, 79, 80, 82, 83, 88, 94, 114, 116, 127, 143, 147, 151], "relat": [0, 4, 11, 40, 48, 49, 52, 87, 94, 116, 120, 121, 122, 123, 130, 136, 144, 147, 151, 152], "result": [0, 4, 26, 36, 39, 74, 80, 112, 114, 116, 120, 130, 133, 151, 154], "interpret": [0, 4, 97, 107, 116, 142, 155], "standalon": [0, 120], "e": [0, 4, 11, 18, 19, 20, 38, 39, 48, 49, 50, 53, 54, 65, 68, 70, 76, 78, 82, 84, 86, 88, 89, 91, 94, 95, 107, 114, 116, 132, 133, 134, 137, 138, 143, 146, 147, 151, 152], "mind": [0, 3, 4, 127], "stai": [0, 127], "constant": [0, 49, 61, 82, 107, 116, 120, 143], "across": [0, 49, 84, 116, 137, 147], "reduct": [0, 8, 14, 15, 18, 28, 52, 65, 107, 114, 133, 145, 151, 154], "encourag": [0, 48, 110, 112, 114, 127, 133, 137], "implement": [0, 4, 16, 36, 48, 114, 116, 127, 128, 133, 134, 135, 137, 138, 143, 151, 154], "nxprocess": [0, 4, 8, 18, 26, 28, 53, 88, 94, 114, 116, 151], "preserv": [0, 107, 114, 123, 152], "proven": [0, 79], "achiev": [0, 55, 97, 116], "pete": [1, 111, 125], "r": [1, 46, 56, 57, 82, 84, 89, 100, 114, 121, 134], "jemian": [1, 111], "anl": [1, 111, 130, 137], "gov": [1, 111, 154], "advanc": [1, 133, 137, 147], "photon": [1, 11, 19, 41, 49, 59, 137], "argonn": [1, 130, 137], "nation": [1, 128, 130, 137, 154], "laboratori": [1, 29, 82, 116, 130, 137, 154, 155], "il": 1, "frederick": 1, "akeroyd": 1, "freddi": 1, "stfc": [1, 114], "ac": [1, 114, 154], "uk": [1, 114, 154], "rutherford": [1, 154], "appleton": [1, 154], "didcot": 1, "stuart": 1, "campbel": 1, "campbellsi": 1, "ornl": [1, 103, 104, 109, 130], "oak": [1, 137, 154], "ridg": [1, 137, 154], "tn": 1, "przemek": [1, 130, 137], "klosowski": [1, 130, 134, 137], "nist": [1, 4, 126, 130, 137, 154], "maryland": 1, "gaithersburg": 1, "md": [1, 120, 154], "mark": [1, 27, 75, 114, 119, 130, 132, 137, 146, 147, 151], "k\u00f6nneck": [1, 130, 137], "koenneck": [1, 119, 134], "psi": [1, 17, 120, 130, 154], "ch": [1, 120], "paul": [1, 126, 137], "scherrer": 1, "institut": [1, 130, 133, 137, 154], "5232": 1, "villigen": 1, "switzerland": [1, 137], "osborn": [1, 130, 134, 137], "rosborn": 1, "peter": 1, "f": [1, 107, 121, 122, 123, 133, 154], "peterson": 1, "petersonpf": 1, "spallat": [1, 2, 4, 87, 103, 104, 109], "tobia": 1, "richter": 1, "esss": 1, "se": [1, 54], "european": [1, 114, 130, 137], "lund": 1, "sweden": 1, "joachim": 1, "wuttk": 1, "j": [1, 4, 11, 39, 47, 49, 51, 55, 72, 84, 107, 114, 118, 133, 146, 147], "fz": 1, "juelich": 1, "de": 1, "forschungszentrum": 1, "j\u00fclich": 1, "centr": [1, 45, 52, 66, 68, 76, 86, 92, 152], "heinz": 1, "maier": 1, "leibnitz": 1, "zentrum": 1, "garch": 1, "germani": 1, "statu": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115, 116, 118, 124, 127, 131, 154], "applic": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 48, 53, 81, 88, 94, 97, 103, 104, 109, 110, 112, 114, 115, 124, 127, 128, 129, 130, 131, 133, 136, 137, 143, 144, 145, 147, 151, 152, 153, 154, 155], "definit": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 122, 124, 125, 127, 129, 130, 131, 133, 134, 136, 137, 138, 141, 144, 149, 150, 151, 152, 153, 154, 155], "thi": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 133, 134, 136, 137, 138, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "data": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 48, 49, 50, 51, 53, 55, 61, 62, 64, 65, 66, 68, 70, 75, 79, 80, 81, 82, 84, 88, 94, 95, 97, 103, 104, 107, 109, 110, 112, 116, 118, 119, 120, 127, 128, 130, 131, 134, 136, 137, 138, 141, 142, 144, 145, 146, 147, 153, 155], "archiv": [2, 36, 109, 110, 132, 136, 144, 154], "icat": [2, 36], "icatproject": [2, 36], "No": [2, 3, 4, 5, 17, 33, 37, 38, 39, 40, 41, 42, 43, 44, 45, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 61, 63, 64, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 76, 77, 78, 79, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115, 125, 147], "cite": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115], "nx_char": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 114, 115, 116, 118, 120, 128, 134, 143, 146], "experiment_identifi": [2, 53, 88, 103, 104], "uniqu": [2, 4, 11, 50, 53, 64, 88, 89, 91, 107, 114, 116, 120, 128, 137, 147], "experiment_descript": [2, 53, 88], "brief": [2, 53, 84, 88, 131, 133, 134, 143], "object": [2, 4, 43, 53, 71, 72, 73, 76, 85, 86, 88, 90, 94, 95, 110, 121, 127, 130, 143, 145, 147, 148, 151], "collection_identifi": [2, 53, 88, 103, 104], "id": [2, 4, 11, 29, 47, 50, 53, 55, 72, 75, 80, 88, 91, 103, 104, 116], "daq": [2, 49], "file": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 46, 48, 49, 53, 67, 70, 72, 75, 81, 88, 94, 97, 103, 104, 107, 109, 110, 115, 125, 127, 130, 131, 132, 137, 138, 141, 142, 143, 145, 146, 147, 148, 153, 154], "collection_descript": [2, 53, 88], "summari": [2, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 114, 147, 154], "criteria": [2, 53, 88], "entry_identifi": [2, 53, 88, 103, 104], "facil": [2, 4, 11, 50, 53, 81, 87, 88, 91, 94, 103, 104, 107, 114, 127, 133, 137, 147, 151, 154, 155], "end_tim": [2, 11, 12, 13, 14, 16, 19, 24, 25, 53, 68, 88, 97, 103, 104, 114, 134, 146], "durat": [2, 22, 23, 53, 65, 88, 103, 104], "nx_time": [2, 3, 11, 49, 52, 53, 55, 65, 68, 87, 88, 98, 99, 103, 104, 146], "todo": [2, 3, 62, 107], "need": [2, 4, 11, 16, 24, 39, 48, 49, 53, 62, 72, 78, 81, 84, 88, 89, 95, 97, 107, 114, 115, 116, 119, 120, 121, 123, 127, 132, 133, 137, 138, 141, 143, 145, 147, 148, 151, 154], "collection_tim": [2, 53, 88], "run_cycl": [2, 53, 88], "revis": [2, 53, 62, 88, 114, 117, 131, 143, 147], "recalibr": 2, "reprocess": [2, 53, 88], "nexu": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 43, 44, 48, 53, 55, 62, 64, 70, 71, 75, 80, 81, 88, 89, 94, 96, 97, 104, 107, 109, 111, 113, 125, 126, 127, 131, 141, 142, 146, 147, 148, 155], "nxdl": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 114, 115, 116, 127, 129, 130, 131, 132, 133, 134, 136, 148, 149, 154, 155], "which": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 97, 100, 104, 107, 110, 112, 114, 116, 118, 119, 120, 121, 122, 123, 127, 128, 130, 132, 133, 134, 136, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154], "obligatori": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 49, 51, 53, 62, 81, 88, 97, 103, 104, 107], "The": [2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 40, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 60, 62, 65, 66, 67, 68, 69, 72, 73, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 93, 94, 95, 96, 97, 106, 107, 109, 111, 112, 113, 114, 115, 118, 119, 120, 121, 122, 123, 124, 125, 127, 128, 129, 130, 131, 132, 133, 135, 136, 137, 138, 140, 141, 142, 143, 146, 147, 148, 149, 151, 154, 155], "us": [2, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 107, 109, 110, 111, 115, 116, 122, 123, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 141, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "release_d": 2, "releas": [2, 114, 115, 120, 130, 131, 134, 137, 140, 141, 143, 154, 155], "pd": 2, "role": [2, 91, 103, 104, 114], "facility_user_id": [2, 91, 103, 104], "burocraci": 2, "instrument": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 46, 49, 52, 53, 62, 64, 68, 84, 88, 94, 97, 103, 104, 107, 114, 116, 120, 121, 123, 125, 126, 127, 133, 137, 144, 145, 147, 148, 151, 152, 154, 155], "puls": [2, 4, 49, 52, 55, 64, 67, 68, 87, 103, 135, 137, 146, 150, 152], "reactor": [2, 4, 55, 64, 87], "synchrotron": [2, 4, 19, 63, 87, 93, 94, 133, 136, 147, 151], "muon": [2, 4, 53, 87, 88, 112, 114, 127, 133, 137, 144, 145, 154], "anod": [2, 4, 87], "fix": [2, 3, 4, 17, 51, 82, 87, 89, 114, 116, 120, 130, 138, 143, 146], "tube": [2, 4, 47, 50, 87, 95, 116], "sample_id": 2, "calibr": [2, 11, 28, 49, 53, 82, 88, 103, 104, 116, 127], "normalis": [2, 19, 43, 68, 82], "simul": [2, 39, 60, 82, 116], "none": [2, 19, 43, 44, 47, 48, 50, 51, 55, 65, 70, 71, 72, 74, 75, 80, 82, 85, 89, 91, 100, 147], "sample_environ": 2, "chemical_formula": [2, 46, 57, 82, 83, 95, 116], "chemic": [2, 46, 57, 82, 83, 95, 116, 133], "formula": [2, 46, 57, 82, 83, 95, 116], "cif": [2, 46, 57, 75, 82, 83, 95, 114, 116], "preparation_d": [2, 82], "situat": [2, 48, 60, 82, 114, 115, 116, 127, 147, 152], "environ": [2, 8, 82, 116, 133, 137, 142, 143, 154], "air": [2, 82], "vacuum": [2, 61, 62, 66, 82], "oxid": 2, "atmospher": [2, 61, 62, 66, 82], "dehydr": 2, "nx_temperatur": [2, 3, 4, 11, 17, 46, 57, 67, 82, 103, 104, 146], "magnetic_field": [2, 41, 82, 84, 151, 152], "nx_current": [2, 41, 58, 87, 98, 99, 101, 102, 105, 108, 146], "electric_field": [2, 82, 84], "nx_voltag": [2, 82, 87, 98, 99, 101, 102, 105, 108, 146], "stress_field": [2, 82], "nx_unitless": [2, 11, 22, 46, 56, 61, 62, 63, 66, 73, 77, 80, 82, 89, 92, 95, 103, 104, 133, 146], "pressur": [2, 4, 48, 49, 82, 83, 84, 93, 114, 133, 146, 147], "nx_pressur": [2, 49, 82, 93, 146], "rest": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 145], "web": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 120, 127, 132, 144], "page": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 132, 143, 144, 154], "html": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 118, 120, 121, 122, 127, 130, 131, 136, 137, 138, 139, 142, 144, 147, 154], "end": [2, 11, 12, 13, 14, 16, 19, 24, 25, 53, 55, 63, 68, 76, 86, 87, 88, 89, 97, 103, 104, 114, 116, 118, 120, 126, 147, 151], "date": [2, 4, 11, 26, 28, 48, 49, 70, 79, 81, 82, 87, 103, 104, 107, 124, 127, 146], "cycl": [2, 49, 53, 61, 88], "electr": [2, 78, 82, 83, 94, 146], "magnet": [2, 41, 52, 63, 64, 82, 83, 84, 94, 99, 101, 102, 105, 108, 109, 133, 152], "prepar": [2, 82, 115, 138, 145], "stress": [2, 82, 83, 84], "github": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 114, 115, 116, 120, 121, 125, 127, 129, 130, 132, 134, 135, 138, 139, 140, 141, 142, 143, 145, 147, 150, 154, 155], "com": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 114, 115, 116, 120, 121, 125, 127, 129, 130, 132, 134, 135, 138, 139, 140, 141, 142, 143, 145, 147, 150, 154, 155], "blob": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 116, 120, 134, 138, 142, 154], "main": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 118, 119, 121, 125, 130, 134, 136, 145], "an": [3, 4, 6, 10, 11, 12, 13, 14, 15, 16, 19, 20, 22, 24, 26, 27, 30, 31, 33, 34, 35, 36, 37, 38, 41, 42, 44, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 59, 60, 61, 62, 63, 65, 66, 68, 69, 70, 75, 76, 79, 80, 81, 82, 84, 85, 86, 88, 89, 91, 93, 94, 95, 96, 97, 100, 102, 107, 109, 110, 114, 115, 116, 118, 119, 121, 122, 123, 125, 126, 127, 128, 130, 132, 133, 134, 137, 138, 141, 142, 143, 145, 146, 147, 148, 151, 152, 154, 155], "angular": [3, 11, 36, 45, 49, 52, 63, 89], "resolv": [3, 4, 11, 36, 49, 53, 81, 88, 107, 114, 116, 130, 135, 143, 147, 151], "photo": [3, 36, 116], "spectroscopi": [3, 27, 36, 151], "drawn": 3, "hemispher": 3, "analys": [3, 7, 8, 20], "nxdata": [3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 103, 104, 107, 115, 118, 119, 120, 121, 122, 123, 125, 126, 127, 130, 133, 134, 137, 138, 146, 147, 148, 151, 152], "nxmonochrom": [3, 6, 7, 12, 14, 19, 27, 29, 64, 94, 116, 151, 152], "entry1": [3, 14, 15, 27, 28, 118, 143, 147, 151], "entry2": [3, 14, 15, 27, 28, 147, 151], "energi": [3, 5, 6, 7, 11, 17, 18, 19, 27, 28, 32, 36, 39, 41, 42, 48, 49, 56, 59, 63, 69, 87, 95, 97, 107, 114, 137, 146, 147, 148, 151, 152, 154], "nx_number": [3, 4, 8, 11, 14, 15, 17, 18, 19, 46, 47, 48, 49, 51, 52, 55, 57, 62, 65, 68, 72, 76, 78, 80, 86, 87, 89, 97, 100, 107, 116, 146, 147, 148, 151], "nx_energi": [3, 5, 7, 11, 17, 18, 20, 39, 41, 49, 56, 63, 69, 87, 146], "lens_mod": 3, "len": [3, 42, 93, 94, 120, 121, 141], "acquisition_mod": [3, 49], "swept": 3, "entrance_slit_shap": 3, "curv": [3, 56, 94, 116], "straight": 3, "entrance_slit_set": 3, "dial": [3, 80, 154], "entranc": 3, "slit": [3, 4, 52, 56, 76, 86, 94], "entrance_slit_s": 3, "nx_length": [3, 4, 7, 9, 11, 13, 14, 15, 17, 20, 21, 22, 23, 24, 25, 29, 33, 35, 38, 39, 40, 41, 42, 45, 46, 47, 49, 51, 52, 53, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 72, 76, 80, 82, 83, 85, 86, 87, 88, 89, 90, 92, 93, 97, 98, 99, 101, 102, 103, 104, 105, 108, 146], "pass_energi": 3, "time_per_channel": [3, 11], "clearli": [3, 114, 146], "appli": [3, 4, 11, 17, 48, 49, 51, 65, 80, 82, 83, 89, 107, 116, 118, 119, 130, 146, 147, 151], "method": [3, 43, 48, 49, 65, 110, 114, 116, 118, 119, 122, 130, 137, 143, 147], "sensor_s": 3, "2": [3, 4, 11, 14, 15, 24, 36, 39, 48, 49, 50, 51, 52, 61, 62, 68, 72, 75, 80, 87, 95, 103, 107, 116, 120, 121, 123, 124, 126, 128, 130, 132, 133, 134, 141, 143, 145, 146, 147, 148, 151, 154, 155], "raw": [3, 4, 5, 6, 7, 8, 13, 14, 15, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 49, 65, 78, 103, 104, 110, 114, 130, 133], "activ": [3, 125, 127, 138, 144], "region_origin": 3, "origin": [3, 11, 26, 28, 29, 37, 38, 40, 41, 42, 44, 45, 46, 47, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 70, 72, 73, 76, 77, 78, 81, 82, 84, 85, 86, 87, 90, 92, 93, 103, 104, 107, 114, 116, 120, 122, 123, 125, 127, 128, 138, 147, 151], "rectangular": [3, 11, 18, 40, 50, 114], "region": [3, 49, 107], "readout": [3, 11, 49], "region_s": 3, "acquisit": [3, 43, 49, 53, 65, 88, 107, 114, 116, 133, 137, 154], "pass": [3, 38, 52, 57, 94, 95, 116, 138, 143, 147], "sensor": [3, 11, 29, 49, 52, 54, 57, 84, 94], "channel": [3, 11, 13, 107, 116, 118], "cansa": [4, 36, 114, 130], "standard": [4, 11, 36, 38, 46, 48, 49, 57, 65, 69, 80, 82, 83, 95, 96, 110, 112, 114, 115, 116, 118, 121, 127, 130, 132, 133, 134, 138, 143, 145, 147, 151, 152], "store": [4, 11, 16, 18, 19, 25, 36, 39, 48, 49, 55, 65, 70, 73, 82, 94, 107, 118, 119, 121, 122, 123, 125, 126, 127, 128, 130, 131, 133, 134, 137, 141, 142, 143, 145, 147, 148, 151, 153], "reduc": [4, 8, 14, 18, 19, 36, 38, 49, 57, 82, 94, 110, 120, 138, 143, 145, 151], "small": [4, 14, 36, 53, 88, 116, 123, 127, 133, 144, 145, 147, 148], "scatter": [4, 14, 34, 36, 38, 39, 46, 48, 82, 83, 90, 95, 116, 127, 130, 133, 136, 137, 145, 146, 147, 154], "cansas1d": 4, "1": [4, 9, 11, 20, 23, 24, 27, 28, 29, 32, 46, 48, 49, 50, 53, 57, 62, 68, 70, 75, 79, 80, 82, 83, 84, 87, 89, 95, 97, 103, 104, 107, 109, 110, 113, 115, 116, 118, 119, 120, 121, 122, 123, 125, 126, 127, 128, 130, 132, 133, 134, 141, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "io": [4, 114, 118, 120, 121, 122, 154, 155], "cansas2012": 4, "nxcansas_exampl": 4, "minimum": [4, 19, 36, 65, 78, 103, 104, 110, 115, 116, 122, 127, 133, 138, 147, 151], "describ": [4, 11, 36, 37, 43, 46, 47, 48, 50, 53, 55, 59, 61, 62, 66, 69, 72, 73, 75, 76, 80, 84, 86, 87, 88, 89, 90, 94, 110, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 127, 128, 132, 133, 134, 137, 138, 145, 146, 147, 148, 151, 152, 154], "full": [4, 11, 30, 31, 34, 35, 46, 49, 52, 53, 78, 80, 84, 88, 95, 120, 122, 123, 127, 130, 143, 154], "imag": [4, 11, 16, 19, 24, 25, 33, 48, 49, 51, 53, 65, 70, 88, 97, 114, 116, 132, 147, 151, 152, 154], "inform": [4, 11, 12, 16, 21, 22, 23, 36, 37, 39, 42, 48, 49, 53, 54, 55, 60, 65, 70, 73, 75, 79, 82, 88, 91, 93, 94, 95, 110, 112, 114, 115, 116, 118, 120, 122, 127, 130, 131, 132, 133, 134, 137, 138, 143, 145, 147, 153, 154, 155], "specif": [4, 11, 19, 48, 49, 62, 89, 95, 104, 107, 110, 114, 115, 116, 119, 120, 124, 127, 133, 134, 136, 138, 144, 145, 147, 152, 154, 155], "dimension": [4, 11, 48, 49, 51, 65, 75, 118, 121, 138, 147, 151], "sa": [4, 14, 15, 36, 151, 154], "consist": [4, 11, 50, 51, 62, 83, 89, 94, 114, 115, 116, 134, 146], "vec": 4, "q": [4, 8, 18, 20, 36, 46, 100, 107, 146], "extern": [4, 54, 62, 66, 70, 82, 84, 94, 130], "practis": 4, "wa": [4, 8, 11, 18, 26, 28, 43, 46, 53, 55, 57, 59, 62, 65, 68, 70, 79, 80, 81, 88, 107, 114, 115, 116, 118, 120, 121, 122, 123, 126, 128, 130, 133, 134, 136, 137, 138, 143, 145, 147, 151, 154], "acquir": [4, 14, 15, 49, 107, 120, 137, 152], "process": [4, 14, 18, 26, 28, 36, 53, 59, 74, 78, 79, 88, 94, 95, 116, 120, 127, 133, 137, 143, 145, 147, 154], "yet": [4, 107, 116, 154, 155], "To": [4, 11, 62, 88, 95, 97, 110, 114, 120, 121, 123, 125, 127, 132, 134, 137, 144, 151], "cansas_class": 4, "map": [4, 47, 55, 75, 114, 116, 151, 154], "nx_class": [4, 81, 88, 114, 116, 118, 119, 120, 121, 122, 123, 126, 128, 133, 146, 152], "sasentri": 4, "sasdata": 4, "sasdetector": 4, "sasinstru": 4, "sasnot": 4, "nxnote": [4, 37, 49, 53, 54, 79, 87, 88, 93, 94, 103, 104, 107, 116], "sasprocess": 4, "sasprocessnot": 4, "nxcollect": [4, 11, 17, 49, 53, 62, 64, 88, 94, 97, 103, 104, 116, 120], "sastransmiss": 4, "sastransmission_spectrum": 4, "sassampl": 4, "sassourc": 4, "chosen": [4, 89, 114, 116, 130], "system": [4, 29, 36, 46, 52, 57, 76, 80, 82, 83, 86, 95, 128, 129, 130, 133, 137, 138, 142, 143, 147, 154], "direct": [4, 5, 7, 11, 14, 15, 19, 24, 25, 26, 29, 35, 36, 38, 41, 45, 46, 49, 51, 52, 62, 73, 76, 82, 85, 87, 89, 94, 97, 114, 116, 125], "y": [4, 9, 11, 13, 14, 15, 19, 24, 25, 26, 29, 35, 37, 38, 40, 41, 45, 47, 48, 49, 52, 62, 66, 67, 68, 72, 73, 76, 80, 82, 86, 87, 89, 90, 97, 103, 104, 114, 116, 120, 121, 126, 147], "z": [4, 11, 19, 24, 25, 26, 29, 37, 38, 40, 45, 47, 48, 49, 52, 62, 66, 67, 68, 72, 73, 76, 82, 86, 87, 89, 90, 114, 115, 116, 147], "ax": [4, 11, 19, 24, 32, 48, 49, 62, 84, 85, 89, 90, 97, 103, 107, 116, 118, 119, 121, 122, 123, 126, 128, 133, 134, 138, 146, 148, 151, 152], "short": [4, 11, 49, 54, 64, 82, 84, 87, 128, 133, 152, 154], "i_ax": 4, "q_indic": 4, "nx_per_length": [4, 58, 100, 146], "nxapertur": [4, 64, 76, 86, 94, 103, 104, 147], "nxcollim": [4, 14, 15, 64, 94], "child": [4, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 121, 147], "techniqu": [4, 14, 15, 36, 88, 110, 116, 127, 155], "replac": [4, 48, 88, 114, 116, 120, 143, 151, 152], "numer": [4, 11, 61, 66, 75, 114, 116, 122, 123, 154], "engin": [4, 40, 41, 63, 67, 87, 114, 116, 121, 145, 147, 154], "unidata": [4, 114], "udunit": [4, 114], "compat": [4, 97, 109, 114, 137, 144], "instruct": [4, 114, 118, 120, 123, 125, 132, 143, 147], "deriv": [4, 9, 11, 26, 28, 29, 80, 82, 84, 114, 115, 119, 147], "declar": [4, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 115, 116, 120, 137, 145, 147, 151], "ambigu": [4, 53, 81, 88, 107, 114, 116, 146, 147], "than": [4, 11, 19, 46, 48, 49, 52, 53, 57, 60, 65, 75, 80, 81, 88, 89, 91, 97, 107, 110, 114, 115, 116, 120, 121, 123, 127, 128, 132, 137, 145, 146, 147, 148, 151, 154, 155], "represent": [4, 11, 16, 47, 114, 115, 116, 125, 133, 137, 146, 147, 151], "Such": [4, 11, 19, 48, 53, 88, 89, 107, 110, 114, 115, 116, 120, 151], "subentri": [4, 53, 88, 107], "recogn": [4, 46, 57, 82, 83, 88, 95, 114, 121, 123, 137], "could": [4, 11, 39, 48, 49, 50, 54, 61, 82, 94, 114, 115, 121, 133, 145, 146, 147, 152], "els": [4, 29, 49, 73, 90, 116, 121, 125], "repres": [4, 11, 16, 29, 49, 50, 53, 64, 75, 88, 115, 116, 121, 125, 127, 130, 133, 136, 137, 143, 147, 148, 151], "identif": [4, 54, 64, 84, 91], "en": [4, 18, 20, 107, 114, 118, 121, 122, 145, 147], "entiti": [4, 133, 134, 138, 147], "associ": [4, 11, 48, 53, 68, 82, 107, 116, 118, 119, 120, 122, 130, 132, 133, 136, 145, 147, 151], "correl": [4, 65, 80], "vector": [4, 11, 39, 46, 51, 73, 84, 85, 89, 97, 116, 147], "magnitud": 4, "sasdata01": 4, "sure": [4, 89, 120, 125], "sever": [4, 11, 29, 49, 62, 112, 114, 116, 120, 130, 133, 137, 147, 151, 154], "mask_indic": 4, "indic": [4, 11, 17, 24, 26, 46, 47, 48, 49, 50, 51, 53, 62, 72, 80, 82, 97, 107, 114, 115, 116, 119, 126, 128, 141, 146, 147, 148], "relationship": [4, 48, 114, 127], "vari": [4, 8, 11, 16, 49, 51, 82, 85, 114, 137, 151], "paramet": [4, 8, 18, 26, 28, 46, 53, 54, 57, 59, 63, 74, 82, 83, 85, 88, 94, 100, 103, 104, 107, 116, 118, 120, 133, 138, 141, 147], "temperature_indic": [4, 48, 114, 151], "pressure_indic": [4, 48, 114], "arrai": [4, 11, 13, 16, 19, 26, 30, 31, 34, 35, 39, 41, 46, 48, 49, 50, 51, 55, 61, 65, 66, 68, 75, 80, 82, 83, 85, 97, 107, 115, 116, 118, 120, 133, 134, 137, 141, 143, 145, 146, 147, 148, 151, 152, 154], "independ": [4, 11, 48, 107, 114, 147, 154], "everi": [4, 48, 52, 55, 65, 72, 114, 127, 130, 133, 144, 147, 152, 154], "five": [4, 55, 65], "list": [4, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 52, 55, 57, 59, 61, 62, 72, 80, 82, 83, 87, 89, 95, 107, 110, 112, 114, 115, 116, 121, 124, 127, 132, 133, 134, 140, 141, 145, 147, 148, 154], "intens": [4, 11, 18, 19, 38, 49, 57, 63, 80, 87, 94, 95, 107, 125], "5": [4, 11, 49, 50, 75, 80, 95, 114, 116, 118, 119, 120, 121, 130, 134, 143, 147, 148, 154, 155], "zero": [4, 46, 48, 55, 65, 89, 107, 114, 116, 118, 146, 147], "3": [4, 9, 11, 24, 29, 46, 47, 48, 49, 50, 51, 53, 57, 72, 77, 80, 82, 83, 88, 89, 90, 97, 103, 104, 107, 113, 116, 120, 121, 122, 126, 128, 130, 132, 133, 134, 143, 146, 147, 154], "4": [4, 11, 49, 50, 62, 80, 81, 95, 114, 116, 118, 120, 121, 126, 130, 132, 133, 134, 138, 141, 143, 147, 148, 154], "three": [4, 11, 47, 48, 51, 85, 89, 114, 116, 118, 130, 133, 137, 143, 148, 152, 154], "t": [4, 48, 84, 89, 107, 114, 118, 120, 121, 122, 123, 126, 127, 138, 145, 146], "mask": [4, 11, 49, 59, 80, 114], "boolean": [4, 11], "where": [4, 9, 11, 14, 15, 30, 35, 46, 48, 49, 52, 55, 57, 62, 68, 73, 80, 81, 82, 83, 84, 89, 90, 95, 107, 114, 115, 120, 121, 123, 127, 130, 133, 137, 143, 146, 147, 148, 151, 152, 154], "fals": [4, 11, 48, 49, 146, 147], "true": [4, 11, 48, 49, 97, 120, 146, 147], "timestamp": [4, 52, 55, 65, 120, 121, 126], "iso": [4, 11, 114, 121], "8601": [4, 11, 114, 121], "accompani": [4, 114], "geometri": [4, 5, 7, 11, 14, 15, 31, 36, 37, 38, 40, 41, 45, 46, 47, 49, 51, 52, 56, 57, 60, 62, 63, 66, 67, 68, 69, 72, 73, 76, 82, 84, 86, 87, 89, 90, 92, 93, 94, 96, 97, 106, 107, 109], "pi": 4, "sin": 4, "warn": [4, 44, 110, 114, 119, 147, 151], "valid": [4, 11, 44, 49, 64, 75, 81, 94, 95, 104, 110, 114, 115, 116, 118, 119, 121, 127, 130, 131, 133, 138, 145, 146, 147, 153], "m": [4, 11, 57, 62, 66, 80, 107, 114, 116, 126, 127, 134, 146], "nm": [4, 87, 146], "prefer": [4, 47, 48, 53, 107, 114, 116, 127, 146, 151], "angstrom": [4, 69, 146], "uncertainti": [4, 48, 49, 65, 116], "flexibl": [4, 115, 116, 133], "q_uncertainti": 4, "estim": [4, 11, 49, 65, 80], "By": [4, 11, 114, 121, 127, 137, 143, 147], "deviat": [4, 48, 49, 65, 69, 80, 92, 114], "special": [4, 11, 49, 55, 94, 109, 110, 116, 133], "width": [4, 11, 17, 46, 56, 59, 85, 87, 92], "subdirectori": [4, 133, 147], "constitu": 4, "report": [4, 11, 112, 123, 127, 129, 131, 147], "resolut": [4, 12, 14, 53, 80, 88], "princip": 4, "qdev": 4, "smear": 4, "dqw": 4, "dql": 4, "demonstr": [4, 118, 120, 124, 151], "unanticip": 4, "assum": [4, 9, 11, 14, 15, 29, 45, 46, 57, 65, 82, 83, 89, 95, 107, 114, 116, 120, 121, 127, 134, 146, 152], "function": [4, 11, 36, 42, 61, 62, 65, 66, 82, 83, 94, 114, 118, 119, 126, 127, 133, 134, 138, 143], "approxim": [4, 19, 49], "equat": 4, "gaussian": [4, 11, 46], "resolutions_descript": 4, "lorentzian": 4, "squar": [4, 100], "9": [4, 11, 20, 49, 80, 114, 115, 118, 120, 121, 128, 148, 154, 155], "triangular": 4, "sawtooth": 4, "outward": 4, "vertic": [4, 24, 41, 46, 47, 72, 92, 116], "edg": [4, 47, 52, 61, 116], "larger": [4, 11, 112, 127, 155], "inward": 4, "smaller": [4, 11, 51, 127, 143], "bin": [4, 13, 49, 118, 120, 121, 122, 123, 133, 138, 143, 147, 148, 151], "rang": [4, 11, 49, 52, 53, 68, 88, 89, 114, 118, 121, 137, 147, 152], "contribut": [4, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 111, 114, 115, 116, 124, 127, 129, 131, 133, 136, 145, 147, 154, 155], "assess": 4, "subgroup": [4, 114, 115, 116, 148], "form": [4, 11, 47, 49, 62, 72, 75, 95, 100, 114, 116, 130, 133, 137, 144, 145, 147, 152, 154, 155], "absolut": [4, 11, 49, 52, 65, 90, 116, 120, 121, 122, 145, 147], "sigma": [4, 87], "differenti": [4, 138], "cross": [4, 38, 107], "volum": [4, 26, 36, 46, 57, 72, 82, 83, 95, 114, 116, 127, 146, 151], "solid": [4, 49, 67, 96, 109, 146], "cm": [4, 58, 87, 146], "sr": [4, 146], "atom": 4, "arbitrari": [4, 11, 30, 34, 48, 51, 65, 75, 97, 116], "ratio": [4, 52], "meaningless": 4, "present": [4, 11, 46, 48, 49, 54, 57, 59, 60, 65, 75, 82, 83, 95, 114, 115, 116, 120, 127, 130, 137, 138, 147, 152, 154, 155], "few": [4, 116, 121, 127, 143, 145], "fortun": 4, "area": [4, 11, 14, 15, 16, 29, 36, 39, 49, 51, 87, 114, 124, 132, 146, 152], "consider": [4, 112], "improv": [4, 62, 112, 147], "aris": [4, 116], "automat": [4, 11, 53, 88, 114, 121, 134, 136, 151], "convert": [4, 11, 49, 55, 60, 75, 114, 116, 121, 127, 137, 138, 141, 143, 154], "canon": [4, 116, 152], "differ": [4, 16, 26, 46, 48, 49, 52, 62, 63, 68, 78, 81, 89, 91, 95, 96, 107, 114, 115, 116, 121, 122, 125, 127, 128, 130, 137, 143, 147, 148, 151, 152], "indiscrimin": 4, "analyt": 4, "restrict": [4, 19, 84, 110, 114, 115, 146], "meaning": [4, 116], "fraction": [4, 68, 82, 83, 95, 114], "densiti": [4, 11, 46, 57, 58, 61, 66, 82, 83, 95, 116, 122, 146], "directli": [4, 11, 48, 49, 114, 116, 118, 121, 122, 123, 126, 128, 129, 132, 137, 145, 147], "factor": [4, 11, 48, 52, 65, 80, 107], "scale": [4, 11, 17, 26, 48, 65, 68, 94, 107, 114, 116, 118, 147, 148, 151], "sai": [4, 55, 65, 75, 127, 147, 148], "treat": [4, 19, 110, 151], "unknown": [4, 100, 107, 147], "handl": [4, 114, 116, 119, 121, 134, 138, 143, 145], "m2": 4, "m3": 4, "cm2": 4, "cm3": 4, "g": [4, 11, 38, 39, 49, 50, 53, 54, 68, 70, 78, 82, 84, 88, 89, 91, 94, 95, 107, 114, 116, 121, 126, 132, 133, 137, 146, 147, 152], "idev": [4, 127], "1d": [4, 116, 151], "scaling_factor": [4, 48, 65], "k": [4, 11, 47, 49, 51, 55, 63, 72, 80, 84, 88, 107, 114, 118, 120, 146, 147, 151], "multipli": [4, 46, 57, 82, 83, 89, 95, 114], "uniti": 4, "i_scal": 4, "i_scaling_dev": 4, "exact": [4, 36, 47, 51, 115, 116, 121, 137, 148], "those": [4, 11, 49, 100, 115, 116, 119, 121, 123, 127, 137, 145, 151, 155], "high": [4, 11, 49, 52, 84, 116, 121, 125, 133, 137, 154], "bons": 4, "hart": 4, "perpendicular": [4, 46, 116], "low": [4, 52, 53, 61, 84, 88, 110, 125, 133, 143, 154], "qmean": 4, "higher": [4, 75, 107, 114, 120, 121, 147], "shadowfactor": 4, "nx_dimensionless": [4, 20, 38, 49, 55, 57, 63, 68, 77, 146], "pixel": [4, 9, 11, 13, 14, 15, 19, 24, 25, 29, 35, 47, 49, 51, 72, 80, 97, 103, 104, 114, 115, 116, 147, 151], "affect": 4, "penumbra": 4, "ncnr": [4, 154], "barker": 4, "pedersen": 4, "1995": [4, 130, 137], "appl": [4, 133], "cryst": [4, 46, 57, 82, 133], "28": [4, 114, 121], "105": 4, "114": 4, "carefulli": [4, 123], "ignor": 4, "anlysi": 4, "nxbeam": [4, 11, 40, 64, 76, 82, 86, 94, 95, 97], "properti": [4, 11, 26, 36, 39, 49, 94, 114, 116], "downstream": [4, 60, 63, 90, 95], "apertur": [4, 12, 37, 42, 64, 85, 93, 94, 103, 104], "variat": [4, 11, 19, 25, 36, 68, 121, 123], "nxpinhol": [4, 94], "nxslit": [4, 94], "sasapertur": 4, "pinhol": [4, 76, 94], "blade": [4, 37, 45], "soller": [4, 45], "x_gap": [4, 86], "y_gap": [4, 86], "diverg": [4, 39, 41, 45, 97], "sascollim": 4, "amount": [4, 38, 143], "insert": [4, 63, 64, 94, 114, 145, 152], "san": [4, 14, 40, 127], "distanc": [4, 7, 9, 11, 13, 14, 15, 17, 21, 22, 23, 24, 25, 29, 38, 39, 40, 41, 42, 49, 52, 53, 56, 64, 67, 68, 78, 82, 87, 88, 90, 97, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116], "sdd": 4, "previou": [4, 49, 116, 121, 123, 136, 151], "camera": [4, 16, 32, 33, 35, 36, 120], "crystal": [4, 10, 22, 23, 29, 31, 32, 33, 34, 36, 46, 57, 64, 69, 77, 82, 83, 94, 103, 104, 107, 116, 148, 152], "slit_length": 4, "x_posit": 4, "y_posit": 4, "roll": 4, "about": [4, 48, 53, 79, 88, 89, 111, 112, 116, 118, 120, 122, 123, 127, 130, 131, 132, 133, 134, 137, 143, 144, 147, 151, 154], "pitch": 4, "yaw": 4, "beam_center_x": [4, 11, 14, 15, 35, 49, 97, 114], "center": [4, 9, 11, 14, 15, 23, 29, 35, 37, 38, 40, 49, 52, 62, 67, 76, 82, 85, 87, 90, 97, 114, 116, 128, 138], "hit": [4, 11, 14, 15, 35, 49, 143], "plane": [4, 11, 34, 39, 45, 46, 52, 62, 66, 68, 76, 86, 87, 100, 116], "outsid": [4, 11, 14, 15, 35, 49, 62, 66, 89, 114, 116], "physic": [4, 11, 14, 15, 26, 36, 48, 49, 85, 114, 116, 130, 133, 138], "real": [4, 8, 49, 60, 97, 100, 107, 118, 121, 134, 138, 141], "neg": [4, 45, 52, 60, 64, 66, 67, 87, 116, 147], "beam_center_i": [4, 11, 14, 15, 35, 49, 97], "x_pixel_s": [4, 9, 13, 14, 15, 24, 25, 29, 49, 97], "scalar": [4, 11, 39, 49, 68, 73, 75, 100, 116, 118, 128, 133, 147, 151], "y_pixel_s": [4, 9, 13, 14, 15, 24, 25, 29, 49, 97], "deprec": [4, 11, 37, 40, 41, 45, 46, 49, 52, 53, 56, 57, 60, 62, 63, 65, 66, 67, 68, 69, 82, 83, 84, 87, 92, 103, 104, 107, 109, 116, 146, 147], "issu": [4, 11, 53, 65, 69, 82, 103, 104, 112, 114, 116, 129, 130, 138, 143, 147, 150, 151, 154], "765": 4, "redund": 4, "uv": [4, 87], "laser": [4, 87], "optic": [4, 62, 87, 94], "ion": [4, 49, 84, 87], "plasma": [4, 87], "ultraviolet": [4, 87], "visibl": [4, 87], "light": [4, 63, 87, 94, 116], "positron": [4, 87], "proton": [4, 87, 103, 104], "beam_shap": 4, "incident_wavelength": [4, 11, 39], "wavelength_min": 4, "lowest": [4, 11, 49], "wavelength_max": 4, "highest": 4, "incident_wavelength_spread": [4, 11, 39], "fwhm": [4, 11, 39, 42, 92], "beam_size_x": 4, "beam_size_i": 4, "thick": [4, 11, 38, 45, 46, 49, 57, 58, 59, 61, 62, 66, 82, 93], "transmiss": [4, 11, 35, 38, 42, 46, 57, 82, 83], "i_0": 4, "dimensionless": [4, 89], "abil": 4, "spectrum": [4, 11, 19, 41, 63, 116, 147], "instead": [4, 37, 40, 41, 45, 46, 49, 52, 53, 56, 57, 62, 63, 66, 67, 68, 69, 82, 84, 87, 92, 114, 116, 118, 120, 123, 132, 147, 151], "elsewher": [4, 107, 121, 127, 147], "step": [4, 12, 14, 15, 16, 35, 79, 89, 114, 116, 125, 137, 147, 151], "Be": [4, 111, 120, 125, 132, 151], "yyyi": [4, 121], "mm": [4, 82, 121], "ddthh": [4, 121], "ss": [4, 121], "dd": 4, "hh": 4, "tr": [4, 114], "datetim": [4, 114, 120, 121], "wikipedia": [4, 114, 145, 147], "wiki": [4, 48, 114, 130, 132, 145, 147], "iso_8601": 4, "take": [4, 11, 49, 53, 88, 96, 97, 100, 115, 119, 121, 127, 143, 147], "subprocess": 4, "anyth": [4, 44, 53, 79, 116, 154], "cover": [4, 14, 15, 29, 36, 70, 94, 110, 147, 151], "transmission_spectrum": 4, "sastransmission_spectrum01": 4, "t_ax": 4, "tdev": 4, "gap": [4, 11, 46, 49, 63, 86], "spread": [4, 11, 14, 39, 92, 97], "max": [4, 78], "min": [4, 78], "nxtofraw": [5, 7, 36], "spectromet": [5, 7, 20, 36], "nxdisk_chopp": [5, 13, 64, 94, 103, 104], "nxfermi_chopp": [5, 17, 64, 94, 104], "definitli": 5, "rotation_spe": [5, 52, 56, 92], "chopper": [5, 13, 17, 21, 22, 23, 52, 53, 55, 56, 64, 88, 94, 103, 104, 133, 152], "fermi_chopp": [5, 17, 64, 104], "disk_chopp": [5, 64, 103, 104], "nx_frequenc": [5, 11, 45, 52, 56, 87, 92, 103, 104, 146], "speed": [5, 52, 56, 78, 92, 127, 137], "disk": [5, 52, 64, 103, 104, 114, 127, 132], "fermi": [5, 17, 56, 64, 94, 104], "fluoresc": [6, 36, 147, 154], "ne": [6, 19, 32, 143, 148, 151], "nvar": 8, "taken": [8, 25, 49, 65, 90, 95, 138, 143, 147, 148], "nqx": 8, "nqy": 8, "nxparamet": [8, 18, 26, 28, 53, 88, 94, 116, 151], "input": [8, 18, 49, 56, 92, 121, 122, 123, 137, 151], "filenam": [8, 18, 120, 121, 126, 143, 151], "output": [8, 11, 18, 49, 63, 72, 120, 121, 122, 123, 133, 154, 155], "eventu": [8, 18, 110], "client": [8, 48, 121, 148], "multidimension": [8, 48, 49, 114, 116, 133, 141], "varied_vari": 8, "p": [8, 48, 100, 107, 114, 134, 151], "mf": 8, "qx": [8, 18, 127], "qy": [8, 18], "laue": [9, 32, 33, 36, 46, 154], "nxpixel": [9, 14, 15, 29], "nypixel": [9, 14, 15, 29], "ntof": [9, 13, 15, 114], "flight": [9, 11, 13, 15, 21, 22, 23, 36, 49, 68, 103, 104, 114, 116, 133, 134, 146, 152], "planar": 9, "2d": [9, 11, 114, 151], "azimuthal_angl": [9, 14, 15, 21, 22, 23, 46, 49, 80, 103, 104, 114, 116], "azimuth": [9, 14, 15, 17, 21, 22, 23, 46, 49, 80, 103, 104], "nx_posint": [9, 29, 48, 49, 70, 79, 146], "time_of_flight": [9, 13, 15, 21, 22, 23, 49, 68, 103, 104, 114, 118, 125, 134], "nx_time_of_flight": [9, 13, 15, 21, 22, 23, 49, 55, 68, 103, 104, 146], "orientation_matrix": [9, 20, 29, 46, 57, 82, 83, 107], "orient": [9, 17, 20, 29, 37, 38, 40, 41, 42, 45, 46, 49, 52, 54, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 73, 76, 77, 78, 82, 83, 84, 85, 86, 87, 89, 92, 93, 95, 100, 103, 104, 107, 116, 127], "matrix": [9, 20, 29, 46, 57, 82, 83, 89, 100, 107, 116], "buse": [9, 29, 46, 57, 82, 83, 107], "levi": [9, 29, 46, 57, 82, 83, 107], "strictli": [9, 29], "ub": [9, 29, 82, 107], "bow": [9, 29], "usag": [9, 29, 46, 49, 57, 115, 116, 143, 144, 151, 154], "thie": 9, "nearli": [9, 29, 116, 133, 141], "unit_cel": [9, 20, 29, 46, 82, 114], "6": [9, 11, 20, 29, 46, 49, 73, 80, 82, 97, 103, 104, 109, 114, 116, 118, 120, 121, 126, 128, 134, 147, 148, 154], "cell": [9, 20, 29, 46, 57, 82, 83, 95], "b": [9, 29, 46, 47, 48, 57, 82, 83, 96, 107, 116, 121, 126, 147], "alpha": [9, 29, 31, 46, 57, 82, 83, 116], "beta": [9, 29, 46, 57, 82, 83], "gamma": [9, 29, 34, 46, 57, 82, 83], "again": [9, 29, 134, 138, 143, 151], "primari": [9, 11, 20, 49, 107, 114], "macromolecular": [11, 36], "crystallographi": [11, 36, 82, 83, 116], "mx": 11, "produc": [11, 19, 53, 75, 88, 111, 116, 118, 120, 128, 133, 137, 147], "modul": [11, 49, 51, 80, 94, 126, 138], "datarank": [11, 48], "np": [11, 12, 16, 18, 19, 20, 27, 28, 29, 30, 31, 34, 35, 49, 51, 68, 120, 151], "slowest": [11, 49, 51, 114], "third": [11, 18, 29, 47, 49, 114, 147], "known": [11, 48, 49, 74, 78, 107, 114, 115, 116, 120, 130, 134, 137, 138, 147], "groupindex": 11, "hierarch": [11, 50, 116, 128, 133, 154], "parent": [11, 47, 48, 50, 51, 72, 116, 147], "top": [11, 50, 52, 53, 87, 97, 114, 116, 118, 127, 128, 133, 138, 141, 143, 152], "nxattenu": [11, 35, 57, 64, 94, 103, 104], "nxdetector_group": [11, 64, 94], "nxdetector_modul": [11, 49, 50, 94, 116], "nxtransform": [11, 37, 38, 40, 41, 42, 45, 46, 49, 52, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 73, 76, 77, 78, 82, 84, 86, 87, 92, 93, 94, 95, 97, 100, 114, 116, 146], "recommend": [11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 114, 116, 124, 127, 130, 132, 137, 146, 152], "file_nam": [11, 70, 81, 118, 121, 126, 134], "file_tim": [11, 81, 118, 120, 121, 126, 134], "nxroot": [11, 94, 107, 116, 120], "utc": [11, 114], "suffix": [11, 114, 147], "avoid": [11, 48, 114, 116, 127, 143, 147], "confus": [11, 89, 114, 116], "local": [11, 45, 49, 53, 73, 85, 86, 88, 114, 115, 116, 118, 132, 137, 138, 143, 146, 147], "zone": [11, 59, 94, 114, 146], "beamlin": [11, 37, 39, 44, 45, 47, 64, 66, 72, 94, 97, 98, 99, 101, 102, 103, 104, 105, 108, 116, 133, 151], "time_zon": 11, "last": [11, 37, 38, 40, 41, 42, 45, 46, 48, 49, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 81, 82, 84, 86, 87, 92, 93, 107, 114, 147], "fill": [11, 87, 93, 118], "accur": 11, "observ": [11, 38, 80, 137], "abort": [11, 151], "otherwis": [11, 39, 49, 52, 53, 107, 114, 115, 143, 146, 147, 151], "prevent": [11, 127], "omit": [11, 46, 48, 51, 53, 57, 59, 82, 83, 89, 95, 114, 134, 147], "end_time_estim": 11, "avail": [11, 36, 48, 53, 114, 125, 131, 132, 133, 134, 136, 138, 143, 144, 145, 147, 152, 154], "frame": [11, 24, 25, 29, 49, 51, 75, 80, 89, 103, 104, 114], "depends_on": [11, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 100, 116], "anywher": [11, 116, 145, 151], "goniomet": [11, 89], "jet": [11, 87], "transform": [11, 26, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 97, 146], "reason": [11, 16, 43, 48, 49, 114, 127, 133, 137, 151, 152], "mainli": [11, 39], "accommod": [11, 133], "xfel": [11, 154], "shot": 11, "exposur": [11, 49, 89, 114, 120], "vocabulari": 11, "mmcif": [11, 75], "wwpdb": [11, 75], "mmcif_pdbx_v50": 11, "dic": [11, 75], "_diffrn_sourc": 11, "pdbx_synchrotron_beamlin": 11, "highli": [11, 46, 116], "short_nam": [11, 54, 64, 84, 87], "acronym": [11, 64, 87], "offset": [11, 26, 48, 49, 51, 55, 89, 92, 103, 104, 114, 116, 147], "attenu": [11, 35, 38, 64, 94, 95, 103, 104], "attenuator_transmiss": [11, 35, 38], "detector_group": [11, 64], "logic": [11, 50, 51, 82, 94, 116, 147], "own": [11, 49, 50, 62, 88, 114, 115, 127, 128, 133], "decompos": [11, 50], "endstat": [11, 50], "group_nam": [11, 50], "group_index": [11, 50], "hierarchi": [11, 16, 21, 22, 23, 29, 50, 53, 75, 88, 110, 114, 116, 122, 133, 138, 148, 151, 154], "group_par": [11, 50], "det": [11, 50, 80], "four": [11, 30, 36, 41, 50, 116, 133, 138, 151], "dtl": [11, 50], "dtr": [11, 50], "dll": [11, 50, 143], "dlr": [11, 50], "howev": [11, 48, 60, 65, 68, 75, 114, 116, 133, 136, 143, 145, 146, 154], "position": [11, 64, 78, 82, 94, 103, 104, 107, 151, 152], "chain": [11, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 75, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 114, 116, 121], "manufactur": [11, 42, 49, 59, 120, 130], "model": [11, 48, 49, 54, 84, 95, 114, 116, 120, 121, 134], "dectector": 11, "preced": [11, 115, 147], "calcul": [11, 12, 14, 68, 82, 95, 114, 116, 120], "distance_deriv": 11, "nx_boolean": [11, 17, 46, 48, 49, 67, 80, 84, 87, 93, 146], "rather": [11, 48, 49, 60, 75, 97, 110, 114, 116, 120, 121, 123, 128, 132, 145, 147, 148], "delector": 11, "dead_tim": [11, 49], "dead": [11, 49, 52, 152], "count_tim": [11, 49, 68, 107], "elaps": [11, 49, 65, 68, 82, 107], "beam_center_deriv": 11, "quantiti": [11, 26, 84], "angular_calibration_appli": [11, 49], "angular_calibr": [11, 49], "flatfield_appli": [11, 49], "flat": [11, 24, 45, 46, 49, 66], "flatfield": [11, 49], "compress": [11, 118, 120, 128, 138], "flatfield_error": [11, 49], "plural": 11, "error": [11, 17, 48, 49, 65, 69, 80, 103, 104, 110, 116, 119, 120, 121, 134, 143, 145, 147], "pixel_mask_appli": [11, 49], "pixel_mask": [11, 49, 114], "32": [11, 48, 49, 114, 125, 141, 143, 151], "blind": [11, 49], "unwant": [11, 49], "undesir": [11, 49], "respond": [11, 49], "noisi": [11, 49], "undefin": [11, 49, 114, 146, 147], "cluster": [11, 46, 49, 57, 82, 83, 95], "problemat": [11, 49], "7": [11, 49, 80, 114, 116, 118, 120, 121, 128, 134, 148, 154], "around": [11, 49, 52, 80, 89, 116, 133, 151], "beamstop": [11, 40, 49], "30": [11, 49, 114, 120, 121, 128, 152], "31": [11, 49, 114, 121, 122, 123, 128], "virtual": [11, 49, 88, 97, 116], "corner": [11, 49], "interpol": [11, 49], "0x0000ffff": [11, 49], "upper": [11, 49, 80, 84, 114, 121, 147], "byte": [11, 49, 116, 133, 134, 137, 138, 141, 143, 147], "sole": [11, 49], "reject": [11, 49], "unless": [11, 46, 49, 57, 82, 83, 95, 107], "lower": [11, 49, 80, 84, 114, 125, 127, 147], "depth": [11, 49, 61, 67], "fewer": [11, 49], "permiss": [11, 49, 53, 110], "pixel_mask_n": [11, 49], "n": [11, 46, 48, 49, 52, 68, 78, 80, 84, 116, 119, 126, 128, 134], "bad": [11, 49, 132], "shadow": [11, 49], "pixel_mask_2": [11, 49], "cumul": [11, 49], "bitwis": [11, 49], "OR": [11, 49], "countrate_correction_appli": [11, 49], "rate": [11, 49, 84], "bit_depth_readout": [11, 49], "detector_readout_tim": [11, 49], "millisecond": [11, 49], "import": [11, 14, 40, 42, 49, 51, 89, 95, 97, 111, 114, 116, 118, 120, 121, 122, 123, 137, 138, 143, 145, 148, 152], "frame_tim": [11, 49], "exposure_tim": [11, 49], "gain_set": [11, 49], "saturation_valu": [11, 49], "goe": [11, 49, 103, 104, 120], "satur": [11, 49], "invalid": [11, 24, 49, 114, 151], "underload_valu": [11, 49], "equal": [11, 49, 89, 114, 147, 148], "greater": [11, 49, 52, 62, 80, 116, 133, 146, 147], "sensor_materi": [11, 49], "sens": [11, 49, 52, 116, 152], "scintil": [11, 49, 68], "materi": [11, 37, 45, 46, 49, 56, 57, 59, 61, 62, 66, 67, 77, 87, 93, 95, 103, 104], "sensor_thick": [11, 49], "threshold_energi": [11, 49], "counter": [11, 49, 107, 120], "adjust": [11, 49], "optim": [11, 49], "threshold": [11, 49], "ccd": [11, 49], "plate": [11, 33, 49, 59, 84, 94], "cmo": [11, 49], "non": [11, 38, 47, 65, 72, 76, 86, 121, 128, 147, 154, 155], "perform": [11, 14, 15, 42, 116, 120, 125, 137, 138, 143, 151, 154], "detector_modul": [11, 49], "oper": [11, 87, 96, 114, 116, 134, 136, 138, 147, 154], "sync": 11, "pars": [11, 48, 114, 121, 127], "definiton": 11, "hyperslab": [11, 51], "span": [11, 154], "entir": [11, 49, 116, 144, 147, 155], "data_origin": [11, 51], "slow": [11, 51, 114], "fast": [11, 49, 51, 114, 127], "data_s": [11, 51], "data_strid": 11, "stride": [11, 114], "module_offset": [11, 51], "regard": [11, 51, 116, 152], "transformation_typ": [11, 51, 89, 116, 146], "translat": [11, 24, 25, 29, 51, 60, 82, 89, 94, 97, 103, 104, 116, 133, 146, 154], "fast_pixel_direct": [11, 51], "fastest": [11, 49, 51, 52, 114], "itself": [11, 21, 22, 23, 51, 53, 84, 88, 116, 134, 137, 145], "slow_pixel_direct": [11, 51], "monchromat": 11, "permit": [11, 46, 114, 116, 127, 146, 147], "presenc": [11, 147], "absenc": 11, "incident_wavelength_x": 11, "polychromat": 11, "rel": [11, 52, 55, 65, 73, 76, 82, 83, 86, 89, 90, 95, 98, 99, 101, 102, 105, 108, 116, 120, 121, 147], "weight": [11, 114, 146], "incident_wavelength_weight": 11, "variant": [11, 137], "837": 11, "flux": [11, 19, 39, 87, 146], "nx_flux": [11, 39, 87, 146], "total_flux": 11, "incident_beam_s": 11, "airi": 11, "diamet": [11, 33, 49, 59, 76, 85, 93], "hat": 11, "incident_polarisation_stok": 11, "incident_wavelength_spectrum": 11, "storag": [11, 19, 87, 94, 112, 116, 123, 124, 127, 128, 130, 137, 147, 151], "ring": [11, 19, 87, 94, 147], "pdbx_synchrotron_sit": 11, "polaris": 11, "stoke": 11, "countrat": [11, 49], "underload": [11, 49], "reflectomet": [12, 13, 36], "doe": [12, 29, 49, 82, 89, 114, 116, 127, 128, 133, 136, 138, 152, 155], "xsize": [13, 23, 24, 25, 114, 151], "ysize": [13, 23, 24, 25, 114, 151], "meant": [14, 116, 121, 143], "sax": [14, 40, 88, 94, 127, 151], "wsa": 14, "graze": 14, "gisa": 14, "nxgeometri": [14, 15, 37, 40, 41, 45, 46, 49, 52, 54, 56, 57, 62, 63, 66, 67, 68, 69, 73, 82, 84, 85, 87, 90, 92, 94, 103, 104], "nxshape": [14, 15, 46, 60, 61, 66, 94, 95, 103, 104, 116], "wavelength_spread": [14, 92], "delta_lambda": 14, "delta": 14, "nxcylind": [14, 15, 85], "nxbox": [14, 15, 85], "aequatorial_angl": [14, 15], "aequatori": [14, 15], "stringent": 16, "show": [16, 46, 57, 95, 111, 114, 115, 116, 118, 120, 121, 122, 123, 125, 126, 128, 133, 143, 148, 151, 152, 154, 155], "rule": [16, 20, 72, 107, 115, 133, 134, 145, 147, 152], "throughout": [16, 48], "respect": [16, 39, 48, 49, 55, 57, 95, 114, 116, 148], "256x256": 16, "256": 16, "equival": [16, 49, 80, 115, 116, 141, 143, 148], "familiar": [16, 116, 121], "classic": 16, "tabular": [16, 151], "hdf": [16, 60, 81, 114, 115, 116, 119, 125, 126, 127, 130, 131, 132, 134, 137, 143, 151], "unlimit": [16, 151], "append": [16, 48, 89, 107, 114, 116, 151], "built": [16, 114, 118, 131, 133, 140, 141, 154], "static": [16, 119], "new": [16, 29, 48, 49, 53, 88, 107, 109, 112, 114, 115, 116, 118, 119, 121, 123, 125, 127, 130, 132, 133, 134, 135, 137, 143, 147, 154], "xdim": [16, 65], "ydim": [16, 65], "inelast": [17, 36, 154], "program_nam": [17, 53, 88, 115, 151], "nxspe_info": 17, "fixed_energi": 17, "ki_over_kf_sc": 17, "whether": [17, 38, 46, 57, 67, 82, 83, 95, 138, 154], "ki": 17, "kf": 17, "dc": 17, "mslice": 17, "azimuthal_width": 17, "polar_width": 17, "seblock": [17, 54], "info": 17, "om": [18, 36], "grid": [18, 147, 151], "visualis": [18, 133, 154], "regrid": 18, "qe": 18, "nx_wavenumb": [18, 46, 146], "qz": 18, "transfer": [18, 39, 48, 133, 143], "stxm": [19, 36], "interferomet": 19, "chronolog": 19, "3d": [19, 26, 36, 114, 116], "nume": 19, "numi": [19, 103, 104], "numx": [19, 103, 104], "stack": [19, 48, 66, 114], "former": [19, 138], "loss": 19, "precis": [19, 114, 116, 133], "latter": [19, 138], "simplifi": [19, 120, 122, 130, 134, 137, 138, 143, 145, 147, 151], "constraint": 19, "line": [19, 36, 44, 61, 70, 93, 94, 107, 114, 116, 120, 121, 122, 128, 133, 134, 138, 141, 146, 147, 148, 154], "spectra": 19, "sample_imag": 19, "compar": [19, 118, 119, 120, 121, 122, 123, 134, 141, 143], "ny": [19, 26, 48], "detectorrank": 19, "sample_x": 19, "sample_i": 19, "sample_z": 19, "stxm_scan_typ": 19, "label": [19, 48, 60, 114, 116, 121, 127, 133, 134, 147, 154], "human": [19, 114, 127], "photon_energi": 19, "focu": [19, 42, 59, 93, 94, 154], "zoneplate_z": 19, "osa": 19, "osa_i": 19, "osa_x": 19, "detector_i": 19, "detector_x": 19, "summaris": 19, "spatial": [19, 61, 80, 90, 94, 147], "parallel": [19, 46, 62, 76, 137], "therefor": [19, 49, 89, 95, 114, 138, 151], "proxi": 19, "tripl": [20, 36], "trademark": 20, "ta": [20, 87, 115], "align": [20, 24, 49, 52, 90, 121], "nxscan": [20, 36], "ei": [20, 147], "ef": [20, 147], "qh": 20, "qk": 20, "ql": 20, "sgu": [20, 151], "sgl": 20, "denot": [20, 114, 148], "ntimechan": [21, 22, 23], "pre_sample_flightpath": [21, 22, 23, 53, 88], "moder": [21, 22, 23, 53, 64, 67, 88, 94, 103, 104, 136], "t0": [21, 22, 23, 52, 53, 88, 134], "detector_numb": [21, 22, 47, 49, 55], "pre": [21, 22, 23, 53, 88, 114, 116], "flightpath": [21, 22, 23, 53, 88], "run_numb": [22, 103, 104, 134], "natur": [22, 23, 49, 95, 103, 104, 147], "liquid": [22, 23, 67], "integral_count": 22, "tomographi": [24, 25, 26, 36, 49, 145], "dark": [24, 25, 125], "bright": [24, 25], "distinguish": [24, 65, 116, 127, 147], "carri": [24, 75], "image_kei": 24, "nframe": 24, "project": [24, 100, 114, 132, 137, 143, 154, 155], "magic": 24, "x_rotation_axis_pixel_posit": 24, "y_rotation_axis_pixel_posit": 24, "horizont": [24, 41, 46, 87, 116, 121], "somehow": 24, "best": [24, 29, 48, 49, 62, 78, 110, 114, 116, 130, 137, 143], "x_translat": [24, 25, 29, 82, 116], "y_translat": [24, 25, 29], "z_translat": [24, 25], "fluctuat": [24, 25], "phase": [25, 36, 52, 63, 151], "contrast": [25, 36, 116], "properli": [25, 49, 111, 116, 121, 125, 143, 155], "sequenc": [25, 49, 70, 75, 79, 89, 114, 116, 148, 151], "nbrightfram": [25, 49], "ndarkfram": 25, "nsamplefram": 25, "nphase": 25, "bright_field": 25, "sequence_numb": [25, 49], "dark_field": 25, "construct": [26, 36, 49, 89, 94, 96, 106, 109, 110, 114, 116, 131, 145, 151, 153, 154, 155], "voxel": 26, "nz": [26, 48], "reconstruct": [26, 28, 79, 94], "raw_fil": [26, 28], "realli": [26, 48, 68, 127, 132], "absorpt": [27, 28, 36, 38, 95, 151], "absorb": [27, 28, 36, 37, 45, 56, 95], "incoming_beam": 27, "absorbed_beam": 27, "xa": [28, 36], "xas_data_reduct": 28, "detector1": 29, "detector2": [29, 151], "detectorn": 29, "maxoccur": [29, 115], "frame_start_numb": [29, 49], "px": [29, 49, 80], "coupl": [29, 49, 67, 103, 104, 143, 154], "return": [29, 49, 118, 134, 138, 143, 147], "concaten": [29, 49], "whatev": [29, 69, 114, 116, 152], "data1": [29, 118], "data2": 29, "data3": 29, "nxxbase": [30, 31, 34, 35, 36], "circl": [30, 36, 116, 151], "eulerian": [30, 36, 116], "cradl": [30, 36, 116], "log": [30, 34, 45, 46, 54, 57, 65, 67, 68, 70, 82, 84, 103, 104, 116, 133, 146], "reciproc": [30, 34, 100, 151], "space": [30, 34, 45, 46, 49, 52, 57, 61, 76, 82, 83, 86, 95, 100, 111, 114, 116, 127, 147, 151, 154], "chi": [30, 116, 151], "phi": [30, 31, 80, 116, 118, 151], "kappa": [31, 36], "cad4": [31, 36], "inclin": [31, 152], "arm": [31, 133], "nxxrot": [32, 36], "nxxlaue": [33, 36], "cylindr": [33, 46, 47, 49, 93, 94], "tilt_angl": 34, "tilt": [34, 116], "rotation_angle_step": 35, "made": [35, 85, 95, 106, 107, 114, 123, 127, 130, 137, 143, 147, 154], "reserv": [36, 53, 114, 116], "spell": [36, 81, 87, 107, 110, 114, 116, 137, 147], "contract": [36, 116], "liber": [36, 48, 110, 114], "involv": [36, 110, 112, 122, 133, 136, 151, 152], "tree": [36, 88, 97, 110, 116, 120, 121, 122, 123, 125, 127, 130, 132, 133, 134, 139, 140, 141, 142, 147, 151, 154, 155], "nxarp": [36, 127], "nxcansa": [36, 110, 127, 154], "nxdirecttof": 36, "nxfluo": [36, 110, 151], "nxindirecttof": 36, "nxiqproc": [36, 127], "nxlauetof": 36, "nxmx": [36, 80, 154], "nxrefscan": 36, "nxreftof": 36, "nxsa": [36, 110, 127, 130, 151], "nxsastof": 36, "nxspe": 36, "nxsqom": 36, "nxstxm": [36, 154], "nxta": 36, "nxtofnpd": 36, "nxtofsingl": 36, "nxtomo": 36, "nxtomophas": 36, "nxtomoproc": 36, "nxxa": 36, "nxxasproc": 36, "nxxeuler": 36, "nxxkappa": 36, "nxxlaueplat": 36, "nxxnb": 36, "lead": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114, 115, 130, 147, 151], "niac2014": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114], "2014_how_to_find_default_data": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114, 130], "surfac": [37, 38, 40, 45, 46, 52, 61, 62, 66, 67, 68, 72, 84, 86, 96, 100, 109, 116, 147], "complex": [37, 38, 49, 62, 76, 84, 86, 95, 116, 121, 122, 130, 133], "asymmet": [37, 38], "nxoff_geometri": [37, 38, 47, 49, 94, 96, 106, 115], "unambigu": [37, 38, 49, 144], "blade_geometri": 37, "base_class": [37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 110, 145], "devic": [38, 40, 52, 63, 64, 69, 78, 89, 93, 94, 116], "uncertain": [38, 57], "nxfilter": [38, 64, 94], "band": [38, 57, 94], "filter": [38, 57, 64, 94], "composit": [38, 57, 77, 82, 95, 133], "polythen": 38, "scattering_cross_sect": 38, "nx_cross_sect": [38, 146], "coher": 38, "incoher": 38, "absorption_cross_sect": 38, "nomin": [38, 46, 49, 57, 67, 68, 77, 84, 116], "transmit": [38, 45, 52, 56, 76], "move": [38, 78, 89, 95, 114, 116, 123, 137, 146, 147, 154], "stamp": [38, 65, 114, 116, 121, 133, 146, 147, 151], "particulari": 38, "referenc": [39, 43, 121, 133], "valuabl": [39, 133], "incident_energi": 39, "enter": [39, 80, 88, 112, 120], "final_energi": 39, "leav": [39, 120], "energy_transf": 39, "caus": [39, 89, 114], "incident_beam_diverg": [39, 97], "extent": [39, 85, 97], "final_wavelength": 39, "incident_polar": 39, "final_polar": 39, "final_wavelength_spread": 39, "final_beam_diverg": 39, "plottabl": [39, 48, 53, 88, 94, 107, 116, 118, 119, 122, 127, 130, 133, 134, 137, 147, 151], "block": [40, 52, 75, 94, 107, 120, 121], "protect": [40, 94], "circular": [40, 47, 76], "distance_to_detector": 40, "bend": [41, 62, 64, 66, 94], "critical_energi": 41, "bending_radiu": 41, "strength": 41, "dipol": 41, "accepted_photon_beam_diverg": 41, "half": [41, 46, 85], "source_distance_x": 41, "particl": [41, 87], "waist": 41, "source_distance_i": 41, "divergence_x_plu": 41, "outboard": 41, "divergence_x_minu": 41, "inboard": 41, "divergence_y_plu": 41, "upward": [41, 116], "divergence_y_minu": 41, "downward": 41, "nxbend": 41, "radiu": [41, 52, 56, 85, 92, 93], "critic": [41, 62, 66], "minu": [41, 76], "capillari": [42, 64, 94, 95], "gerd": [42, 93], "wellenreuth": [42, 93], "desi": [42, 93], "single_bounc": 42, "polycapillari": 42, "conical_capillari": 42, "impact": [42, 80], "maximum_incident_angl": 42, "accepting_apertur": 42, "working_dist": 42, "focal_s": 42, "focal": [42, 59], "maximum": [42, 46, 48, 49, 65, 78, 103, 104, 141, 143, 147], "literatur": [43, 94, 137], "idea": [43, 112, 132, 133, 137], "url": [43, 53, 88, 114, 115, 116, 121, 145, 147], "doi": [43, 133], "endnot": 43, "bibliograph": 43, "bibtex": 43, "unvalid": [44, 94, 116], "gather": [44, 116, 130], "nxlog": [45, 46, 57, 67, 68, 82, 84, 94, 98, 99, 101, 102, 103, 104, 105, 108, 116, 151, 152], "radial": 45, "oscil": 45, "honeycomb": 45, "soller_angl": 45, "divergence_x": 45, "divergence_i": 45, "frequenc": [45, 49, 87, 103, 104, 133, 146], "blade_thick": 45, "blade_spac": 45, "absorbing_materi": [45, 56], "transmitting_materi": [45, 56], "orthogon": [45, 52, 62, 66, 68, 86], "face": [45, 47, 52, 61, 66, 68, 72, 116, 137], "frequency_log": 45, "doubl": [46, 59, 125, 133], "bent": 46, "compris": [46, 53, 64, 116, 122, 133, 138], "segment": 46, "anisotrop": 46, "mosaic": 46, "curvatur": [46, 56, 93], "absent": [46, 73, 90], "li": [46, 47, 62], "n_comp": [46, 57, 82, 95], "bragg": [46, 80], "abbrevi": [46, 57, 82, 83, 95, 116], "parenthesi": [46, 57, 82, 83, 95], "enclos": [46, 57, 82, 83, 89, 95, 116, 147], "parenthes": [46, 57, 82, 83, 95, 115], "close": [46, 57, 72, 81, 82, 83, 95, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 136, 138, 143], "That": [46, 57, 82, 83, 95, 114, 120, 121, 127, 133, 134], "print": [46, 57, 82, 83, 95, 121, 122, 126, 134, 147, 154, 155], "subscript": [46, 57, 82, 83, 95, 136, 147], "manner": [46, 57, 82, 83, 95], "moieti": [46, 57, 82, 83, 95], "carbon": [46, 57, 82, 83, 95], "h": [46, 57, 80, 82, 83, 95, 107, 114, 118, 119, 125, 134, 143, 151, 154], "alphabet": [46, 57, 82, 83, 95, 114, 123, 147], "pure": [46, 57, 82, 83, 95, 143], "hill": [46, 57, 82, 83, 95], "abstract": [46, 57, 82, 83, 95, 116, 130], "iucr": [46, 116], "__data": 46, "cifstd15": 46, "ca": [46, 154], "train": 46, "stneasytip": 46, "subinforformula1": 46, "substanc": 46, "hkl": [46, 77, 107, 114, 146], "lattic": [46, 57, 82, 107], "2010": [46, 57, 121, 126, 130, 154], "11": [46, 57, 80, 114, 118, 120, 121, 134, 147, 148, 154], "17": [46, 57, 80, 114, 118, 121, 122, 123, 126, 128, 134, 154], "wider": [46, 57, 95], "varieti": [46, 57, 116, 133, 137, 147, 151], "pg": 46, "pyrolyt": [46, 57], "graphit": [46, 57], "ge": 46, "si": [46, 97, 114], "cu": 46, "fe3si": 46, "cofe": 46, "cu2mnal": 46, "heusler": 46, "multilay": 46, "diamond": [46, 95, 116, 154], "order_no": 46, "th": [46, 107, 119], "cut_angl": 46, "cut": [46, 107], "space_group": [46, 82, 83], "unit_cell_a": [46, 57], "unit_cell_b": [46, 57], "unit_cell_c": [46, 57], "unit_cell_alpha": [46, 57], "unit_cell_beta": [46, 57], "unit_cell_gamma": [46, 57], "unit_cell_volum": [46, 57, 82, 83, 114], "nx_volum": [46, 57, 82, 83, 146], "w": [46, 57, 82, 87, 89, 115, 120, 121, 122, 123, 133, 146], "1967": [46, 57, 82, 83], "acta": [46, 57, 82, 83], "22": [46, 57, 80, 82, 114, 118, 120, 121, 154], "457": [46, 57, 82], "464": [46, 57, 82], "scattering_vector": 46, "miller": [46, 80], "nx_mass_dens": [46, 57, 61, 66, 82, 83, 95, 146], "mass": [46, 57, 82, 83, 85, 95, 133, 146], "segment_width": 46, "individu": [46, 56, 62, 116, 130, 133, 137, 147, 151, 154], "segment_height": 46, "height": [46, 52, 55, 56, 59, 85, 92, 116], "segment_thick": 46, "segment_gap": 46, "adjac": [46, 80], "segment_column": 46, "column": [46, 72, 75, 107, 114, 115, 121, 126, 133], "segment_row": 46, "row": [46, 89, 114, 133], "mosaic_horizont": 46, "mosaic_vert": 46, "curvature_horizont": 46, "focus": 46, "curvature_vert": 46, "is_cylindr": 46, "cylindrical_orientation_angl": 46, "cylind": [46, 47, 49, 85, 93, 100, 115, 116], "assembli": [46, 49], "bragg_angl": 46, "averag": [46, 57, 65, 67, 84, 89, 103, 104, 114], "temperature_coeffici": 46, "temperature_log": [46, 57, 67, 82], "arrang": [46, 145], "coeffici": [46, 59, 61, 85, 107], "helium": [47, 61, 62, 66, 116], "uniform": [47, 72, 114, 115], "z_pixel_offset": [47, 49, 72, 116], "vertex": [47, 116, 147], "nxcylindr": 47, "mandatori": [48, 53], "motiv": [48, 114, 116, 127, 133], "hard": [48, 116, 123, 126, 127, 128], "nx_maxrank": [48, 141], "mr": [48, 114, 121, 126], "mr_indic": [48, 114, 121], "float": [48, 114, 116, 118, 119, 120, 121, 122, 123, 133, 146, 148], "100": [48, 54, 114, 126, 152], "data_2d": [48, 114], "time_indic": [48, 114], "1000": [48, 114, 118, 119, 133], "20": [48, 80, 82, 114, 116, 118, 121, 134, 143, 152, 154], "old": [48, 116, 126, 143, 154], "older": [48, 114, 126], "oldest": 48, "whose": [48, 95, 114], "long_nam": [48, 49, 116, 121, 126, 133, 134, 148], "fallback": [48, 107], "displai": [48, 54, 84, 116, 120, 121, 125, 147, 148], "annot": [48, 116, 137], "niac2018minut": [48, 137], "plottyp": [48, 137], "auxiliary_sign": [48, 114, 146], "auxiliari": [48, 116], "slice": [48, 114], "axisname_indic": [48, 107, 114], "axisnam": [48, 89, 107, 114], "2014_axes_and_uncertainti": [48, 114], "illustr": [48, 114, 116, 124, 133, 151], "effort": [48, 114, 127, 130, 133, 134], "strict": [48, 114, 116], "writer": [48, 114, 116, 120], "potenti": [48, 114, 144], "_indic": [48, 114], "circumst": [48, 114], "tool": [48, 116, 118, 121, 122, 123, 124, 125, 127, 131, 133, 134, 138, 145, 147, 155], "first_good": 48, "last_good": 48, "variable_error": [48, 115, 116], "_error": [48, 114], "variable_resolut": 48, "connect": [48, 114, 121], "colon": [48, 114, 133], "delimit": [48, 114, 133, 147], "bank": [49, 50, 94, 114, 151], "multidetector": [49, 94], "faster": [49, 55, 65, 127], "histogram": [49, 104, 109, 125, 138], "nxcylindrical_geometri": [49, 94, 115], "raw_time_of_flight": 49, "nx_puls": [49, 146], "hz": [49, 146], "check_sum": 49, "data_error": [49, 114], "x_pixel_offset": [49, 103, 104, 116], "y_pixel_offset": [49, 103, 104, 116], "irregular": [49, 87, 114], "serial_numb": 49, "serial": 49, "local_nam": 49, "solid_angl": 49, "nx_solid_angl": [49, 146], "subtend": 49, "gas_pressur": [49, 93], "ga": [49, 93], "detection_gas_path": 49, "drift": 49, "crate": 49, "slot": 49, "he3": 49, "psd": 49, "fission": [49, 68], "chamber": [49, 68], "proport": [49, 68], "real_tim": 49, "stop_tim": 49, "calibration_d": 49, "layout": [49, 97, 114], "linear": [49, 58, 89, 114], "gate": 49, "trigger": 49, "sum": [49, 80], "event": [49, 53, 55, 64, 79, 87, 94, 103, 109, 152], "decim": 49, "12": [49, 80, 114, 116, 118, 120, 121, 128, 130, 131, 134, 148, 154], "14": [49, 80, 114, 118, 120, 121, 134, 148, 154], "16": [49, 53, 80, 114, 116, 118, 120, 121, 134, 154], "trigger_delay_tim": 49, "reaction": 49, "firmwar": 49, "delai": [49, 52], "trigger_delay_time_set": 49, "trigger_internal_delay_tim": 49, "hardwar": [49, 65, 78, 84, 114], "boundari": [49, 72, 114, 138], "request": [49, 112, 123, 127, 129, 133, 137, 138], "trigger_dead_tim": 49, "dure": [49, 65, 87, 89, 95, 114, 116, 121, 147, 151], "readout_tim": 49, "auto": [49, 120], "number_of_cycl": 49, "sometim": [49, 51, 114, 116, 148], "spectral": [49, 154], "wavelength_indic": [49, 62], "calibration_method": 49, "convers": [49, 114, 116, 125, 143, 145], "polynomi": [49, 59, 61], "data_fil": 49, "interest": [49, 107, 120, 123, 133, 144, 147, 152], "subdivis": 49, "detect": [49, 55, 72], "children": [50, 88, 147], "ref": [50, 68, 84, 145], "group_typ": 50, "offset_unit": [51, 89], "tempor": [52, 87, 94], "pair": [52, 55, 63, 65, 72, 73, 90, 107, 129, 148], "commonli": [52, 116, 127, 133, 137], "stationari": 52, "hous": 52, "featur": [52, 53, 115, 126, 128, 130, 135, 137, 151, 152], "anticlockwis": 52, "awai": [52, 130], "exactli": [52, 87], "contra_rotating_pair": 52, "synchro_pair": 52, "slit_angl": 52, "pair_separ": 52, "slit_edg": 52, "2n": 52, "360": 52, "degre": [52, 85, 118, 119, 121, 122, 123, 126, 128, 133, 134, 138], "top_dead_cent": 52, "unix": [52, 65, 107, 116, 134, 147], "1970": [52, 65], "01": [52, 65, 130], "01t00": [52, 65], "00": [52, 65, 134], "0z": [52, 65], "beam_posit": 52, "slit_height": 52, "drive": [52, 137], "effect": [52, 55, 67, 87, 114, 116], "wavelength_rang": 52, "spin": [52, 58, 77, 94, 108, 109], "axl": 52, "almost": [52, 55, 151], "though": [52, 116, 127, 137], "nxdisk": 52, "nxsubentri": [53, 94, 110, 127], "v3": [53, 88, 130, 132], "idf_vers": [53, 88], "isi": [53, 88, 114, 130, 137, 154], "propos": [53, 88, 91, 97, 110, 112, 127, 130, 137, 144], "entry_identifier_uuid": 53, "uuid": 53, "futur": [53, 114, 127, 130, 143, 154], "niac": [53, 60, 109, 112, 113, 114, 116, 124, 127, 130, 133, 147, 152, 154], "382": 53, "overlai": [53, 88], "definition_loc": [53, 88], "transpir": [53, 88], "suspend": [53, 88], "due": [53, 68, 88, 97, 120, 147], "2007": [53, 88, 130], "configur": [53, 88, 115, 127, 142, 154], "re": [53, 88], "niac2016": 53, "decid": [53, 60, 122, 130, 138, 143, 154], "extens": [53, 127, 137, 144, 147, 154], "overrid": [53, 115], "minoccur": [53, 115, 127], "experiment_document": [53, 88], "pdf": [53, 88, 95, 116, 130, 131, 138, 147], "latex": [53, 88], "thumbnail": [53, 88, 115], "640x480": [53, 88], "jpeg": [53, 70, 88], "mime": [53, 70, 88, 114, 116], "idf": [53, 88], "nxsensor": [54, 57, 94], "apparatu": 54, "oc100": 54, "011": 54, "dashboard": 54, "schedul": 54, "oc": 54, "100mm": 54, "bore": 54, "orang": 54, "cryostat": [54, 114], "pump": 54, "labview": 54, "vi": 54, "digit": [54, 114], "photograph": 54, "emit": 55, "stream": [55, 65, 114, 116, 133, 143, 152], "detectorid": 55, "event_id": 55, "event_time_offset": 55, "stroboscop": 55, "setup": [55, 82], "random": [55, 65, 119], "access": [55, 65, 115, 116, 125, 132, 133, 134, 137, 142, 151, 152, 154], "cue_timestamp_zero": [55, 65], "cue_index": [55, 65], "courser": 55, "minut": [55, 65, 112], "extra": [55, 107, 116, 133, 147], "event_time_zero": 55, "iso8601": [55, 65, 107, 114, 146], "event_index": [55, 103], "pulse_height": 55, "voltag": [55, 65, 84, 87, 98, 99, 101, 102, 105, 108, 146], "attach": [55, 84, 114, 116], "events_per_puls": 55, "cue_timestamp": 55, "nxevent": 55, "cue": [55, 65, 152], "r_slit": 56, "nxfermi": 56, "beryllium": 57, "sapphir": 57, "silicon": 57, "supermirror": [57, 62, 66, 77, 94], "m_valu": [57, 62, 66], "substrate_materi": [57, 61, 62, 66], "substrat": [57, 61, 62, 66], "substrate_thick": [57, 61, 62, 66], "coating_materi": [57, 61, 62, 66], "coat": [57, 61, 62, 66], "substrate_rough": [57, 61, 62, 66], "rough": [57, 61, 62, 66, 114], "rm": 57, "coating_rough": [57, 61, 62, 66], "nsurf": [57, 62, 147], "sensor_typ": 57, "flipper": [58, 64, 94], "coil": 58, "sheet": 58, "flip_turn": 58, "flip": 58, "comp_turn": 58, "compens": 58, "guide_turn": 58, "flip_curr": 58, "comp_curr": 58, "guide_curr": 58, "travel": 58, "comp": 58, "fresnel": [59, 94], "focus_paramet": 59, "increas": [59, 61, 88, 89, 137, 143], "power": [59, 61, 63, 87, 146, 154], "micron": 59, "volt": 59, "outer_diamet": 59, "outermost_zone_width": 59, "central_stop_diamet": 59, "fabric": 59, "etch": 59, "zone_height": 59, "zone_materi": 59, "themselv": [59, 121], "zone_support_materi": 59, "central_stop_materi": 59, "central_stop_thick": 59, "mask_thick": 59, "mask_materi": 59, "support_membrane_materi": 59, "support_membrane_thick": 59, "nxfresnel": 59, "central": [59, 80], "outer": 59, "outermost": 59, "membran": 59, "2014": [60, 130, 147], "legaci": [60, 73, 85, 90, 94, 124, 128, 137, 147], "aid": 60, "mcsta": [60, 89], "share": [60, 114, 127, 147], "nxorient": [60, 84, 85, 90, 94, 103, 104, 116], "nxtranslat": [60, 73, 85, 94, 103, 104, 116, 154], "component_index": 60, "grate": [61, 69, 94], "soft": [61, 78, 94, 121, 127, 130, 137], "blaze": 61, "trapezoid": 61, "groov": 61, "duty_cycl": 61, "diffraction_ord": 61, "deflection_angl": 61, "utilis": 61, "outgo": 61, "interior_atmospher": [61, 62, 66], "argon": [61, 62, 66], "substrate_dens": [61, 66], "layer_thick": [61, 66], "layer": [61, 66], "mirror": [61, 62, 64, 66, 94, 121], "figure_data": [61, 66], "deflect": 61, "duti": 61, "interior": [61, 62, 66], "build": [62, 111, 114, 116, 122, 123, 128, 131, 132, 133, 143, 145, 151], "simplest": [62, 118, 125], "box": [62, 80, 120], "although": [62, 95, 107, 116, 121], "ellipt": [62, 93], "popular": [62, 88, 127, 143], "characterist": 62, "wall": [62, 95], "bender": 62, "vane": 62, "nxpolar": [62, 64, 94, 103, 104], "nxmirror": [62, 64, 94], "constitut": [62, 127, 144], "redefin": 62, "welcom": [62, 112, 124, 127, 138, 152, 154], "nwl": [62, 147], "incident_angl": [62, 66], "bend_angle_x": [62, 66], "bend_angle_i": [62, 66], "external_materi": [62, 66], "regim": [62, 66], "nickel": [62, 66], "number_sect": 62, "explain": [62, 114, 115, 133], "intend": [62, 88, 89, 114, 115, 118, 134, 144, 147, 148, 152, 154], "surface_indic": 62, "veri": [62, 95, 111, 114, 116, 121, 127, 131, 133, 134, 138, 146, 154], "loos": 62, "undul": [63, 69, 152], "wiggler": 63, "oppos": 63, "pole": [63, 85], "taper": 63, "magnetic_wavelength": 63, "displac": [63, 89], "nx_power": [63, 87, 146], "deliv": 63, "bandwidth": 63, "harmon": 63, "nxinsert": 63, "nxbeam_stop": [64, 94], "nxbending_magnet": [64, 94], "nxcapillari": [64, 94], "nxevent_data": [64, 94, 103, 151, 152], "nxflipper": [64, 94], "nxguid": [64, 94], "nxinsertion_devic": [64, 94], "nxmoder": [64, 94, 103, 104], "nxposition": [64, 82, 94, 103, 104, 151], "nxvelocity_selector": [64, 69, 94], "nxxraylen": [64, 94], "beam_stop": 64, "bending_magnet": 64, "event_data": [64, 103], "insertion_devic": 64, "velocity_selector": [64, 69], "xraylen": 64, "veloc": [64, 69, 78, 92, 94, 152], "selector": [64, 69, 92, 94, 152], "accomod": 65, "coarser": 65, "tick": 65, "nentri": 65, "raw_valu": [65, 78], "thermocoupl": 65, "average_valu": [65, 103, 104], "average_value_error": [65, 103, 104], "639": 65, "minimum_valu": [65, 103, 104], "maximum_valu": [65, 103, 104], "even_layer_materi": 66, "even_layer_dens": 66, "odd_layer_materi": 66, "odd_layer_dens": 66, "odd": 66, "h20": 67, "d20": 67, "h2": 67, "ch4": 67, "d2": 67, "poison_depth": 67, "coupling_materi": [67, 103, 104], "cd": 67, "poison_materi": 67, "gd": 67, "pulse_shap": [67, 87], "poison": 67, "steadi": 68, "sampled_fract": 68, "calendar": [68, 136, 144], "paus": 68, "lost": 68, "unavail": 68, "intersect": [68, 96], "integral_log": 68, "ev": [69, 137], "nxgrate": [69, 94], "wavelength_error": 69, "820": 69, "energy_error": 69, "freeform": [70, 94], "pictur": 70, "movi": 70, "audio": 70, "creator": [70, 81, 120, 121, 126], "creat": [70, 81, 88, 111, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 132, 133, 134, 138, 143, 152, 154], "sequence_index": [70, 79], "nx_binari": [70, 146], "binari": [70, 114, 116, 118, 127, 128, 131, 133, 143, 146], "termin": [70, 114, 146, 147], "cr": [70, 114, 146], "lf": [70, 114, 146], "off": [72, 106, 116, 128], "cad": [72, 116], "l": [72, 75, 80, 107, 151], "winding_ord": [72, 116], "detector_fac": 72, "ascend": 72, "consecut": 72, "nxoff": 72, "wind": [72, 116], "numobj": [73, 85, 90], "cosin": 73, "six": [73, 103, 104], "dot": [73, 116], "product": [73, 98, 99, 101, 102, 105, 108, 119, 120, 125, 154], "orthonorm": [73, 90], "transliter": [75, 94], "pdb": [75, 94], "incorpor": [75, 110], "lowercas": [75, 114, 121], "loop": [75, 114], "unloop": 75, "beus": 75, "unambig": 75, "quot": [75, 115], "except": [75, 114, 116, 120, 121, 130, 143], "null": [75, 119, 147], "clariti": [75, 148], "ieee": 75, "nan": 75, "inf": 75, "ddl2": 75, "save": [75, 107, 120, 127, 143, 152, 154], "nxpdb_class": 75, "cbf_cbfsf": 75, "nest": [75, 89, 115, 133], "savefram": 75, "attribu": 75, "datablock1": 75, "cbf_cbfdb": 75, "category1": 75, "cbf_cbfcat": 75, "column_name1": 75, "column_name2": 75, "column_name3": 75, "category2": 75, "column_name4": 75, "column_name5": 75, "column_name6": 75, "saveframe1": 75, "category3": 75, "column_name7": 75, "column_name8": 75, "column_name9": 75, "begin": [75, 89, 114, 116, 128, 133, 147], "data_1yva": 75, "_entri": 75, "1yva": 75, "_audit_conform": 75, "dict_nam": 75, "mmcif_pdbx": 75, "dict_vers": 75, "279": 75, "dict_loc": 75, "ascii": [75, 114, 121, 130, 133, 154], "loop_": 75, "_database_2": 75, "database_id": 75, "database_cod": 75, "rcsb": [75, 114], "rcsb031959": 75, "d_1000031959": 75, "audit_conform": 75, "database_2": 75, "excerpt": [75, 133], "9in": 75, "_entity_poli": 75, "entity_id": 75, "nstd_linkag": 75, "nstd_monom": 75, "pdbx_seq_one_letter_cod": 75, "pdbx_seq_one_letter_code_can": 75, "giveqcctsicslyqlenycn": 75, "polypeptid": 75, "fvnqhlcgshlvealylvcgergffytpka": 75, "entity_poli": 75, "overlap": [76, 80, 136], "pin": 76, "hole": 76, "3he": 77, "motor": [78, 82, 89, 94, 97, 103, 104, 116, 151, 152], "piezo": [78, 94], "transduc": [78, 94], "mnemon": [78, 147], "target_valu": 78, "toler": 78, "soft_limit_min": 78, "soft_limit_max": 78, "acceleration_tim": 78, "ramp": 78, "controller_record": 78, "epic": [78, 114, 124], "taco": 78, "tango": 78, "acceler": [78, 87], "understand": [79, 89, 116, 127, 133, 134, 143], "reflection_id": 80, "partial": [80, 152], "exit": [80, 82, 118], "ewald": 80, "sphere": [80, 100, 116], "det_modul": 80, "flag": [80, 114, 147], "predict": 80, "used_in_refin": 80, "reference_spot": 80, "dont_integr": 80, "integrated_sum": 80, "integrated_prf": 80, "10": [80, 100, 114, 118, 119, 120, 121, 126, 130, 133, 134, 143, 148, 152, 154], "overload": 80, "overlapped_fg": 80, "13": [80, 114, 118, 121, 148, 154], "in_powder_r": 80, "foreground_includes_bad_pixel": 80, "15": [80, 114, 118, 121, 133, 134, 148, 154], "background_includes_bad_pixel": 80, "includes_bad_pixel": 80, "bad_shoebox": 80, "18": [80, 114, 118, 120, 121, 128, 133, 154], "bad_spot": 80, "19": [80, 114, 118, 121, 147, 154], "used_in_model": 80, "centroid_outli": 80, "21": [80, 114, 118, 121, 128, 154], "failed_during_background_model": 80, "failed_during_summ": 80, "23": [80, 114, 118, 121, 134, 147, 154], "failed_during_profile_fit": 80, "24": [80, 114, 118, 121, 128, 134, 154], "bad_refer": 80, "divid": [80, 114, 133], "inflat": 80, "predicted_fram": 80, "predicted_x": 80, "predicted_i": 80, "predicted_phi": 80, "predicted_px_x": 80, "predicted_px_i": 80, "observed_fram": 80, "observed_frame_var": 80, "varianc": 80, "observed_frame_error": 80, "observed_px_x": 80, "observed_px_x_var": 80, "observed_px_x_error": 80, "observed_px_i": 80, "observed_px_y_var": 80, "observed_px_y_error": 80, "observed_phi": 80, "observed_phi_var": 80, "observed_phi_error": 80, "observed_x": 80, "observed_x_var": 80, "observed_x_error": 80, "observed_i": 80, "observed_y_var": 80, "observed_y_error": 80, "bounding_box": 80, "bound": [80, 84], "background_mean": 80, "int_prf": 80, "int_prf_var": 80, "int_prf_error": 80, "int_sum": 80, "summat": 80, "int_sum_var": 80, "int_sum_error": 80, "lp": 80, "prf_cc": 80, "centroid": 80, "spheric": [80, 93], "int": [80, 118, 119, 120, 121, 122, 123, 134, 141, 143], "prf": 80, "var": 80, "cc": 80, "cement": 81, "file_update_tim": 81, "nexus_vers": [81, 118, 121, 126, 134], "hdf_version": 81, "hdf5_version": [81, 107, 118, 121, 126], "uppercas": [81, 107, 114, 147], "v": [81, 82, 107, 114, 120, 121, 126, 146, 147, 152], "xml_version": 81, "h5py_vers": [81, 107, 120, 121], "creator_vers": 81, "updat": 81, "n_temp": [82, 83], "n_efield": [82, 83], "n_mfield": [82, 83], "n_pfield": [82, 83], "n_sfield": [82, 83], "nxenviron": [82, 84, 94], "nxsample_compon": [82, 94], "changer_posit": [82, 103, 104], "changer": [82, 103, 104], "unit_cell_abc": [82, 83, 114], "unit_cell_alphabetagamma": [82, 83, 114], "sample_orient": [82, 83], "ub_matrix": 82, "nx_mass": [82, 83, 95, 146], "relative_molecular_mass": [82, 83, 95], "molecular": [82, 83, 95, 146], "buffer": [82, 121, 122, 123, 143], "sample_compon": 82, "member": [82, 107, 116, 136, 137, 144], "inert": 82, "oxidis": 82, "seal": 82, "kit": [82, 118, 138, 143, 154], "concentr": [82, 138], "volume_fract": [82, 83], "scattering_length_dens": [82, 83], "nx_scattering_length_dens": [82, 83, 146], "unit_cell_class": [82, 83], "triclin": [82, 83], "monoclin": [82, 83], "orthorhomb": [82, 83], "tetragon": [82, 83], "rhombohedr": [82, 83], "hexagon": [82, 83], "cubic": [82, 83], "crystallograph": [82, 83], "point_group": [82, 83], "path_length": 82, "path_length_window": 82, "window": [82, 95, 125], "external_dac": 82, "sent": [82, 136], "short_titl": 82, "legend": 82, "interact": [82, 114, 142, 154], "perfer": 82, "temperature_env": 82, "sensor1": 82, "816": 82, "value_log": [82, 84], "magnetic_field_env": 82, "magnetic_field_log": 82, "external_adc": 82, "pzt": 82, "adc": 82, "dac": 82, "env": [82, 121, 122, 123, 133], "abc": [82, 83, 114], "alphabetagamma": [82, 83, 114], "crysta": 83, "v22": 83, "p457": 83, "attached_to": 84, "ph": 84, "conduct": 84, "resist": 84, "flow": 84, "strain": 84, "shear": 84, "surface_pressur": 84, "pt100": 84, "rh": 84, "fe": 84, "hg": [84, 87, 115], "hg2cl2": 84, "ag": 84, "agcl": 84, "isfet": 84, "electrod": 84, "speci": 84, "ca2": 84, "hall": 84, "wilhelmi": 84, "run_control": 84, "synchronis": 84, "value_deriv1": 84, "high_trip_valu": 84, "low_trip_valu": 84, "setpoint": 84, "value_deriv2": 84, "external_field_brief": 84, "transvers": 84, "solenoid": [84, 105, 109], "gradient": 84, "vortic": 84, "global": [84, 114, 116, 118, 138, 143], "histori": [84, 114, 117, 131, 133], "value_deriv1_log": 84, "value_deriv2_log": 84, "external_field_ful": 84, "satisfi": [84, 115, 116, 133, 151, 152], "trip": 84, "deriv1": 84, "deriv2": 84, "nxflat": 85, "nxsphere": 85, "nxcone": 85, "nxellipt": 85, "nxtoroid": 85, "nxparabol": 85, "nxpolynomi": 85, "nshapepar": 85, "cone": [85, 100], "semi": 85, "major": [85, 114, 130, 136, 137], "minor": [85, 121], "parabol": 85, "polynom": 85, "concav": 85, "convex": 85, "signifi": 87, "pick": [87, 107, 114], "metal": 87, "emittance_x": 87, "nx_emitt": [87, 146], "emitt": [87, 146], "rad": [87, 146], "emittance_i": 87, "sigma_x": 87, "sigma_i": 87, "excit": 87, "nx_period": [87, 146], "target_materi": [87, 115], "depleted_u": [87, 115], "enriched_u": [87, 115], "pb": [87, 115], "number_of_bunch": 87, "bunch": 87, "bunch_length": 87, "bunch_dist": 87, "pulse_width": 87, "top_up": 87, "last_fil": 87, "recent": [87, 114, 127, 132, 135, 137, 143, 150, 152], "inject": 87, "infinit": 87, "thin": 87, "messag": [87, 147], "bunch_pattern": 87, "modal": [88, 94, 110], "wax": [88, 94, 127], "nxmyappdef": 88, "previous": [88, 127, 138, 154], "combin": [88, 95, 114, 130, 137, 138, 145, 147, 148, 151], "mime_typ": [88, 115], "graviti": 89, "movabl": [89, 116], "cap": 89, "nx_transform": [89, 146], "t_1": 89, "t_2": 89, "t_3": 89, "t_f": 89, "explicit": [89, 114, 146], "subset": [89, 116, 151], "affin": 89, "4x4": 89, "matric": [89, 116], "act": [89, 134], "homogen": 89, "t_r": 89, "pmatrix": 89, "o": [89, 107, 138], "0_3": 89, "t_t": 89, "i_3": 89, "3x3": 89, "xyz": [89, 116], "forc": [89, 119, 138], "axisname_end": 89, "motion": [89, 114, 116], "basi": [89, 130, 137, 147], "substitut": [89, 114, 127], "mechan": [89, 112, 114, 116, 128, 143], "mount": [89, 116], "placehold": 89, "_end": [89, 114], "axisname_increment_set": 89, "_increment_set": [89, 114], "ideal": [89, 116], "agre": [89, 114, 127, 130, 133], "signific": [89, 116, 152], "increment": [89, 114, 151], "movement": [90, 151], "perfectli": [90, 116], "gravitation": 90, "affili": 91, "local_contact": 91, "principal_investig": 91, "address": [91, 116, 121, 136, 147], "telephone_numb": 91, "telephon": 91, "fax_numb": 91, "fax": 91, "email": [91, 132, 144], "person": [91, 130, 154], "orcid": 91, "research": [91, 127, 137, 142, 154], "contributor": 91, "uri": 91, "spwidth": 92, "spoke": 92, "rotor": 92, "num": [92, 107], "lamella": 92, "twist": 92, "nxveloc": 92, "lens_geometri": 93, "paraboloid": [93, 100], "hyperbol": 93, "symmetr": 93, "focus_typ": 93, "lens_thick": 93, "lens_length": 93, "middl": 93, "number_of_lens": [93, 114], "lens": 93, "compound": 93, "lens_materi": 93, "cylinder_orient": 93, "nxcite": 94, "nxfresnel_zone_pl": 94, "nxpdb": 94, "nxreflect": 94, "investig": [95, 109, 122, 125, 137], "overal": [95, 114], "glass": 95, "vanadium": 95, "furnac": [95, 114], "anvil": 95, "left": [95, 116, 119, 120, 125], "blue": 95, "dash": 95, "subtract": 95, "portion": [95, 154], "furthermor": [95, 115, 154], "inconceiv": 95, "beampath": 95, "noth": [95, 119, 127], "insid": [95, 127, 148], "verbos": [95, 122, 143], "packing_fract": 95, "occupi": [95, 116], "adsorpt": 95, "reference_measur": 95, "inner": 95, "pack": 95, "contributed_definit": [95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110], "nxquadric": [96, 106, 109], "csg": [96, 106], "pointer": [96, 116, 118, 127], "union": 96, "complement": 96, "is_quadr": 96, "is_mesh": 96, "compulsori": [96, 127], "operand": 96, "ptychographi": [97, 109], "cxi": [97, 109], "cxi_vers": 97, "pai": [97, 147], "attent": [97, 147], "merger": 97, "restructur": [97, 111, 147], "remap": 97, "fulli": [97, 116, 127], "npts_x": 97, "npts_y": 97, "frame_size_x": 97, "frame_size_i": 97, "raster": 97, "entry_1": 97, "instrument_1": 97, "source_1": 97, "machin": [97, 114, 132, 145], "beam_1": 97, "incident_beam_energi": 97, "incident_energy_spread": 97, "detector_1": 97, "slowaxisnam": 97, "fastaxisnam": 97, "data_1": 97, "regardless": [97, 137, 138], "x_indic": 97, "y_indic": 97, "sample_1": 97, "life": 97, "geometry_1": 97, "nxcxi": 97, "ptycho": 97, "electrostat": [98, 102, 109], "kicker": [98, 99, 109], "beamline_dist": [98, 99, 101, 102, 105, 108], "set_curr": [98, 99, 101, 105], "suppli": [98, 99, 101, 102, 105, 108, 131, 145], "set_voltag": [98, 99], "volag": 98, "read_curr": [98, 99, 101, 105], "read_voltag": [98, 99, 101, 105], "nxelectrostat": 98, "nxmagnet": 99, "quadric": [100, 106, 109], "ten": 100, "q11": 100, "q12": 100, "q13": 100, "q22": 100, "q23": 100, "q33": 100, "p1": 100, "p2": 100, "p3": 100, "surface_typ": 100, "ellipsoid": 100, "elliptic_paraboloid": 100, "hyperbolic_paraboloid": 100, "elliptic_hyperboloid_of_1_sheet": 100, "elliptic_hyperboloid_of_2_sheet": 100, "elliptic_con": 100, "elliptic_cylind": 100, "hyperbolic_cylind": 100, "parabolic_cylind": 100, "spheroid": 100, "hyperboloid_1_sheet": 100, "hyperboloid_2_sheet": 100, "imaginari": 100, "quadrupol": [101, 109], "nxquadrupol": 101, "set_bfield_curr": [102, 108], "set_efield_voltag": [102, 108], "ht": [102, 108], "read_bfield_curr": [102, 108], "read_bfield_voltag": [102, 108], "read_efield_curr": [102, 108], "read_efield_voltag": [102, 108], "bfield": [102, 108], "efield": [102, 108], "sn": [103, 104, 109, 154], "collection_titl": [103, 104], "proton_charg": [103, 104], "nx_charg": [103, 104, 146], "raw_fram": [103, 104], "total_count": [103, 104], "nx_uint": [103, 104, 146], "total_uncounted_count": [103, 104], "daslog": [103, 104], "cvinfo": [103, 104], "histotool": [103, 104], "821": [103, 104], "nvalu": [103, 104], "numvalu": [103, 104], "snshistotool": [103, 104], "snsbanking_file_nam": [103, 104], "snsmapping_file_nam": [103, 104], "command1": [103, 104], "event2nxl": 103, "data_x_i": [103, 104], "event_pixel_id": 103, "event_time_of_flight": 103, "pulse_tim": 103, "snsdetector_calibration_id": [103, 104], "da": [103, 104], "snsgeometry_file_nam": [103, 104], "snstranslation_servic": [103, 104], "numpuls": 103, "numev": 103, "pixel_id": [103, 104], "nine": [103, 104], "numtimechannel": [103, 104], "holder": [103, 104, 116, 130], "snsdetector": [103, 104], "snsgeometri": [103, 104], "snstranslat": [103, 104], "servic": [103, 104], "charg": [103, 104, 109, 146], "snsbank": [103, 104], "snsmap": [103, 104], "uncount": [103, 104], "event2histo_nxl": 104, "data_x_time_of_flight": 104, "data_y_time_of_flight": 104, "numtof": 104, "nxchopper": 104, "nxsolenoid": 105, "node": [106, 109, 147, 154], "nxcsg": [106, 109], "off_geometri": 106, "nxsolid": 106, "remov": [107, 109, 115, 132, 147], "spec": [107, 121, 154], "certif": [107, 121, 154], "spec_fil": 107, "header": [107, 125], "spec_dat": 107, "spec_epoch": 107, "epoch": [107, 152], "spec_com": 107, "newlin": 107, "spec_num_head": 107, "scan_numb": 107, "cscan": 107, "690": 107, "750": [107, 125, 134], "60": 107, "temp_sp": 107, "degc_sp": 107, "mca": 107, "whitespac": [107, 115, 147], "energy_indic": [107, 151], "th_indic": 107, "seconda_1": 107, "spec_nam": 107, "intensity_factor": 107, "_mca_": 107, "_mca_channel_": 107, "_mca1_": 107, "_mca1_channel_": 107, "counter_cross_refer": 107, "positioner_cross_refer": 107, "clase": 107, "g3": 107, "g0": 107, "geo": 107, "sector": 107, "g1": 107, "g2": 107, "g4": 107, "assign": [107, 114, 116, 122, 146, 151], "neccesari": 107, "compli": [107, 127], "calib": 107, "comput": [107, 116, 121, 128, 133, 137, 147, 152, 154], "preset_tim": 107, "elapsed_live_tim": 107, "elapsed_real_tim": 107, "number_sav": 107, "first_sav": 107, "last_sav": 107, "reduction_coef": 107, "calib_a": 107, "calib_b": 107, "calib_c": 107, "roi": 107, "roin": 107, "first_channel": 107, "last_channel": 107, "unicat": 107, "ap": [107, 121, 126, 130], "spec_us": 107, "_unrecogn": 107, "unrecogn": 107, "mca1": 107, "degc": 107, "sp": 107, "coef": 107, "temp": 107, "nxspin": 108, "proposit": [109, 110, 114], "incub": [109, 110, 133], "feedback": 109, "ratif": 109, "nxcontain": 109, "nxcxi_ptycho": 109, "nxelectrostatic_kick": 109, "nxmagnetic_kick": 109, "nxquadrupole_magnet": 109, "nxsepar": 109, "nxsnsevent": 109, "nxsnshisto": 109, "nxsolenoid_magnet": 109, "nxsolid_geometri": 109, "nxspecdata": 109, "nxspin_rot": 109, "split": [110, 121, 126], "codifi": 110, "progress": [110, 125, 132, 151], "understood": [110, 116, 128], "predefin": [110, 147], "procedur": [110, 112, 114, 120, 127, 129, 130, 132, 144, 147], "fluo": [110, 151], "anticip": 110, "sphinx": 111, "indent": [111, 115, 116, 134, 148], "care": [111, 119, 132, 143], "mix": 111, "tab": [111, 147], "began": [112, 133], "goal": [112, 133, 154], "exchang": [112, 133, 144, 145], "advic": [112, 120, 133], "forum": [112, 133], "supervis": [112, 133, 144], "mainten": [112, 133, 137, 138, 144], "overse": [112, 130, 133, 136], "technic": [112, 114, 116, 133, 136, 154], "infrastructur": [112, 130, 133], "membership": [112, 116, 136], "camp": [112, 154], "tele": 112, "confer": [112, 130, 144, 154], "kept": 112, "repositori": [112, 115, 125, 127, 132, 134, 135, 145, 150, 152, 154], "organis": [112, 127], "forth": 112, "video": [112, 116, 152], "announc": [112, 132], "retir": 112, "1996": [113, 114, 130, 137], "download": [113, 132, 134, 154], "fdl": 113, "txt": [113, 121, 122, 123], "lgpl": 113, "trail": [114, 147], "letter": [114, 115, 127, 147], "validitemnam": [114, 145], "recognis": 114, "world": [114, 116, 126, 129, 133, 136], "latin": 114, "revisit": 114, "relax": 114, "za": [114, 115, 147], "z0": [114, 115, 147], "9_": [114, 147], "adequ": 114, "comprehens": 114, "persist": 114, "readback": 114, "occas": 114, "_set": 114, "temperature_set": 114, "_": [114, 115], "conflict": 114, "evolv": [114, 132, 137], "scheme": [114, 115, 116, 130, 151], "wide": [114, 116, 120, 127, 130, 145], "bluesky_": 114, "blueski": 114, "blueskyproject": 114, "idf_": 114, "ndattr": 114, "areadetector": [114, 120], "nx_": 114, "pdbx_": 114, "protein": 114, "sas_": 114, "silx_": 114, "silx": 114, "_mask": 114, "_weight": 114, "dataset_weight": 114, "lose": 114, "histor": [114, 127, 147], "obsolet": 114, "preceed": 114, "beam_center_x_refin": 114, "beam_center_x_initial_guess": 114, "borrow": [114, 152], "rare": 114, "beam_center_x_error": 114, "languag": [114, 115, 116, 118, 119, 121, 127, 130, 131, 133, 134, 137, 138, 142, 143, 147, 149], "iter": [114, 138], "qualifi": 114, "unnecessari": 114, "latenc": 114, "revers": [114, 141], "fortran": [114, 134, 138], "crazi": [114, 127], "25": [114, 121, 154], "26": [114, 118, 121, 154], "27": [114, 118, 121], "29": [114, 121, 147], "33": 114, "34": 114, "35": [114, 134], "36": 114, "37": 114, "38": 114, "39": 114, "40": [114, 120, 152], "41": [114, 134], "42": 114, "43": [114, 134], "44": [114, 125, 134], "45": [114, 151], "46": 114, "47": 114, "48": [114, 120, 133], "49": 114, "50": [114, 118], "51": 114, "52": 114, "53": 114, "54": 114, "55": 114, "56": 114, "57": 114, "58": 114, "64": [114, 141, 143, 147], "nx_int8": 114, "nx_int16": 114, "nx_int32": [114, 118, 121, 123, 134, 143, 151], "nx_int64": [114, 120], "nx_float32": [114, 118, 128, 134], "nx_float64": [114, 123], "uint8": 114, "07": [114, 120, 130], "31t21": 114, "0600": [114, 134], "interv": 114, "norm": [114, 146], "countri": [114, 146], "gone": [114, 146], "strftime": 114, "dt": 114, "appear": [114, 115, 116, 121, 123, 145, 147, 151, 152], "liter": 114, "readabl": [114, 127, 129, 145, 147], "assur": 114, "plethora": 114, "difficult": [114, 133, 151], "wherev": [114, 115, 143], "challeng": [114, 133], "till": 114, "crucial": 114, "emphas": 114, "visual": [114, 127, 130, 133, 142, 147, 154], "evolut": [114, 132], "underli": [114, 138], "undergo": 114, "distinct": [114, 116], "routin": [114, 116, 118, 127, 134, 141, 151, 154], "browser": [114, 125, 133, 134, 154], "encount": [114, 127, 138], "algorithm": [114, 116, 138, 154], "trivial": 114, "try": [114, 120, 126, 127, 143], "abscissa": [114, 147], "intent": [114, 116, 134, 151, 155], "possibilti": 114, "hdf5_file_nam": 114, "default_nxentry_group_nam": 114, "attr": [114, 120, 121, 122, 123, 126, 133], "default_nxdata_group_nam": 114, "signal_dataset_nam": 114, "fail": 114, "until": [114, 130], "succe": 114, "comma": [114, 147], "search": [114, 116, 120, 137, 138, 143], "among": [114, 147], "repeat": [114, 151], "unfortun": 114, "namespac": 114, "had": [114, 116, 120, 128, 130, 137, 147], "devis": [114, 137], "discourag": [114, 147], "prerequisit": 114, "webpag": [114, 131, 136], "datafil": 114, "1500": 114, "1502": 114, "1504": 114, "some_other_angl": 114, "1st": 114, "2nd": 114, "semant": [115, 119], "gihub": 115, "keyword": 115, "guarante": [115, 127, 143], "prepend": 115, "bold": 115, "namestartchar": 115, "namechar": 115, "Or": [115, 151], "_a": 115, "w_": [115, 147], "capit": 115, "surround": 115, "markup": 115, "unbound": [115, 147], "fragment": [115, 143], "pixel_shap": [115, 116], "enforc": [115, 119, 147], "explan": [116, 123], "extrem": [116, 133], "necess": 116, "wild": 116, "musr": 116, "navig": [116, 133, 134, 138], "self": [116, 133, 137], "notat": [116, 147, 148], "condens": 116, "convei": 116, "arrow": [116, 148], "meta": [116, 130, 138], "dataset_nam": 116, "calibration_statu": 116, "data_offset": 116, "rgba": [116, 147], "hsla": [116, 147], "cmyk": [116, 147], "colour": 116, "simpli": [116, 133], "scaler": [116, 147], "rgb": [116, 147], "hsl": [116, 147], "hdf5_object": 116, "_id": [116, 123], "externallink": [116, 121], "somewher": 116, "concept": [116, 152, 154], "filesystem": 116, "replic": 116, "notion": [116, 137], "truth": 116, "h5dump": [116, 121, 122, 123, 127, 128, 154, 155], "frequent": [116, 131, 152, 153], "portal": [116, 121, 125, 147], "hdfgroup": [116, 120, 121, 125, 128, 147, 154], "h5l_create_hard": 116, "strategi": [116, 127, 131, 153], "154": 116, "pm": 116, "obviou": [116, 133], "adapt": [116, 143], "satisif": 116, "easili": [116, 133, 145, 148, 151], "commerci": [116, 125], "vendor": 116, "external_link": 116, "targetfil": 116, "dl": 116, "i22": 116, "2012": [116, 130, 136], "sm7594": 116, "69201": 116, "pilatus2m": 116, "h5": [116, 119, 120, 126, 127], "targetpath": 116, "nx5nativeexternallink": 116, "fe8ddd287ee33961982931e2016cc25f76f95edd": 116, "src": [116, 132, 154], "napi5": 116, "l2248": 116, "maintain": [116, 128, 137, 144, 154], "napimount": 116, "_static": [116, 131, 147], "nexusintern": [116, 138, 147], "master": [116, 120, 121, 125, 134, 138, 139, 140, 141, 142, 154], "interfil": 116, "wherea": [116, 132, 151], "adopt": [116, 127, 133, 147, 154], "fact": [116, 133, 134, 145], "mislead": 116, "establish": [116, 144, 145], "sound": 116, "complic": [116, 127, 133, 147], "superced": 116, "397": 116, "notabl": [116, 137], "answer": 116, "scenario": 116, "exclud": 116, "my": [116, 127, 152], "java": [116, 120, 134, 138], "modern": [116, 133], "inherit": [116, 146], "bare": 116, "beauti": 116, "break": 116, "complianc": [116, 138], "prior": [116, 133], "knowledg": 116, "opposit": 116, "deal": 116, "seri": [116, 121, 130, 132, 144], "rise": 116, "mathemat": 116, "aspect": [116, 136, 137, 154], "matter": [116, 123, 130], "behind": 116, "industri": [116, 145], "robot": 116, "dynam": 116, "game": 116, "piec": [116, 127, 145], "Its": [116, 136, 147, 154, 155], "happen": [116, 151], "dir": [116, 134], "action": 116, "clear": [116, 126, 144], "arbitrarili": 116, "meridional_angl": 116, "implicit": 116, "polygon": 116, "straightforward": 116, "benefici": 116, "manipul": [116, 142, 154, 155], "freecad": 116, "render": [116, 147], "geomview": 116, "cube": 116, "mesh": 116, "initi": [116, 128, 138, 147, 154, 155], "proceed": 116, "compos": 116, "flatten": 116, "rag": 116, "concis": [116, 154, 155], "detector_shap": 116, "tile": 116, "forward": [116, 147], "occasion": 116, "undergon": 116, "soon": 116, "prove": 116, "approach": 116, "team": [116, 130], "learn": [116, 145], "becam": 116, "expand": 116, "demand": [116, 151], "came": [116, 133], "convinc": 116, "nevertheless": 116, "sign": [116, 138, 148], "post": [116, 123, 132, 136], "colophon": [117, 131], "n_t": 118, "n_p": 118, "nxhandl": [118, 134, 141, 143], "file_id": 118, "popul": 118, "getdata": [118, 143], "nxopen": [118, 134, 138], "nxfile": [118, 119, 134], "nxacc_create5": 118, "nxputattr": [118, 128, 134], "user_nam": 118, "joe": 118, "blogg": 118, "nxmakegroup": [118, 128, 134], "nxopengroup": [118, 134], "nxmakedata": [118, 128, 134], "nxopendata": [118, 128, 133, 134], "nxputdata": [118, 128, 134], "microsecond": [118, 134], "nxclosedata": [118, 133, 134], "nxclosegroup": [118, 134], "nxclose": [118, 134, 143], "longer": [118, 130, 137, 143, 154], "writedata": 118, "napif": 118, "nxhandles": 118, "nxacc_creat": [118, 134, 138], "nxputcharattr": 118, "nxumodul": [118, 138], "alloc": [118, 138], "getlocaldata": 118, "nx_ok": 118, "nxuwriteglob": [118, 138], "nxusetcompress": [118, 138], "nx_comp_lzw": 118, "nxuwritegroup": [118, 138], "nxuwritedata": [118, 138], "usr": [118, 121, 122, 123, 132, 133, 138, 143], "sy": 118, "numpi": [118, 120, 121, 122, 123, 130], "dtype": 118, "val": [118, 120], "nf": [118, 143], "w5": 118, "makegroup": 118, "opengroup": [118, 143], "putattr": 118, "makedata": [118, 143], "int32": [118, 121, 122, 123, 126, 133], "opendata": [118, 143], "putdata": [118, 143], "closedata": 118, "closegroup": 118, "datatyp": [118, 119, 120, 125, 126, 128, 134, 143], "h5t_string": [118, 125, 128], "strsize": [118, 125, 128], "strpad": [118, 125, 128], "h5t_str_nullterm": [118, 125], "cset": [118, 125, 128], "h5t_cset_ascii": [118, 125, 128], "ctype": [118, 125, 128], "h5t_c_s1": [118, 119, 125, 128], "dataspac": [118, 119, 125, 128, 147], "2011": [118, 119], "0100": 118, "h5t_std_i32l": [118, 125], "lot": [118, 137, 152], "distract": 118, "custom": 118, "readthedoc": [118, 122, 154, 155], "latest": [118, 122, 124, 137], "source_cod": [118, 122], "h5tree": [118, 122], "__arrai": [118, 120], "compliant": [119, 121, 124], "alon": 119, "two_theta": [119, 121, 122, 123, 126, 128, 133, 134], "two_theta_indic": [119, 121, 122, 123, 126, 133], "wrap": 119, "hdfid": 119, "h5function": 119, "gracefulli": 119, "clearer": 119, "instal": [119, 120, 125, 127, 131, 138, 142], "hugo": [119, 151], "octob": [119, 136, 137], "stdlib": 119, "void": [119, 134, 141, 143], "write_string_attr": 119, "hid_t": 119, "hid": 119, "const": 119, "char": [119, 141], "att": 119, "atttyp": 119, "attid": 119, "h5screat": 119, "h5s_scalar": 119, "h5tcopi": 119, "h5tset_siz": 119, "strlen": 119, "h5acreat": 119, "h5p_default": [119, 126], "h5awrit": 119, "h5sclose": 119, "h5tclose": 119, "h5aclos": 119, "write_int_attr": 119, "h5t_native_int": 119, "400": 119, "argc": 119, "argv": 119, "fid": [119, 126], "fapl": 119, "gid": 119, "dataprop": 119, "dataid": 119, "hsize_t": 119, "maxdim": 119, "rand_max": 119, "behaviour": [119, 151], "down": 119, "throat": 119, "h5pcreat": 119, "h5p_file_access": 119, "h5pset_fclose_degre": 119, "h5f_close_strong": 119, "h5fcreat": 119, "h5f_acc_trunc": 119, "h5pclose": 119, "h5gcreat": 119, "h5screate_simpl": 119, "h5p_dataset_cr": 119, "h5dcreat": 119, "h5dwrite": 119, "h5s_all": 119, "h5dclose": 119, "h5t_native_float": 119, "therebi": [119, 137], "h5glink": 119, "h5g_link_hard": 119, "h5fclose": 119, "nxh5write": 119, "memdataspac": 119, "h5fopen": 119, "h5f_acc_rdonli": 119, "h5dopen": 119, "h5dget_spac": 119, "h5sget_simple_extent_ndim": 119, "malloc": 119, "sizeof": 119, "h5sget_simple_extent_dim": 119, "h5t_native_int32": 119, "h5dread": 119, "printf": 119, "2f": 119, "10d": 119, "simdetector": 120, "pv": 120, "13sim1": 120, "rememb": [120, 121], "ioc": 120, "ll": [120, 121, 127], "directori": [120, 121, 127, 132, 138, 143, 145, 147], "screen": 120, "ndattribut": 120, "reformat": 120, "nonamespaceschemaloc": 120, "adcor": 120, "iocboot": 120, "acquiretim": 120, "epics_pv": 120, "cam1": 120, "dbrtype": 120, "dbr_nativ": 120, "imagecount": 120, "param": 120, "array_count": 120, "calc1_val": 120, "prj": 120, "usercalc1": 120, "calc2_val": 120, "usercalc2": 120, "maxsizex": 120, "max_size_x": 120, "maxsizei": 120, "max_size_i": 120, "cameramodel": 120, "cameramanufactur": 120, "fine": 120, "hdf5_layout": 120, "det_default": 120, "sd": [120, 128, 143, 147], "colormod": 120, "ndattr_default": 120, "hardlink": [120, 128], "util": [120, 124, 127, 128, 131, 133, 137, 155], "placement": 120, "onfileopen": 120, "onfileclos": 120, "exposure_": 120, "caqtdm": 120, "adbas": 120, "ndfilehdf5": 120, "bottom": 120, "ye": [120, 127], "zlib": 120, "enabl": [120, 133, 137, 143, 145, 148, 151], "won": [120, 145], "callback": 120, "wait": 120, "finish": 120, "tmp": 120, "mrinal_001": 120, "memori": [120, 138, 143], "tiff": 120, "pyepic": 120, "write_nexus_fil": 120, "py": [120, 122, 123, 154], "sim": 120, "def": 120, "fname": 120, "str": [120, 121], "__version__": 120, "create_group": [120, 121, 122, 123, 133], "create_dataset": [120, 121, 122, 123, 133], "gzip": 120, "__name__": 120, "__main__": 120, "img": 120, "caget": 120, "image1": 120, "arraydata": 120, "size_x": 120, "arraysizex_rbv": 120, "size_i": 120, "arraysizey_rbv": 120, "reshap": 120, "extra_inform": 120, "dict": 120, "unique_id": 120, "uniqueid_rbv": 120, "detector_st": 120, "detectorstate_rbv": 120, "bitcoin_valu": 120, "15000": 120, "2017": [120, 130], "582105": 120, "nx_uint8": 120, "80": 120, "112": 120, "208": 120, "240": 120, "176": 120, "144": 120, "simpler": [120, 127], "rewrit": 120, "nxfield": 120, "makelink": 120, "nxsignal": 120, "hdfview": [120, 127, 154], "nexpi": [120, 121, 127, 133, 154], "pymca": [120, 127, 154], "matlab": [120, 124, 154], "igorpro": 120, "idl": [120, 130, 134, 138], "write_nexus_file2": 120, "rewritten": 120, "adsimdetector": 120, "sourceforg": [120, 145, 154], "net": [120, 145, 154], "usax": [121, 126, 127], "station": 121, "32id": [121, 126], "extract": [121, 154], "mild": 121, "unfamiliar": 121, "mr_scan": [121, 126], "float64": [121, 122, 133], "i00": [121, 126, 151, 152], "92608": [121, 123, 126], "1037": [121, 122, 123, 126], "92591": [121, 123, 126], "1318": [121, 122, 123, 126], "92575": [121, 123, 126], "1704": [121, 122, 123, 126], "92558": [121, 126], "2857": [121, 126], "92541": [121, 126], "4516": [121, 126], "92525": [121, 126], "9998": [121, 126], "92508": [121, 126], "23819": [121, 126], "92491": [121, 126], "31662": [121, 126], "92475": [121, 126], "40458": [121, 126], "92458": [121, 126], "49087": [121, 126], "92441": [121, 126], "56514": [121, 126], "92425": [121, 126], "63499": [121, 126], "92408": [121, 126], "66802": [121, 126], "92391": [121, 126], "66863": [121, 126], "92375": [121, 126], "66599": [121, 126], "92358": [121, 126], "66206": [121, 126], "92341": [121, 126], "65747": [121, 126], "92325": [121, 126], "65250": [121, 126], "92308": [121, 126], "64129": [121, 126], "92291": [121, 126], "63044": [121, 126], "92275": [121, 126], "60796": [121, 126], "92258": [121, 126], "56795": [121, 126], "92241": [121, 126], "51550": [121, 126], "92225": [121, 126], "43710": [121, 126], "92208": [121, 126], "29315": [121, 126], "92191": [121, 126], "19782": [121, 126], "92175": [121, 126], "12992": [121, 126], "92158": [121, 126], "6622": [121, 126], "92141": [121, 126], "4198": [121, 126], "92125": [121, 126], "2248": [121, 126], "92108": [121, 122, 123, 126], "1321": [121, 122, 123, 126], "basicwrit": 121, "join": [121, 130, 136], "collat": 121, "corrupt": 121, "prj_test": [121, 126], "18t17": [121, 126], "04": [121, 126, 130], "0500": [121, 126], "loadtxt": [121, 122, 123], "dat": [121, 122, 123], "mr_arr": 121, "i00_arr": 121, "asarrai": [121, 122, 123], "wrote": [121, 152], "basicread": 121, "bulk": 121, "remind": 121, "9261": [121, 128], "9259": [121, 128], "9258": [121, 128], "9256": [121, 128], "9254": [121, 128], "9252": [121, 128], "9251": [121, 128], "9249": [121, 128], "9247": [121, 128], "9246": [121, 128], "9244": [121, 128], "9243": [121, 128], "9241": [121, 128], "9239": [121, 128], "9237": [121, 128], "9236": [121, 128], "9234": [121, 128], "9232": [121, 128], "9231": [121, 128], "9229": [121, 128], "9228": [121, 128], "9226": [121, 128], "9224": [121, 128], "9222": [121, 128], "9221": [121, 128], "9219": [121, 128], "9217": [121, 128], "9216": [121, 128], "9214": [121, 128], "9213": [121, 128], "9211": [121, 128], "demo": 121, "subsect": 121, "reader_attributes_trail": 121, "nx_entri": 121, "nx_data": 121, "attr_ax": 121, "isinst": 121, "tupl": 121, "rais": 121, "valueerror": 121, "zip": [121, 143, 154], "becaus": [121, 127, 143, 151], "descend": 121, "advantag": [121, 127], "local_addr": 121, "external_file_nam": 121, "external_addr": 121, "926079999999999": [121, 122], "h5l_create_extern": 121, "stabl": 121, "writer_2_1": [121, 123, 126], "file_hdf5_mast": 121, "file_hdf5_angl": 121, "file_hdf5_count": 121, "tthdata": [121, 122, 123], "countsdata": [121, 122, 123], "incomplet": 121, "external_angles_h5dump": 121, "external_angles_structur": 121, "punx": [121, 122, 123, 127, 154], "external_counts_h5dump": 121, "external_counts_structur": 121, "external_master_h5dump": 121, "external_master_structur": 121, "nexus_h5dump": 121, "nexus_structur": 121, "writer_1_3_h5pi": 122, "particularli": 122, "2014niac": 122, "writer_1_3": 122, "tth": [122, 128, 133, 134], "925909999999998": 122, "925750000000001": 122, "appreci": 122, "writer_1_3_h5dump": 122, "writer_1_3_structur": 122, "ds_tth": 123, "ds_count": 123, "source_addr": 123, "target_addr": 123, "h5g": [123, 126], "link_hard": 123, "behavior": 123, "writer_2_1_h5dump": 123, "writer_2_1_structur": 123, "hdf4": [124, 125, 127, 128, 130, 132, 134, 137, 138, 143, 147, 154], "awar": 124, "exmpl": 124, "lrmec": [124, 134], "grow": [124, 137, 152], "brows": [124, 129, 133, 137, 150, 154], "mostli": 124, "ipn": [125, 130, 134, 154], "nx5": [125, 133], "148x750": 125, "148x32": 125, "exampledata": [125, 127, 154], "histogram1": [125, 134], "eclips": [125, 154], "148": [125, 134], "h5t_ieee_f32l": 125, "751": [125, 134], "drag": 125, "click": [125, 133], "menu": 125, "platform": [125, 128, 137, 154], "radio": 125, "button": 125, "press": 125, "ok": 125, "white": 125, "dialog": 125, "wavemetr": [125, 154], "dataaccess": 125, "htm": [125, 154], "submenu": 125, "wave": 125, "hdfbrowser": 125, "panel": 125, "kienzl": 126, "docbook": 126, "basic_writ": 126, "disp": 126, "delet": [126, 143], "interven": [126, 144], "h5creat": 126, "h5write": 126, "h5writeatt": 126, "mr_scan_indic": 126, "h5disp": 126, "basic_read": 126, "h5info": 126, "fprintf": 126, "h5read": 126, "h5link": 126, "intermedi": [126, 133], "hello": 126, "goodby": 126, "myfil": 126, "200": 126, "hgdisp": 126, "idx": 126, "strfind": 126, "from_path": 126, "from_data": 126, "to_path": 126, "to_data": 126, "h5f": 126, "h5f_acc_rdwr": 126, "doesn": [126, 138], "create_intermedi": 126, "h5p": 126, "h5p_link_creat": 126, "set_create_intermediate_group": 126, "catch": [126, 143], "from_id": 126, "to_id": 126, "h5l": 126, "create_hard": 126, "henc": 127, "capitalis": 127, "mu": 127, "particip": 127, "never": 127, "am": [127, 143], "easiest": [127, 128], "graphic": [127, 147, 154], "rendit": 127, "nxbrows": [127, 134, 154], "backend": [127, 134, 137, 138, 143], "superior": 127, "happili": 127, "supers": 127, "why": 127, "glossari": [127, 145], "don": [127, 146], "mainstream": 127, "fair": 127, "back": [127, 145, 151, 154], "big": [127, 132], "forese": 127, "anywai": [127, 143], "lai": 127, "standardis": 127, "spent": 127, "past": [127, 133, 136], "chanc": 127, "perceiv": 127, "necessarili": 127, "serious": 127, "defint": 127, "willing": 127, "onc": [127, 144, 147, 152], "submit": [127, 133], "aren": [127, 146], "remain": [127, 134], "subroutin": [127, 134], "subclass": [127, 147], "vice": 127, "versa": 127, "super": 127, "giwax": 127, "think": [127, 132, 143], "founder": 128, "substanti": 128, "supercomput": 128, "ncsa": [128, 143], "univers": 128, "illinoi": 128, "urbana": 128, "champaign": 128, "uiuc": 128, "spun": 128, "thg": 128, "vgroup": [128, 143], "vsetclass": 128, "vgetclass": 128, "f77": [128, 134, 140], "f90": [128, 134, 141], "fileid": [128, 133, 134], "nxmakelink": 128, "itemid": 128, "nxmakenamedlink": 128, "linked_nam": 128, "h5t_str_nullpad": 128, "h5t_ieee_f64l": 128, "held": [129, 130, 136], "git": [129, 132, 154, 155], "thank": 129, "fork": 129, "voluntari": 130, "worker": 130, "2018": [130, 154], "05": 130, "v2018": 130, "releasenotes__v2018": 130, "597": 130, "releasenotes__v3": 130, "2016": [130, 147], "approv": 130, "esrf": 130, "workshop": [130, 137], "hyperspectr": 130, "2009": [130, 154], "09": 130, "draft": [130, 137], "sas2009": 130, "dtd": 130, "biggest": 130, "circumv": 130, "port": 130, "broader": 130, "script": [130, 138, 143, 154], "2005": 130, "emac": 130, "2003": 130, "enough": [130, 132, 143], "stake": 130, "caltech": 130, "06": 130, "richard": 130, "riedel": 130, "grant": 130, "explicitli": 130, "sima": 130, "technologi": [130, 137], "fund": [130, 137], "2002": 130, "brought": 130, "summer": 130, "mlnsc": 130, "lanl": 130, "1997": [130, 137], "sinq": [130, 154], "jonathan": 130, "tischler": [130, 137], "coauthor": 130, "08": [130, 147], "1994": [130, 137], "conven": 130, "jon": [130, 137], "invit": [130, 136], "94": [130, 137], "netcdf": [130, 137, 154], "nexus_propos": 130, "proposed_data_standard_for_the_ap": 130, "verif": [131, 153], "overview": [131, 134, 151], "core": [131, 154], "precompil": 131, "oct": [131, 137], "2023": 131, "onlin": [131, 138, 139, 143], "nexusmanu": 131, "impati": 131, "nximpati": 131, "rst": [132, 145], "ship": [132, 154], "mailman": [132, 136], "listinfo": [132, 136], "i386": 132, "readi": [132, 151, 154], "compil": [132, 142, 143], "uvh": 132, "architectur": [132, 154], "x86_64": 132, "rebuild": 132, "rpmbuild": 132, "buildroot": 132, "fedora": 132, "yum": 132, "devel": 132, "mxml": 132, "msi": 132, "dmg": 132, "checkout": 132, "clone": 132, "tarbal": 132, "outdat": 132, "websit": 132, "readm": [132, 142], "snapshot": 132, "mileston": 132, "articl": 132, "track": 132, "underw": 133, "conclus": 133, "fulfil": [133, 151], "promot": [133, 144], "cooper": 133, "stimul": 133, "sophist": 133, "interchang": [133, 137], "2015": 133, "301": 133, "305": 133, "1107": 133, "s1600576714027575": 133, "portabl": [133, 137], "media": 133, "briefli": 133, "addition": 133, "folder": [133, 154], "pertain": 133, "hide": [133, 138], "verysimpl": 133, "1193": 133, "4474": 133, "53220": 133, "photodiod": [133, 152], "9094": 133, "9096": 133, "9122": 133, "9098": 133, "91": 133, "9102": 133, "9104": 133, "9106": 133, "9108": 133, "911": 133, "9112": 133, "9114": 133, "9116": 133, "9118": 133, "912": 133, "diod": 133, "274310": 133, "515430": 133, "827880": 133, "1227100": 133, "1434640": 133, "1330280": 133, "1037070": 133, "598720": 133, "316460": 133, "56677": 133, "anyon": [133, 136, 155], "agreement": 133, "formal": 133, "tune": 133, "job": [133, 154], "nxgetdata": [133, 134], "unifi": [133, 138], "bind": [134, 138, 139, 140, 141, 142, 154], "77": [134, 138, 141], "90": [134, 138], "walk": 134, "attempt": 134, "fashion": [134, 151], "whenev": 134, "transpar": [134, 138], "travers": 134, "nxacc_read": [134, 143], "nxgetinfo": [134, 143], "nxmalloc": 134, "helper": 134, "session": 134, "lrcs3701": 134, "2000": 134, "02": 134, "eag": 134, "ro": 134, "histogram2": 134, "monitor1": 134, "monitor2": 134, "mgb2": 134, "pdo": 134, "37g": 134, "8k": 134, "120mev": 134, "e0": 134, "240hz": 134, "120hz": 134, "1900": 134, "000000": 134, "1902": 134, "1904": 134, "timelin": 135, "ticket": 135, "subscrib": 136, "pipermail": 136, "roughli": 136, "twice": 136, "month": 136, "agenda": 136, "teleconfer": 136, "tech": 136, "traffic": 136, "earli": 137, "1990": 137, "troublesom": 137, "wast": 137, "throughput": 137, "lack": 137, "led": 137, "june": 137, "scherer": 137, "august": 137, "mitch": 137, "nelson": 137, "broad": [137, 146], "disciplin": [137, 145], "Their": 137, "95": 137, "sept": 137, "96": 137, "attend": [137, 144], "late": 137, "creation": 137, "priori": [137, 147], "facilit": [137, 145, 151], "inde": 137, "raison": 137, "etr": 137, "benefit": [137, 144], "relianc": 137, "longev": 137, "lifetim": 137, "evid": 137, "faithfulli": 137, "cost": [137, 138], "insurmount": 137, "beyond": 137, "minim": 137, "upgrad": 137, "lexicographi": 137, "kev": [137, 146], "nrg": 137, "specialti": 137, "categor": 137, "meantim": 138, "freez": 138, "wrapper": [138, 141, 143], "implicitli": 138, "shutdown": 138, "acknowledg": 138, "inquiri": 138, "statement": [138, 141], "nxmodul": [138, 141], "nxureaddata": 138, "nxuwritehistogram": 138, "nxureadhistogram": 138, "subsequ": [138, 147], "nxufindclass": 138, "nxufinddata": 138, "nxufindattr": 138, "nxufindsign": 138, "nxufindaxi": 138, "nxufindlink": 138, "nxuresumelink": 138, "reopen": 138, "unsign": [138, 146, 147], "nxbuild": 138, "makefil": 138, "execut": [138, 144], "argument": [138, 143], "napi_test": 138, "pkg": 138, "config": 138, "gcc": 138, "cflag": 138, "lib": [138, 143], "issuereport": 138, "doxygen": 139, "cpp": 139, "nxstatu": [141, 143], "nxlink": 141, "nx_maxnamelen": [141, 147], "nxi1": 141, "selected_int_kind": 141, "nxi2": 141, "nxi4": 141, "nxr4": 141, "nxr8": 141, "0d0": 141, "evalu": 142, "idlroot": 142, "idldlm": 142, "dlm": 142, "htmlpreview": 142, "jni": 143, "disadvantag": 143, "runtim": 143, "jre": 143, "system32": 143, "asset": 143, "libjnexu": 143, "jvm": 143, "successfulli": 143, "windows32": 143, "administr": 143, "ld_library_path": 143, "pathnam": 143, "dorg": 143, "jnexuslib": 143, "classpath": 143, "sbin": 143, "sh": 143, "testjapi": 143, "batch": 143, "jl": 143, "win32": 143, "jdk1": 143, "idiom": 143, "nexusfileinterfac": 143, "unclutt": 143, "nexusfil": 143, "constructor": 143, "interspers": 143, "nexusexcept": 143, "anymor": 143, "tricki": 143, "garbag": 143, "collector": 143, "safer": 143, "safe": 143, "harm": 143, "idata": 143, "idim": 143, "trick": 143, "introspect": 143, "eleg": 143, "drawback": 143, "dumb": 143, "mein": 143, "entchen": 143, "string_data": 143, "getbyt": 143, "And": 143, "aforement": 143, "treatment": [143, 154], "signatur": 143, "getinfo": 143, "arg": 143, "debugg": 143, "hashtabl": 143, "groupdir": 143, "classnam": 143, "nxclass": [143, 148], "println": 143, "hasmoreel": 143, "vname": 143, "nextel": 143, "vclass": 143, "attrdir": 143, "attnam": 143, "atten": 143, "attributeentri": 143, "exercis": 143, "200mb": 143, "400mb": 143, "getslab": 143, "putslab": 143, "chunk": 143, "lang": 143, "outofmemoryexcept": 143, "ceil": 143, "mxxxm": 143, "mx512m": 143, "512mb": 143, "8192": 143, "ever": 143, "maxhandl": 143, "recompil": 143, "browsabl": 143, "driver": 143, "examin": 144, "amend": 144, "ratifi": 144, "internet": 144, "reach": 144, "plan": 144, "coincid": 144, "nobug": [144, 154], "satellit": 144, "offic": 144, "govern": 145, "xsltproc": 145, "xmllint": 145, "nomenclatur": [145, 148], "nxdltype": 145, "formedness_and_error": 145, "autom": 145, "caption": 145, "intention": 145, "jargon": 145, "assist": 145, "attributetyp": 145, "definitiontyp": 145, "definitiontypeattr": 145, "dimensionstyp": 145, "doctyp": 145, "enumerationtyp": 145, "fieldtyp": 145, "choicetyp": 145, "grouptyp": 145, "linktyp": 145, "symbolstyp": 145, "basiccompon": 145, "validnxclassnam": 145, "validtargetnam": 145, "nonnegativeunbound": 145, "alia": 146, "picki": 146, "nx_area": 146, "barn": 146, "cancel": 146, "nx_molecular_weight": 146, "mol": 146, "nx_per_area": 146, "pa": 146, "nx_count": 146, "steradian": 146, "wavenumb": 146, "immedi": 147, "controversi": 147, "metr": 147, "meter": 147, "sparingli": 147, "amongst": 147, "switch": 147, "subvers": 147, "prescrib": 147, "rank_": 147, "28computer_program": 147, "telco": 147, "qvec": 147, "tooltip": 147, "bullet": 147, "enumitem": 147, "synonym": 147, "ordin": 147, "xy": 147, "tutor": 147, "phypereg": 147, "512": [147, 151], "confin": 147, "prioriti": 147, "secondari": 147, "backward": 147, "beam_defining_slit": 147, "scatter_slit": 147, "needless": 147, "repetit": 147, "z_": 147, "constrain": 147, "token": 147, "bank1": 147, "nx_other": 147, "emploi": 147, "groupa": 147, "groupb": 147, "dataset1": 147, "feed": 147, "carriag": 147, "w3school": 147, "schema_dtypes_str": 147, "asp": 147, "processor": 147, "prototyp": 148, "strip": 148, "1023": 148, "zeolit": 148, "bins_indic": 148, "unspecifi": 148, "presum": 148, "1024": 148, "offer": [148, 154], "unimport": 148, "monthli": 150, "workflow": 151, "entry3": 151, "512x512": 151, "pydataproc2010": 151, "0a": 151, "sn2013287": 151, "ought": 151, "reproduc": 151, "clash": 151, "fluores": 151, "nxinstument": 151, "sasdet": 151, "fluordet": 151, "large_area": 151, "difficulti": 151, "mimic": 151, "rotation_angle_indic": 151, "mutipl": 151, "h_indic": 151, "k_indic": 151, "l_indic": 151, "chi_indic": 151, "phi_indic": 151, "polar_angle_indic": 151, "i0": [151, 152], "transit": 151, "customari": 151, "nt": 151, "i_data": 151, "i0_data": 151, "rasteris": 151, "spiral": 151, "xraster": 151, "yraster": 151, "orgin": 151, "prematur": 151, "underneath": 151, "foreseen": 151, "lazi": 151, "mxx": 151, "mzz": 151, "ttv": 151, "lieselott": 151, "pilatu": 151, "daunt": 152, "classifi": 152, "lll": 152, "ai": 152, "dy": 152, "helic": 152, "fictiti": 152, "marker": 152, "coars": 152, "trim": 152, "datapoint": 152, "pictori": 152, "grab": 152, "obvious": 152, "favourit": 152, "scene": 152, "correspondingli": 152, "morsel": 152, "ecb064453edb096d": 152, "cursori": 154, "critiqu": 154, "gui": 154, "nxconvert": 154, "nxdir": 154, "queri": 154, "nxingest": 154, "man": 154, "nxsummari": 154, "heavili": 154, "accomplish": 154, "plugin": 154, "nxplot": 154, "cnxvalid": [154, 155], "libxml2": [154, 155], "dave": 154, "itt": 154, "dawn": 154, "dawnsci": 154, "workbench": 154, "anaylsi": 154, "gda": 154, "opengda": 154, "framework": 154, "customis": 154, "gumtre": 154, "ansto": 154, "au": 154, "researchhub": 154, "ourinfrastructur": 154, "acn": 154, "harrisgeospati": 154, "using_idl_hom": 154, "igor": 154, "pro": 154, "extraordinarili": 154, "graph": 154, "isaw": 154, "ftp": 154, "merg": 154, "lamp": 154, "ill": 154, "eu": 154, "data_treat": 154, "langevin": 154, "mantid": 154, "mantidproject": 154, "collabor": 154, "mathwork": 154, "opengeni": 154, "primarili": 154, "art": 154, "toolkit": 154, "dispers": 154, "spec2nexu": 154, "h5totext": 154, "eznx": 154, "programmat": 154, "hdf5_tool": 154, "h5dist": 154, "hdfexplor": 154, "eo": 154, "630": 154, "poldi": 154, "4107360": 154, "axis2000": 154, "read_nexu": 154, "unicorn": 154, "chemistri": 154, "mcmaster": 154, "hdf5gatewai": 154, "prjemian": 154, "ti": 154, "dawnscienc": 154, "scisoft": 154, "nexushdf5load": 154, "nexusfilehdf5": 154, "nxreader": 154, "imagej": 154, "tri": 154, "4107439": 154, "cctbx": 154, "dxtbx": 154, "jf16m": 154, "swissfel": 154, "cctbx_project": 154, "jf16m_cxigeom2nexu": 154, "manti": 154, "spectromicroscopi": 154, "bitbucket": 154, "mlerot": 154, "sasview": 154, "sascalc": 154, "dataload": 154, "cansas_reader_hdf5": 154, "file_convert": 154, "nxcansas_writ": 154, "focusreport": 154, "skip": 154, "statist": 154, "tcl": 154, "swig": 154, "i80": 154, "ida": 154, "rrt_in_foc": 154, "4107386": 154, "zebra": 154, "dump": 154, "tricsread": 154, "4107416": 154, "unbias": 155, "staff": 155, "mine": 155, "reliabl": 155, "confid": 155, "bodi": 155, "catalog": 155}, "objects": {}, "objtypes": {}, "objnames": {}, "titleterms": {"construct": 0, "nexu": [0, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 128, 129, 130, 132, 133, 134, 135, 136, 137, 138, 143, 144, 145, 149, 151, 152, 153, 154], "file": [0, 114, 116, 118, 119, 120, 121, 122, 123, 124, 126, 128, 133, 134, 151, 152, 155], "applic": [0, 36, 116, 134, 135, 138], "definit": [0, 36, 94, 109, 110, 112, 115, 116, 132, 135, 145, 147], "The": [0, 116, 134, 144, 145, 152], "wonder": 0, "new": 0, "instrument": 0, "woni": 0, "decid": 0, "which": 0, "paramet": [0, 151], "need": 0, "store": [0, 114, 116, 120, 152], "map": [0, 128], "nxdata": [0, 48, 114, 116], "fill": 0, "auxiliari": 0, "inform": [0, 151, 152], "creat": 0, "nxdl": [0, 135, 145, 146, 147], "specif": [0, 146, 148], "step": [0, 152], "1": [0, 114], "think": 0, "hard": 0, "about": [0, 117], "data": [0, 114, 115, 121, 122, 123, 124, 125, 126, 133, 143, 148, 151, 152, 154], "2": [0, 114, 118, 125], "hierarchi": 0, "3": [0, 114, 118], "describ": 0, "thi": 0, "4": 0, "standard": [0, 137], "niac": [0, 136, 144], "full": 0, "list": [0, 136, 138], "us": [0, 114, 118, 119, 120, 121, 124, 125], "an": [0, 120], "process": [0, 132, 151], "author": 1, "nxarchiv": 2, "hypertext": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108], "anchor": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 145], "nxarp": 3, "nxcansa": 4, "nxdirecttof": 5, "nxfluo": 6, "nxindirecttof": 7, "nxiqproc": 8, "nxlauetof": 9, "nxmonopd": 10, "nxmx": 11, "nxrefscan": 12, "nxreftof": 13, "nxsa": 14, "nxsastof": 15, "nxscan": 16, "nxspe": 17, "nxsqom": 18, "nxstxm": 19, "nxta": 20, "nxtofnpd": 21, "nxtofraw": 22, "nxtofsingl": 23, "nxtomo": 24, "nxtomophas": 25, "nxtomoproc": 26, "nxxa": 27, "nxxasproc": 28, "nxxbase": 29, "nxxeuler": 30, "nxxkappa": 31, "nxxlaue": 32, "nxxlaueplat": 33, "nxxnb": 34, "nxxrot": 35, "nxapertur": 37, "nxattenu": 38, "nxbeam": 39, "nxbeam_stop": 40, "nxbending_magnet": 41, "nxcapillari": 42, "nxcite": 43, "nxcollect": [44, 151], "nxcollim": 45, "nxcrystal": 46, "nxcylindrical_geometri": [47, 116], "nxdetector": 49, "nxdetector_group": 50, "nxdetector_modul": 51, "nxdisk_chopp": 52, "nxentri": [53, 151], "nxenviron": 54, "nxevent_data": 55, "nxfermi_chopp": 56, "nxfilter": 57, "nxflipper": 58, "nxfresnel_zone_pl": 59, "nxgeometri": [60, 116], "nxgrate": 61, "nxguid": 62, "nxinsertion_devic": 63, "nxinstrument": 64, "nxlog": 65, "nxmirror": 66, "nxmoder": 67, "nxmonitor": 68, "nxmonochrom": 69, "nxnote": 70, "nxobject": 71, "nxoff_geometri": [72, 116], "nxorient": 73, "nxparamet": 74, "nxpdb": 75, "nxpinhol": 76, "nxpolar": 77, "nxposition": 78, "nxprocess": 79, "nxreflect": 80, "nxroot": 81, "nxsampl": 82, "nxsample_compon": 83, "nxsensor": 84, "nxshape": 85, "nxslit": 86, "nxsourc": 87, "nxsubentri": [88, 151], "nxtransform": 89, "nxtranslat": 90, "nxuser": 91, "nxvelocity_selector": 92, "nxxraylen": 93, "base": [94, 116, 135], "class": [94, 110, 116, 133, 135, 148], "nxcontain": 95, "nxcsg": 96, "nxcxi_ptycho": 97, "nxelectrostatic_kick": 98, "nxmagnetic_kick": 99, "nxquadric": 100, "nxquadrupole_magnet": 101, "nxsepar": 102, "nxsnsevent": 103, "nxsnshisto": 104, "nxsolenoid_magnet": 105, "nxsolid_geometri": 106, "nxspecdata": 107, "nxspin_rot": 108, "contribut": [109, 112], "colophon": 111, "commun": [112, 133, 137], "webpag": 112, "other": 112, "wai": 112, "coordin": [112, 116], "scientif": [112, 133, 137], "copyright": 113, "licens": 113, "rule": [114, 116, 151], "item": [114, 147], "name": [114, 115, 147], "convent": 114, "variant": 114, "uncertainti": 114, "error": 114, "arrai": 114, "storag": [114, 133], "order": 114, "non": 114, "c": [114, 118, 119, 139], "type": [114, 115, 146, 147], "date": 114, "time": [114, 152], "unit": [114, 115, 146, 147], "detector": [114, 116, 120, 151], "monitor": 114, "ar": 114, "special": [114, 151], "find": [114, 121], "plottabl": [114, 121], "version": [114, 132], "associ": 114, "multi": [114, 151], "dimension": 114, "axi": [114, 147], "attribut": [114, 115, 116, 120, 147], "appli": 114, "group": [114, 115, 116, 147, 151], "exampl": [114, 118, 119, 120, 121, 122, 123, 124, 126, 133, 148], "ax": [114, 147], "dimens": [114, 147], "number": 114, "introduct": [115, 133, 145], "overview": [115, 138], "descript": [115, 116], "symbol": [115, 147], "tabl": 115, "annot": 115, "structur": [115, 151], "field": [115, 116, 146, 147], "link": [115, 116, 121, 123, 126, 147], "choic": [115, 128, 147], "design": [116, 133], "object": [116, 133], "term": [116, 137], "python": [116, 118, 120, 121, 154], "h5py": [116, 120, 121, 122, 123], "code": [116, 120, 121, 124, 132, 135], "make": 116, "extern": [116, 121], "combin": 116, "facilit": 116, "automat": 116, "plot": [116, 121, 137], "where": 116, "metadata": 116, "geometri": 116, "system": 116, "transform": 116, "And": [116, 151], "shape": 116, "legaci": 116, "mcsta": 116, "simpl": [116, 118, 119, 123, 133, 137, 151], "spheric": 116, "polar": 116, "underli": [116, 128], "format": [116, 128, 137], "doc": [117, 147], "program": [118, 119, 134, 138, 143], "napi": [118, 124, 134, 135, 138, 139, 140, 141, 142, 143], "d": [118, 125], "write": [118, 119, 120, 121, 122, 123, 124, 126, 134, 143, 145], "f77": [118, 154], "f90": [118, 138], "view": [118, 120, 125], "hdf5": [118, 119, 120, 121, 154], "h5dump": [118, 125], "output": [118, 125], "punx": [118, 155], "tree": 118, "simple3d": 118, "h5": 118, "nativ": 119, "command": 119, "read": [119, 121, 124, 126, 134, 143], "epic": 120, "area": [120, 151], "plugin": 120, "configur": 120, "xml": 120, "layout": 120, "addit": 120, "imag": [120, 125], "packag": 120, "nexusformat": 120, "visual": [120, 125], "download": [120, 121, 122, 123, 126], "footnot": 120, "simplest": [121, 122, 152], "complet": 121, "default": 121, "external_angl": 121, "external_count": 121, "external_mast": 121, "sourc": [121, 132], "externalexampl": 121, "py": 121, "variou": 124, "languag": [124, 145, 154], "api": [124, 138, 143, 154], "from": 125, "lrmec": 125, "lrcs3701": 125, "hdfview": 125, "igorpro": [125, 154], "matlab": 126, "input": 126, "dat": 126, "frequent": 127, "ask": 127, "question": 127, "physic": 128, "hdf": [128, 154], "repositori": 129, "brief": 130, "histori": [130, 150], "user": [131, 153], "manual": [131, 153], "refer": [131, 145, 149], "document": [131, 143, 145, 149], "instal": [132, 143], "precompil": 132, "binari": 132, "linux": 132, "rpm": 132, "distribut": 132, "kit": 132, "microsoft": 132, "window": [132, 143], "mac": 132, "o": 132, "x": 132, "releas": 132, "note": 132, "tag": 132, "what": 133, "i": [133, 134], "A": 133, "set": 133, "principl": 133, "import": 133, "subroutin": 133, "interfac": [134, 138, 139, 140, 141, 142, 143], "how": 134, "do": 134, "brows": 134, "issu": 135, "report": [135, 138], "librari": [135, 143], "mail": 136, "intern": [136, 144, 147], "advisori": [136, 144], "committe": [136, 144], "video": 136, "confer": 136, "announc": 136, "develop": 136, "retir": 136, "motiv": 137, "unifi": 137, "reduct": 137, "analysi": [137, 154], "defin": 137, "dictionari": 137, "programm": 138, "frozen": 138, "statu": 138, "core": 138, "util": [138, 154], "routin": [138, 143], "build": 138, "bug": 138, "fortran": [140, 141], "77": 140, "90": 141, "idl": [142, 154], "java": [143, 154], "acknowledg": 143, "requir": [143, 147], "under": [143, 147], "unix": 143, "run": 143, "locat": 143, "share": 143, "jnexu": 143, "jar": 143, "inquiri": 143, "known": 143, "problem": 143, "On": 143, "line": 143, "allow": 146, "categori": [146, 147], "element": 147, "enumer": 147, "attributetyp": 147, "option": 147, "definitiontyp": 147, "extend": 147, "ignoreextraattribut": 147, "ignoreextrafield": 147, "ignoreextragroup": 147, "restrict": 147, "svnid": 147, "definitiontypeattr": 147, "dimensionstyp": 147, "rank": 147, "dim": 147, "incr": 147, "index": 147, "ref": 147, "refindex": 147, "valu": 147, "doctyp": 147, "enumerationtyp": 147, "fieldtyp": 147, "data_offset": 147, "interpret": 147, "long_nam": 147, "maxoccur": 147, "minoccur": 147, "nametyp": 147, "primari": 147, "recommend": 147, "signal": 147, "stride": 147, "choicetyp": 147, "grouptyp": 147, "linktyp": 147, "napimount": 147, "target": 147, "symbolstyp": 147, "basiccompon": 147, "validitemnam": 147, "validnxclassnam": 147, "validtargetnam": 147, "nonnegativeunbound": 147, "represent": 148, "path": 148, "revis": 150, "content": 151, "raw": 151, "method": 151, "case": [151, 152], "scan": [151, 152], "complex": 151, "hkl": 151, "xa": 151, "raster": 151, "stream": 151, "acquisit": 151, "log": 151, "strategi": 152, "": 152, "two": 152, "more": 152, "column": 152, "wavelength": 152, "stamp": 152, "next": 152, "suppli": 154, "valid": [154, 155], "tool": 154, "mix": 154, "verif": 155, "nxvalid": 155}, "envversion": {"sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.viewcode": 1, "sphinx": 58}, "alltitles": {"Constructing NeXus Files and Application Definitions": [[0, "constructing-nexus-files-and-application-definitions"]], "The WOnderful New Instrument (WONI)": [[0, "the-wonderful-new-instrument-woni"]], "Constructing a NeXus file for WONI": [[0, "constructing-a-nexus-file-for-woni"]], "Decide which parameters need to be stored": [[0, "decide-which-parameters-need-to-be-stored"]], "Mapping parameters to NeXus": [[0, "mapping-parameters-to-nexus"]], "Decide on NXdata": [[0, "decide-on-nxdata"]], "Fill in auxiliary Information": [[0, "fill-in-auxiliary-information"]], "Creating a NXDL Specification": [[0, "creating-a-nxdl-specification"]], "Application Definition Steps": [[0, "application-definition-steps"]], "Step 1: Think! hard about data": [[0, "step-1-think-hard-about-data"]], "Step 2: Map Data into the NeXus Hierarchy": [[0, "step-2-map-data-into-the-nexus-hierarchy"]], "Step 3: Describe this map in a NXDL file": [[0, "step-3-describe-this-map-in-a-nxdl-file"]], "Step 4: Standardize with the NIAC": [[0, "step-4-standardize-with-the-niac"]], "Full listing of the WONI Application Definition": [[0, "full-listing-of-the-woni-application-definition"]], "Using an Application Definition": [[0, "using-an-application-definition"]], "Processed Data": [[0, "processed-data"]], "Authors": [[1, "authors"]], "NXarchive": [[2, "nxarchive"]], "Hypertext Anchors": [[2, "hypertext-anchors"], [3, "hypertext-anchors"], [4, "hypertext-anchors"], [5, "hypertext-anchors"], [6, "hypertext-anchors"], [7, "hypertext-anchors"], [8, "hypertext-anchors"], [9, "hypertext-anchors"], [10, "hypertext-anchors"], [11, "hypertext-anchors"], [12, "hypertext-anchors"], [13, "hypertext-anchors"], [14, "hypertext-anchors"], [15, "hypertext-anchors"], [16, "hypertext-anchors"], [17, "hypertext-anchors"], [18, "hypertext-anchors"], [19, "hypertext-anchors"], [20, "hypertext-anchors"], [21, "hypertext-anchors"], [22, "hypertext-anchors"], [23, "hypertext-anchors"], [24, "hypertext-anchors"], [25, "hypertext-anchors"], [26, "hypertext-anchors"], [27, "hypertext-anchors"], [28, "hypertext-anchors"], [29, "hypertext-anchors"], [30, "hypertext-anchors"], [31, "hypertext-anchors"], [32, "hypertext-anchors"], [33, "hypertext-anchors"], [34, "hypertext-anchors"], [35, "hypertext-anchors"], [37, "hypertext-anchors"], [38, "hypertext-anchors"], [39, "hypertext-anchors"], [40, "hypertext-anchors"], [41, "hypertext-anchors"], [42, "hypertext-anchors"], [43, "hypertext-anchors"], [45, "hypertext-anchors"], [46, "hypertext-anchors"], [47, "hypertext-anchors"], [48, "hypertext-anchors"], [49, "hypertext-anchors"], [50, "hypertext-anchors"], [51, "hypertext-anchors"], [52, "hypertext-anchors"], [53, "hypertext-anchors"], [54, "hypertext-anchors"], [55, "hypertext-anchors"], [56, "hypertext-anchors"], [57, "hypertext-anchors"], [58, "hypertext-anchors"], [59, "hypertext-anchors"], [60, "hypertext-anchors"], [61, "hypertext-anchors"], [62, "hypertext-anchors"], [63, "hypertext-anchors"], [64, "hypertext-anchors"], [65, "hypertext-anchors"], [66, "hypertext-anchors"], [67, "hypertext-anchors"], [68, "hypertext-anchors"], [69, "hypertext-anchors"], [70, "hypertext-anchors"], [72, "hypertext-anchors"], [73, "hypertext-anchors"], [74, "hypertext-anchors"], [76, "hypertext-anchors"], [77, "hypertext-anchors"], [78, "hypertext-anchors"], [79, "hypertext-anchors"], [80, "hypertext-anchors"], [81, "hypertext-anchors"], [82, "hypertext-anchors"], [83, "hypertext-anchors"], [84, "hypertext-anchors"], [85, "hypertext-anchors"], [86, "hypertext-anchors"], [87, "hypertext-anchors"], [88, "hypertext-anchors"], [89, "hypertext-anchors"], [90, "hypertext-anchors"], [91, "hypertext-anchors"], [92, "hypertext-anchors"], [93, "hypertext-anchors"], [95, "hypertext-anchors"], [96, "hypertext-anchors"], [97, "hypertext-anchors"], [98, "hypertext-anchors"], [99, "hypertext-anchors"], [100, "hypertext-anchors"], [101, "hypertext-anchors"], [102, "hypertext-anchors"], [103, "hypertext-anchors"], [104, "hypertext-anchors"], [105, "hypertext-anchors"], [106, "hypertext-anchors"], [107, "hypertext-anchors"], [108, "hypertext-anchors"]], "NXarpes": [[3, "nxarpes"]], "NXcanSAS": [[4, "nxcansas"]], "NXdirecttof": [[5, "nxdirecttof"]], "NXfluo": [[6, "nxfluo"]], "NXindirecttof": [[7, "nxindirecttof"]], "NXiqproc": [[8, "nxiqproc"]], "NXlauetof": [[9, "nxlauetof"]], "NXmonopd": [[10, "nxmonopd"]], "NXmx": [[11, "nxmx"]], "NXrefscan": [[12, "nxrefscan"]], "NXreftof": [[13, "nxreftof"]], "NXsas": [[14, "nxsas"]], "NXsastof": [[15, "nxsastof"]], "NXscan": [[16, "nxscan"]], "NXspe": [[17, "nxspe"]], "NXsqom": [[18, "nxsqom"]], "NXstxm": [[19, "nxstxm"]], "NXtas": [[20, "nxtas"]], "NXtofnpd": [[21, "nxtofnpd"]], "NXtofraw": [[22, "nxtofraw"]], "NXtofsingle": [[23, "nxtofsingle"]], "NXtomo": [[24, "nxtomo"]], "NXtomophase": [[25, "nxtomophase"]], "NXtomoproc": [[26, "nxtomoproc"]], "NXxas": [[27, "nxxas"]], "NXxasproc": [[28, "nxxasproc"]], "NXxbase": [[29, "nxxbase"]], "NXxeuler": [[30, "nxxeuler"]], "NXxkappa": [[31, "nxxkappa"]], "NXxlaue": [[32, "nxxlaue"]], "NXxlaueplate": [[33, "nxxlaueplate"]], "NXxnb": [[34, "nxxnb"]], "NXxrot": [[35, "nxxrot"]], "Application Definitions": [[36, "application-definitions"]], "NXaperture": [[37, "nxaperture"]], "NXattenuator": [[38, "nxattenuator"]], "NXbeam": [[39, "nxbeam"]], "NXbeam_stop": [[40, "nxbeam-stop"]], "NXbending_magnet": [[41, "nxbending-magnet"]], "NXcapillary": [[42, "nxcapillary"]], "NXcite": [[43, "nxcite"]], "NXcollection": [[44, "nxcollection"], [151, "nxcollection"]], "NXcollimator": [[45, "nxcollimator"]], "NXcrystal": [[46, "nxcrystal"]], "NXcylindrical_geometry": [[47, "nxcylindrical-geometry"], [116, "nxcylindrical-geometry"]], "NXdata": [[48, "nxdata"]], "NXdetector": [[49, "nxdetector"]], "NXdetector_group": [[50, "nxdetector-group"]], "NXdetector_module": [[51, "nxdetector-module"]], "NXdisk_chopper": [[52, "nxdisk-chopper"]], "NXentry": [[53, "nxentry"]], "NXenvironment": [[54, "nxenvironment"]], "NXevent_data": [[55, "nxevent-data"]], "NXfermi_chopper": [[56, "nxfermi-chopper"]], "NXfilter": [[57, "nxfilter"]], "NXflipper": [[58, "nxflipper"]], "NXfresnel_zone_plate": [[59, "nxfresnel-zone-plate"]], "NXgeometry": [[60, "nxgeometry"]], "NXgrating": [[61, "nxgrating"]], "NXguide": [[62, "nxguide"]], "NXinsertion_device": [[63, "nxinsertion-device"]], "NXinstrument": [[64, "nxinstrument"]], "NXlog": [[65, "nxlog"]], "NXmirror": [[66, "nxmirror"]], "NXmoderator": [[67, "nxmoderator"]], "NXmonitor": [[68, "nxmonitor"]], "NXmonochromator": [[69, "nxmonochromator"]], "NXnote": [[70, "nxnote"]], "NXobject": [[71, "nxobject"]], "NXoff_geometry": [[72, "nxoff-geometry"], [116, "nxoff-geometry"]], "NXorientation": [[73, "nxorientation"]], "NXparameters": [[74, "nxparameters"]], "NXpdb": [[75, "nxpdb"]], "NXpinhole": [[76, "nxpinhole"]], "NXpolarizer": [[77, "nxpolarizer"]], "NXpositioner": [[78, "nxpositioner"]], "NXprocess": [[79, "nxprocess"]], "NXreflections": [[80, "nxreflections"]], "NXroot": [[81, "nxroot"]], "NXsample": [[82, "nxsample"]], "NXsample_component": [[83, "nxsample-component"]], "NXsensor": [[84, "nxsensor"]], "NXshape": [[85, "nxshape"]], "NXslit": [[86, "nxslit"]], "NXsource": [[87, "nxsource"]], "NXsubentry": [[88, "nxsubentry"]], "NXtransformations": [[89, "nxtransformations"]], "NXtranslation": [[90, "nxtranslation"]], "NXuser": [[91, "nxuser"]], "NXvelocity_selector": [[92, "nxvelocity-selector"]], "NXxraylens": [[93, "nxxraylens"]], "Base Class Definitions": [[94, "base-class-definitions"]], "NXcontainer": [[95, "nxcontainer"]], "NXcsg": [[96, "nxcsg"]], "NXcxi_ptycho": [[97, "nxcxi-ptycho"]], "NXelectrostatic_kicker": [[98, "nxelectrostatic-kicker"]], "NXmagnetic_kicker": [[99, "nxmagnetic-kicker"]], "NXquadric": [[100, "nxquadric"]], "NXquadrupole_magnet": [[101, "nxquadrupole-magnet"]], "NXseparator": [[102, "nxseparator"]], "NXsnsevent": [[103, "nxsnsevent"]], "NXsnshisto": [[104, "nxsnshisto"]], "NXsolenoid_magnet": [[105, "nxsolenoid-magnet"]], "NXsolid_geometry": [[106, "nxsolid-geometry"]], "NXspecdata": [[107, "nxspecdata"]], "NXspin_rotator": [[108, "nxspin-rotator"]], "Contributed Definitions": [[109, "contributed-definitions"], [112, "contributed-definitions"]], "NeXus Class Definitions": [[110, "nexus-class-definitions"]], "Colophon": [[111, "colophon"]], "NeXus Community": [[112, "nexus-community"]], "NeXus Webpage": [[112, "nexus-webpage"]], "Other Ways NeXus Coordinates with the Scientific Community": [[112, "other-ways-nexus-coordinates-with-the-scientific-community"]], "Copyright and Licenses": [[113, "copyright-and-licenses"]], "Rules for Storing Data Items in NeXus Files": [[114, "rules-for-storing-data-items-in-nexus-files"]], "Naming Conventions": [[114, "naming-conventions"]], "Variants": [[114, "variants"]], "Uncertainties or Errors": [[114, "uncertainties-or-errors"]], "NeXus Array Storage Order": [[114, "nexus-array-storage-order"]], "Non C Storage Order": [[114, "non-c-storage-order"]], "NeXus Data Types": [[114, "nexus-data-types"]], "NeXus dates and times": [[114, "nexus-dates-and-times"]], "NeXus Data Units": [[114, "nexus-data-units"]], "Storing Detectors": [[114, "storing-detectors"]], "Monitors are Special": [[114, "monitors-are-special"]], "Find the plottable data": [[114, "find-the-plottable-data"]], "Version 3": [[114, "version-3"]], "Version 2": [[114, "version-2"]], "Version 1": [[114, "version-1"]], "Associating Multi Dimensional Data with Axis Data": [[114, "associating-multi-dimensional-data-with-axis-data"]], "Associating plottable data using attributes applied to the NXdata group": [[114, "associating-plottable-data-using-attributes-applied-to-the-nxdata-group"]], "Examples": [[114, "examples"]], "Associating plottable data by name using the axes attribute": [[114, "associating-plottable-data-by-name-using-the-axes-attribute"]], "Associating plottable data by dimension number using the axis attribute": [[114, "associating-plottable-data-by-dimension-number-using-the-axis-attribute"]], "Introduction to NeXus definitions": [[115, "introduction-to-nexus-definitions"]], "Overview of NeXus definitions": [[115, "overview-of-nexus-definitions"]], "Description": [[115, "description"], [115, "id1"]], "Symbols table": [[115, "symbols-table"]], "Annotated Structure": [[115, "annotated-structure"]], "Names (groups, fields, links, and attributes)": [[115, "names-groups-fields-links-and-attributes"]], "NeXus data type": [[115, "nexus-data-type"]], "Units": [[115, "units"]], "Choice": [[115, "choice"]], "NeXus Design": [[116, "nexus-design"]], "NeXus Objects and Terms": [[116, "nexus-objects-and-terms"]], "Groups": [[116, "groups"]], "Fields": [[116, "fields"]], "Attributes": [[116, "attributes"]], "File attributes": [[116, "file-attributes"]], "Links": [[116, "links"]], "Python h5py code to make NeXus links": [[116, "index-13"]], "External File Links": [[116, "external-file-links"]], "Combining NeXus links and External File Links": [[116, "combining-nexus-links-and-external-file-links"]], "NeXus Base Classes": [[116, "nexus-base-classes"]], "NXdata Facilitates Automatic Plotting": [[116, "nxdata-facilitates-automatic-plotting"]], "Where to Store Metadata": [[116, "where-to-store-metadata"]], "NeXus Application Definitions": [[116, "nexus-application-definitions"]], "NeXus Geometry": [[116, "nexus-geometry"]], "The NeXus Coordinate System": [[116, "the-nexus-coordinate-system"]], "Coordinate Transformations": [[116, "coordinate-transformations"]], "Coordinate Transformation Field And Attributes": [[116, "coordinate-transformation-field-and-attributes"]], "Shape Descriptions": [[116, "shape-descriptions"]], "Detector Shape Descriptions": [[116, "detector-shape-descriptions"]], "Legacy Geometry Descriptions": [[116, "legacy-geometry-descriptions"]], "McStas and NXgeometry System": [[116, "mcstas-and-nxgeometry-system"]], "Simple (Spherical Polar) Coordinate System": [[116, "simple-spherical-polar-coordinate-system"]], "Rules and Underlying File Formats": [[116, "rules-and-underlying-file-formats"]], "About these docs": [[117, "about-these-docs"]], "Example NeXus programs using NAPI": [[118, "example-nexus-programs-using-napi"]], "NAPI Simple 2-D Write Example (C, F77, F90)": [[118, "napi-simple-2-d-write-example-c-f77-f90"]], "NAPI C Example: write simple NeXus file": [[118, "napi-c-example-write-simple-nexus-file"]], "NAPI F77 Example: write simple NeXus file": [[118, "napi-f77-example-write-simple-nexus-file"]], "NAPI F90 Example: write simple NeXus file": [[118, "napi-f90-example-write-simple-nexus-file"]], "NAPI Python Simple 3-D Write Example": [[118, "napi-python-simple-3-d-write-example"]], "NAPI Python Example: write simple NeXus file": [[118, "napi-python-example-write-simple-nexus-file"]], "View a NeXus HDF5 file using h5dump": [[118, "view-a-nexus-hdf5-file-using-h5dump"]], "NAPI Python Example: h5dump output of NeXus HDF5 file": [[118, "napi-python-example-h5dump-output-of-nexus-hdf5-file"]], "View a NeXus HDF5 file using punx tree": [[118, "view-a-nexus-hdf5-file-using-punx-tree"]], "NAPI Python Example: punx tree simple3D.h5 output of NeXus HDF5 file": [[118, "napi-python-example-punx-tree-simple3d-h5-output-of-nexus-hdf5-file"]], "Example NeXus C programs using native HDF5 commands": [[119, "example-nexus-c-programs-using-native-hdf5-commands"]], "Writing a simple NeXus file using native HDF5 commands in C": [[119, "writing-a-simple-nexus-file-using-native-hdf5-commands-in-c"]], "Reading a simple NeXus file using native HDF5 commands in C": [[119, "reading-a-simple-nexus-file-using-native-hdf5-commands-in-c"]], "EPICS Area Detector Examples": [[120, "epics-area-detector-examples"]], "HDF5 File Writing Plugin": [[120, "hdf5-file-writing-plugin"]], "configuration files": [[120, "configuration-files"]], "attributes.xml": [[120, "attributes-xml"]], "layout.xml": [[120, "layout-xml"]], "additional configuration": [[120, "additional-configuration"]], "Example view": [[120, "example-view"]], "Python code to store an image in a NeXus file": [[120, "python-code-to-store-an-image-in-a-nexus-file"]], "using the h5py package": [[120, "using-the-h5py-package"]], "using the nexusformat package": [[120, "using-the-nexusformat-package"]], "Visualization": [[120, "visualization"]], "Downloads": [[120, "downloads"], [126, "downloads"]], "Footnotes": [[120, "footnotes"]], "Python Examples using h5py": [[121, "python-examples-using-h5py"]], "Writing the simplest data using h5py": [[121, "writing-the-simplest-data-using-h5py"]], "Complete h5py example writing and reading a NeXus data file": [[121, "complete-h5py-example-writing-and-reading-a-nexus-data-file"]], "Writing the HDF5 file using h5py": [[121, "writing-the-hdf5-file-using-h5py"]], "Reading the HDF5 file using h5py": [[121, "reading-the-hdf5-file-using-h5py"]], "Finding the default plottable data": [[121, "finding-the-default-plottable-data"]], "Plotting the HDF5 file": [[121, "plotting-the-hdf5-file"]], "Links to Data in External HDF5 Files": [[121, "links-to-data-in-external-hdf5-files"]], "file: external_angles.hdf5": [[121, "file-external-angles-hdf5"]], "file: external_counts.hdf5": [[121, "file-external-counts-hdf5"]], "file: external_master.hdf5": [[121, "file-external-master-hdf5"]], "source code: externalExample.py": [[121, "source-code-externalexample-py"]], "downloads": [[121, "downloads"], [122, "downloads"], [123, "downloads"]], "h5py example writing the simplest NeXus data file": [[122, "h5py-example-writing-the-simplest-nexus-data-file"]], "h5py example writing a simple NeXus data file with links": [[123, "h5py-example-writing-a-simple-nexus-data-file-with-links"]], "Examples of writing and reading NeXus data files": [[124, "examples-of-writing-and-reading-nexus-data-files"]], "Code Examples in Various Languages": [[124, "code-examples-in-various-languages"]], "Code Examples that use the NeXus API (NAPI)": [[124, "code-examples-that-use-the-nexus-api-napi"]], "Code that reads NeXus data files": [[124, "code-that-reads-nexus-data-files"]], "Viewing 2-D Data from LRMECS": [[125, "viewing-2-d-data-from-lrmecs"]], "Visualize Using h5dump": [[125, "visualize-using-h5dump"]], "LRMECS lrcs3701 data: h5dump output": [[125, "lrmecs-lrcs3701-data-h5dump-output"]], "Visualize Using HDFview": [[125, "visualize-using-hdfview"]], "LRMECS lrcs3701 data: image": [[125, "lrmecs-lrcs3701-data-image"], [125, "id3"]], "Visualize Using IgorPro": [[125, "visualize-using-igorpro"]], "MATLAB Examples": [[126, "matlab-examples"]], "input.dat": [[126, "input-dat"]], "writing data": [[126, "writing-data"]], "reading data": [[126, "reading-data"]], "writing data file with links": [[126, "writing-data-file-with-links"]], "Frequently Asked Questions": [[127, "frequently-asked-questions"]], "Physical File format": [[128, "physical-file-format"]], "Choice of HDF as Underlying File Format": [[128, "choice-of-hdf-as-underlying-file-format"]], "Mapping NeXus into HDF": [[128, "mapping-nexus-into-hdf"]], "NeXus Repositories": [[129, "nexus-repositories"]], "Brief history of NeXus": [[130, "brief-history-of-nexus"]], "User Manual and Reference Documentation": [[131, "user-manual-and-reference-documentation"]], "Installation": [[132, "installation"], [143, "installation"]], "Precompiled Binary Installation": [[132, "precompiled-binary-installation"]], "Linux RPM Distribution Kits": [[132, "linux-rpm-distribution-kits"]], "Microsoft Windows Installation Kit": [[132, "microsoft-windows-installation-kit"]], "Mac OS X Installation Kit": [[132, "mac-os-x-installation-kit"]], "Source Installation": [[132, "source-installation"]], "NeXus Source Code Distribution": [[132, "nexus-source-code-distribution"]], "Releases": [[132, "releases"]], "NeXus definitions": [[132, "nexus-definitions"]], "Release Notes": [[132, "release-notes"]], "Release Process": [[132, "release-process"]], "Versioning (Tags)": [[132, "versioning-tags"]], "NeXus Introduction": [[133, "nexus-introduction"]], "What is NeXus?": [[133, "what-is-nexus"]], "A Set of Design Principles": [[133, "a-set-of-design-principles"]], "Example of a NeXus File": [[133, "example-of-a-nexus-file"]], "Important Classes": [[133, "important-classes"]], "Simple Example": [[133, "simple-example"]], "A Set of Data Storage Objects": [[133, "a-set-of-data-storage-objects"]], "A Set of Subroutines": [[133, "a-set-of-subroutines"]], "Scientific Community": [[133, "scientific-community"]], "NAPI: The NeXus Application Programming Interface": [[134, "napi-the-nexus-application-programming-interface"]], "How do I write a NeXus file?": [[134, "how-do-i-write-a-nexus-file"]], "How do I read a NeXus file?": [[134, "how-do-i-read-a-nexus-file"]], "How do I browse a NeXus file?": [[134, "how-do-i-browse-a-nexus-file"]], "NeXus Issue Reporting": [[135, "nexus-issue-reporting"]], "NeXus Code (NAPI, Library, and Applications)": [[135, "nexus-code-napi-library-and-applications"]], "NeXus Definitions (NXDL base classes and application definitions)": [[135, "nexus-definitions-nxdl-base-classes-and-application-definitions"]], "NeXus Mailing List": [[136, "nexus-mailing-list"]], "NeXus International Advisory Committee (NIAC) Mailing List": [[136, "nexus-international-advisory-committee-niac-mailing-list"]], "NeXus Video Conference Announcements": [[136, "nexus-video-conference-announcements"]], "NeXus Developers Mailing List (retired)": [[136, "nexus-developers-mailing-list-retired"]], "Motivations for the NeXus standard in the Scientific Community": [[137, "motivations-for-the-nexus-standard-in-the-scientific-community"]], "Simple plotting": [[137, "simple-plotting"]], "Unified format for reduction and analysis": [[137, "unified-format-for-reduction-and-analysis"]], "Defined dictionary of terms": [[137, "defined-dictionary-of-terms"]], "NAPI: NeXus Application Programmer Interface (frozen)": [[138, "napi-nexus-application-programmer-interface-frozen"]], "Status": [[138, "status"]], "Overview": [[138, "overview"]], "Core API": [[138, "core-api"]], "Utility API": [[138, "utility-api"]], "List of F90 Utility Routines": [[138, "list-of-f90-utility-routines"]], "Building Programs": [[138, "building-programs"]], "Reporting Bugs in the NeXus API": [[138, "reporting-bugs-in-the-nexus-api"]], "NAPI C and C++ Interface": [[139, "napi-c-and-c-interface"]], "NAPI Fortran 77 Interface": [[140, "napi-fortran-77-interface"]], "NAPI Fortran 90 Interface": [[141, "napi-fortran-90-interface"]], "NAPI IDL Interface": [[142, "napi-idl-interface"]], "NAPI Java Interface": [[143, "napi-java-interface"]], "Acknowledgement": [[143, "acknowledgement"]], "Requirements": [[143, "requirements"]], "Installation under Windows": [[143, "installation-under-windows"]], "Installation under Unix": [[143, "installation-under-unix"]], "Running Programs with the NeXus API for Java": [[143, "running-programs-with-the-nexus-api-for-java"]], "Locating the shared libraries": [[143, "locating-the-shared-libraries"]], "Locating jnexus.jar": [[143, "locating-jnexus-jar"]], "Programming with the NeXus API for Java": [[143, "programming-with-the-nexus-api-for-java"]], "Data Writing and Reading": [[143, "data-writing-and-reading"]], "Inquiry Routines": [[143, "inquiry-routines"]], "Known Problems": [[143, "known-problems"]], "On-line Documentation": [[143, "on-line-documentation"]], "NIAC: The NeXus International Advisory Committee": [[144, "niac-the-nexus-international-advisory-committee"]], "NXDL: The NeXus Definition Language": [[145, "nxdl-the-nexus-definition-language"]], "Introduction": [[145, "introduction"]], "Writing references and anchors in the documentation.": [[145, null]], "NXDL Field Types and Units": [[146, "nxdl-field-types-and-units"]], "Field Types allowed in NXDL specifications": [[146, "field-types-allowed-in-nxdl-specifications"]], "Unit Categories allowed in NXDL specifications": [[146, "unit-categories-allowed-in-nxdl-specifications"]], "NXDL Elements and Field Types": [[147, "nxdl-elements-and-field-types"]], "NXDL Elements": [[147, "nxdl-elements"]], "attribute": [[147, "attribute"], [147, "id24"]], "choice": [[147, "choice"]], "definition": [[147, "definition"], [147, "nxdl-data-type-definition"]], "dimensions": [[147, "dimensions"], [147, "id12"], [147, "id25"]], "doc": [[147, "doc"], [147, "id13"], [147, "id19"], [147, "id21"], [147, "id35"], [147, "id37"], [147, "id39"]], "enumeration": [[147, "enumeration"], [147, "id14"], [147, "id26"]], "field": [[147, "field"]], "group": [[147, "group"], [147, "id28"]], "link": [[147, "link"]], "symbols": [[147, "symbols"], [147, "id18"]], "NXDL Field Types (internal)": [[147, "nxdl-field-types-internal"]], "attributeType": [[147, "attributetype"]], "Attributes of attributeType": [[147, "attributes-of-attributetype"]], "@name": [[147, "name"], [147, "id16"], [147, "id27"], [147, "id31"], [147, "id36"], [147, "id38"]], "@optional": [[147, "optional"], [147, "id22"], [147, "id32"]], "@type": [[147, "type"], [147, "id17"], [147, "id23"], [147, "id34"]], "Elements of attributeType": [[147, "elements-of-attributetype"]], "definitionType": [[147, "definitiontype"]], "Attributes of definitionType": [[147, "attributes-of-definitiontype"]], "@category": [[147, "category"]], "@extends": [[147, "extends"]], "@ignoreExtraAttributes": [[147, "ignoreextraattributes"]], "@ignoreExtraFields": [[147, "ignoreextrafields"]], "@ignoreExtraGroups": [[147, "ignoreextragroups"]], "@restricts": [[147, "restricts"]], "@svnid": [[147, "svnid"]], "Elements of definitionType": [[147, "elements-of-definitiontype"]], "Groups under definitionType": [[147, "groups-under-definitiontype"]], "definitionTypeAttr": [[147, "definitiontypeattr"]], "dimensionsType": [[147, "dimensionstype"]], "Attributes of dimensionsType": [[147, "attributes-of-dimensionstype"]], "@rank": [[147, "rank"]], "Elements of dimensionsType": [[147, "elements-of-dimensionstype"]], "dim": [[147, "dim"]], "@incr": [[147, "incr"]], "@index": [[147, "index"]], "@ref": [[147, "ref"]], "@refindex": [[147, "refindex"]], "@required": [[147, "required"]], "@value": [[147, "value"], [147, "id20"]], "docType": [[147, "doctype"]], "enumerationType": [[147, "enumerationtype"]], "Elements of enumerationType": [[147, "elements-of-enumerationtype"]], "item": [[147, "item"]], "fieldType": [[147, "fieldtype"]], "@axes": [[147, "axes"]], "@axis": [[147, "axis"]], "@data_offset": [[147, "data-offset"]], "@interpretation": [[147, "interpretation"]], "@long_name": [[147, "long-name"]], "@maxOccurs": [[147, "maxoccurs"], [147, "id29"]], "@minOccurs": [[147, "minoccurs"], [147, "id30"]], "@nameType": [[147, "nametype"]], "@primary": [[147, "primary"]], "@recommended": [[147, "recommended"], [147, "id33"]], "@signal": [[147, "signal"]], "@stride": [[147, "stride"]], "@units": [[147, "units"]], "choiceType": [[147, "choicetype"]], "Attributes of choiceType": [[147, "attributes-of-choicetype"]], "Elements of choiceType": [[147, "elements-of-choicetype"]], "groupType": [[147, "grouptype"]], "Attributes of groupType": [[147, "attributes-of-grouptype"]], "linkType": [[147, "linktype"]], "@napimount": [[147, "napimount"]], "@target": [[147, "target"]], "symbolsType": [[147, "symbolstype"]], "Elements of symbolsType": [[147, "elements-of-symbolstype"]], "symbol": [[147, "symbol"]], "basicComponent": [[147, "basiccomponent"]], "Attributes of basicComponent": [[147, "attributes-of-basiccomponent"]], "Elements of basicComponent": [[147, "elements-of-basiccomponent"]], "validItemName": [[147, "validitemname"]], "validNXClassName": [[147, "validnxclassname"]], "validTargetName": [[147, "validtargetname"]], "nonNegativeUnbounded": [[147, "nonnegativeunbounded"]], "Representation of data examples": [[148, "representation-of-data-examples"]], "Class path specification": [[148, "class-path-specification"]], "NeXus: Reference Documentation": [[149, "nexus-reference-documentation"]], "Revision History": [[150, "revision-history"]], "Rules for Structuring Information in NeXus Files": [[151, "rules-for-structuring-information-in-nexus-files"]], "Content of a Raw Data NXentry Group": [[151, "content-of-a-raw-data-nxentry-group"]], "Content of a processed data NXentry group": [[151, "content-of-a-processed-data-nxentry-group"]], "NXsubentry or Multi-Method Data": [[151, "nxsubentry-or-multi-method-data"]], "Rules for Special Cases": [[151, "rules-for-special-cases"]], "Scans": [[151, "scans"]], "Simple scan": [[151, "simple-scan"]], "Simple scan with area detector": [[151, "simple-scan-with-area-detector"]], "Complex hkl scan": [[151, "complex-hkl-scan"]], "Multi-parameter scan: XAS": [[151, "multi-parameter-scan-xas"]], "Rastering": [[151, "rastering"]], "Streaming Data Acquisition And Logging": [[151, "streaming-data-acquisition-and-logging"]], "Strategies for storing information in NeXus data files": [[152, "strategies-for-storing-information-in-nexus-data-files"]], "Strategies: The simplest case(s)": [[152, "strategies-the-simplest-case-s"]], "Step scan with two or more data columns": [[152, "step-scan-with-two-or-more-data-columns"]], "Strategies: The wavelength": [[152, "strategies-the-wavelength"]], "Strategies: Time-stamped data": [[152, "strategies-time-stamped-data"]], "Strategies: The next case": [[152, "strategies-the-next-case"]], "NeXus: User Manual": [[153, "nexus-user-manual"]], "NeXus Utilities": [[154, "nexus-utilities"]], "Utilities supplied with NeXus": [[154, "utilities-supplied-with-nexus"]], "Validation": [[154, "validation"]], "Data Analysis": [[154, "data-analysis"]], "HDF Tools": [[154, "hdf-tools"]], "Language APIs for NeXus and HDF5": [[154, "language-apis-for-nexus-and-hdf5"]], "Language API: F77": [[154, "language-api-f77"]], "Language API: IDL": [[154, "language-api-idl"]], "Language API: IgorPro": [[154, "language-api-igorpro"]], "Language API: Java": [[154, "language-api-java"]], "Language API: Python": [[154, "language-api-python"]], "Language API: mixed": [[154, "language-api-mixed"]], "Verification and validation of files": [[155, "verification-and-validation-of-files"]], "nxvalidate": [[155, "nxvalidate"]], "punx": [[155, "punx"]]}, "indexentries": {"nxdl template file": [[0, "index-6"], [0, "index-6"]], "nxprocess": [[0, "index-11"], [79, "index-0"]], "processed data": [[0, "index-11"]], "woni": [[0, "index-0"], [0, "index-1"]], "category (nxdl attribute)": [[0, "index-6"]], "definition (nxdl element)": [[0, "index-6"], [147, "index-3"]], "dim (nxdl element)": [[0, "index-8"]], "dimensions (nxdl element)": [[0, "index-8"], [147, "index-4"]], "doc (nxdl element)": [[0, "index-8"], [147, "index-5"]], "extends (nxdl attribute)": [[0, "index-6"]], "field (nxdl element)": [[0, "index-8"], [147, "index-7"]], "group (nxdl element)": [[0, "index-7"], [147, "index-8"]], "hierarchy": [[0, "index-12"], [0, "index-3"], [0, "index-5"], [116, "index-0"], [116, "index-2"], [133, "index-8"], [133, "index-9"], [151, "index-2"], [151, "index-3"], [154, "index-7"]], "index (nxdl attribute)": [[0, "index-8"]], "metadata": [[0, "index-10"], [0, "index-2"], [0, "index-4"], [116, "index-25"], [145, "index-2"], [155, "index-1"]], "name (nxdl attribute)": [[0, "index-6"], [0, "index-8"]], "rank": [[0, "index-9"], [114, "index-33"], [114, "index-46"], [134, "index-5"]], "rank (nxdl attribute)": [[0, "index-8"]], "template": [[0, "index-6"]], "tutorial": [[0, "index-1"]], "type (nxdl attribute)": [[0, "index-6"], [0, "index-7"], [0, "index-8"]], "units (nxdl attribute)": [[0, "index-8"]], "value (nxdl attribute)": [[0, "index-8"]], "xmlns (nxdl attribute)": [[0, "index-6"]], "xsi:schemalocation (nxdl attribute)": [[0, "index-6"]], "authors": [[1, "index-0"]], "documentation editor": [[1, "index-1"]], "nxarchive": [[2, "index-0"]], "nxarchive (application definition)": [[2, "index-0"]], "nxentry (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-0"], [81, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-10"]], "nxinstrument (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-1"], [64, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-14"]], "nxsample (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-1"], [82, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [133, "index-13"]], "nxsource (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [14, "index-1"], [15, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [29, "index-1"], [32, "index-1"], [64, "index-1"], [87, "index-0"], [97, "index-1"], [103, "index-1"], [104, "index-1"]], "nxuser (base class)": [[2, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [53, "index-1"], [88, "index-1"], [91, "index-0"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "archive (application definition)": [[2, "index-0"], [2, "index-0"]], "chemical_formula (field)": [[2, "index-31"], [46, "index-6"], [57, "index-9"], [82, "index-5"], [83, "index-5"], [95, "index-4"]], "collection_description (field)": [[2, "index-7"], [53, "index-9"], [88, "index-9"]], "collection_identifier (field)": [[2, "index-6"], [53, "index-8"], [88, "index-8"], [103, "index-2"], [104, "index-2"]], "collection_time (field)": [[2, "index-12"], [53, "index-24"], [88, "index-20"]], "definition (field)": [[2, "index-15"], [3, "index-5"], [4, "index-8"], [5, "index-4"], [6, "index-4"], [7, "index-4"], [8, "index-4"], [9, "index-2"], [10, "index-4"], [11, "index-7"], [12, "index-5"], [13, "index-5"], [14, "index-6"], [15, "index-5"], [16, "index-5"], [17, "index-3"], [18, "index-4"], [19, "index-5"], [20, "index-4"], [21, "index-4"], [22, "index-4"], [23, "index-4"], [24, "index-5"], [25, "index-5"], [26, "index-3"], [27, "index-5"], [28, "index-4"], [29, "index-4"], [30, "index-4"], [31, "index-2"], [32, "index-2"], [33, "index-2"], [34, "index-2"], [35, "index-2"], [53, "index-14"], [88, "index-11"], [97, "index-5"], [103, "index-4"], [104, "index-4"], [107, "index-14"]], "description (field)": [[2, "index-23"], [2, "index-29"], [4, "index-99"], [11, "index-21"], [37, "index-6"], [40, "index-4"], [43, "index-3"], [49, "index-30"], [54, "index-5"], [57, "index-4"], [60, "index-5"], [62, "index-4"], [65, "index-8"], [66, "index-5"], [70, "index-7"], [78, "index-5"], [82, "index-27"], [83, "index-14"], [95, "index-3"], [98, "index-2"], [99, "index-2"], [101, "index-2"], [102, "index-2"], [103, "index-21"], [103, "index-31"], [103, "index-42"], [103, "index-66"], [103, "index-77"], [103, "index-84"], [103, "index-86"], [104, "index-21"], [104, "index-31"], [104, "index-42"], [104, "index-66"], [104, "index-78"], [104, "index-85"], [104, "index-87"], [105, "index-2"], [108, "index-2"]], "duration (field)": [[2, "index-11"], [22, "index-5"], [23, "index-5"], [53, "index-23"], [65, "index-15"], [88, "index-19"], [103, "index-22"], [103, "index-32"], [103, "index-5"], [104, "index-22"], [104, "index-32"], [104, "index-5"]], "electric_field (field)": [[2, "index-36"], [82, "index-7"]], "end_time (field)": [[2, "index-10"], [11, "index-5"], [12, "index-4"], [13, "index-4"], [14, "index-5"], [16, "index-4"], [19, "index-4"], [24, "index-4"], [25, "index-4"], [53, "index-22"], [68, "index-6"], [88, "index-18"], [97, "index-4"], [103, "index-6"], [104, "index-6"]], "entry_identifier (field)": [[2, "index-8"], [53, "index-10"], [88, "index-10"], [103, "index-7"], [104, "index-7"]], "experiment_description (field)": [[2, "index-5"], [53, "index-7"], [88, "index-7"]], "experiment_identifier (field)": [[2, "index-4"], [53, "index-6"], [88, "index-6"], [103, "index-8"], [104, "index-8"]], "facility_user_id (field)": [[2, "index-21"], [91, "index-10"], [103, "index-99"], [104, "index-100"]], "index (group attribute)": [[2, "index-2"]], "magnetic_field (field)": [[2, "index-35"], [41, "index-6"], [82, "index-9"]], "name (field)": [[2, "index-19"], [2, "index-22"], [2, "index-25"], [2, "index-27"], [3, "index-23"], [3, "index-7"], [4, "index-60"], [4, "index-85"], [4, "index-97"], [6, "index-11"], [6, "index-6"], [8, "index-5"], [8, "index-7"], [8, "index-9"], [9, "index-11"], [10, "index-11"], [10, "index-6"], [11, "index-12"], [11, "index-77"], [11, "index-9"], [12, "index-12"], [12, "index-7"], [13, "index-14"], [13, "index-6"], [14, "index-25"], [14, "index-7"], [14, "index-9"], [15, "index-23"], [15, "index-6"], [15, "index-8"], [17, "index-16"], [18, "index-5"], [18, "index-7"], [18, "index-9"], [19, "index-7"], [20, "index-14"], [20, "index-5"], [21, "index-13"], [21, "index-6"], [22, "index-15"], [22, "index-8"], [23, "index-13"], [23, "index-7"], [24, "index-16"], [24, "index-7"], [25, "index-18"], [25, "index-7"], [26, "index-5"], [26, "index-7"], [27, "index-12"], [27, "index-7"], [28, "index-5"], [29, "index-15"], [29, "index-6"], [54, "index-2"], [64, "index-4"], [78, "index-4"], [82, "index-4"], [83, "index-4"], [84, "index-5"], [87, "index-5"], [91, "index-3"], [95, "index-2"], [97, "index-43"], [97, "index-6"], [103, "index-100"], [103, "index-48"], [103, "index-50"], [103, "index-97"], [104, "index-101"], [104, "index-48"], [104, "index-50"], [104, "index-98"]], "preparation_date (field)": [[2, "index-32"], [82, "index-28"]], "pressure (field)": [[2, "index-38"], [82, "index-13"]], "probe (field)": [[2, "index-26"], [3, "index-8"], [6, "index-7"], [8, "index-8"], [10, "index-7"], [12, "index-8"], [14, "index-10"], [15, "index-9"], [18, "index-8"], [19, "index-8"], [20, "index-6"], [24, "index-8"], [25, "index-8"], [26, "index-6"], [27, "index-8"], [29, "index-7"], [87, "index-8"], [97, "index-8"], [103, "index-51"], [104, "index-51"]], "program (field)": [[2, "index-16"], [8, "index-10"], [18, "index-10"], [26, "index-8"], [28, "index-6"], [54, "index-6"], [79, "index-4"]], "release_date (field)": [[2, "index-18"]], "revision (field)": [[2, "index-14"], [53, "index-29"], [88, "index-25"]], "role (field)": [[2, "index-20"], [91, "index-4"], [103, "index-101"], [104, "index-102"]], "run_cycle (field)": [[2, "index-13"], [53, "index-25"], [88, "index-21"]], "sample_id (field)": [[2, "index-28"]], "situation (field)": [[2, "index-33"], [82, "index-26"]], "start_time (field)": [[2, "index-9"], [3, "index-4"], [5, "index-3"], [6, "index-3"], [7, "index-3"], [10, "index-3"], [11, "index-4"], [12, "index-3"], [13, "index-3"], [14, "index-4"], [15, "index-4"], [16, "index-3"], [19, "index-3"], [20, "index-3"], [21, "index-3"], [22, "index-3"], [23, "index-3"], [24, "index-3"], [25, "index-3"], [27, "index-4"], [29, "index-3"], [49, "index-47"], [53, "index-21"], [68, "index-5"], [88, "index-17"], [97, "index-3"], [103, "index-13"], [104, "index-13"]], "stress_field (field)": [[2, "index-37"], [82, "index-11"]], "temperature (field)": [[2, "index-34"], [3, "index-24"], [4, "index-88"], [11, "index-11"], [17, "index-20"], [29, "index-18"], [46, "index-40"], [57, "index-6"], [67, "index-10"], [82, "index-6"], [103, "index-73"], [104, "index-74"]], "title (field)": [[2, "index-3"], [3, "index-3"], [4, "index-9"], [5, "index-2"], [6, "index-2"], [7, "index-2"], [8, "index-3"], [10, "index-2"], [11, "index-3"], [12, "index-2"], [13, "index-2"], [14, "index-3"], [15, "index-3"], [16, "index-2"], [18, "index-3"], [19, "index-2"], [20, "index-2"], [21, "index-2"], [22, "index-2"], [23, "index-2"], [24, "index-2"], [25, "index-2"], [26, "index-2"], [27, "index-3"], [28, "index-3"], [29, "index-2"], [48, "index-27"], [53, "index-5"], [87, "index-30"], [88, "index-5"], [97, "index-2"], [103, "index-14"], [104, "index-14"], [107, "index-16"]], "type (field)": [[2, "index-24"], [2, "index-30"], [3, "index-6"], [6, "index-5"], [8, "index-6"], [10, "index-5"], [11, "index-48"], [12, "index-6"], [14, "index-8"], [15, "index-7"], [18, "index-6"], [19, "index-6"], [24, "index-6"], [25, "index-6"], [26, "index-4"], [27, "index-6"], [29, "index-5"], [38, "index-5"], [42, "index-4"], [45, "index-4"], [46, "index-5"], [49, "index-45"], [52, "index-4"], [54, "index-4"], [56, "index-4"], [58, "index-4"], [63, "index-4"], [66, "index-4"], [67, "index-5"], [68, "index-12"], [70, "index-5"], [77, "index-4"], [82, "index-25"], [84, "index-9"], [87, "index-7"], [92, "index-4"], [97, "index-9"], [103, "index-52"], [103, "index-74"], [103, "index-82"], [104, "index-52"], [104, "index-75"], [104, "index-83"]], "used in application definition": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"]], "version (field attribute)": [[2, "index-17"], [17, "index-4"], [53, "index-12"], [53, "index-15"], [53, "index-19"], [53, "index-27"], [88, "index-12"], [88, "index-15"], [88, "index-23"]], "nxarpes": [[3, "index-0"]], "nxarpes (application definition)": [[3, "index-0"]], "nxdata (base class)": [[3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [34, "index-1"], [35, "index-1"], [39, "index-1"], [41, "index-1"], [42, "index-1"], [46, "index-1"], [48, "index-0"], [49, "index-1"], [53, "index-1"], [57, "index-1"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [66, "index-1"], [67, "index-1"], [69, "index-1"], [82, "index-1"], [83, "index-1"], [87, "index-1"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [114, "index-42"], [133, "index-11"], [133, "index-7"]], "nxdetector (base class)": [[3, "index-1"], [4, "index-2"], [6, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [27, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [49, "index-0"], [64, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [133, "index-7"]], "nxmonochromator (base class)": [[3, "index-1"], [6, "index-1"], [7, "index-1"], [12, "index-1"], [14, "index-1"], [19, "index-1"], [27, "index-1"], [29, "index-1"], [64, "index-1"], [69, "index-0"]], "acquisition_mode (field)": [[3, "index-12"], [49, "index-59"]], "angles (field)": [[3, "index-18"], [61, "index-4"]], "arpes (application definition)": [[3, "index-0"], [3, "index-0"]], "data (field)": [[3, "index-10"], [6, "index-14"], [6, "index-9"], [8, "index-13"], [9, "index-16"], [9, "index-5"], [10, "index-10"], [11, "index-20"], [11, "index-8"], [12, "index-10"], [12, "index-16"], [13, "index-20"], [13, "index-8"], [14, "index-15"], [15, "index-12"], [15, "index-27"], [16, "index-6"], [16, "index-8"], [17, "index-13"], [18, "index-13"], [19, "index-10"], [19, "index-11"], [19, "index-12"], [19, "index-13"], [19, "index-16"], [19, "index-20"], [20, "index-12"], [20, "index-27"], [21, "index-17"], [21, "index-7"], [22, "index-20"], [22, "index-9"], [23, "index-18"], [23, "index-8"], [24, "index-21"], [24, "index-9"], [25, "index-11"], [25, "index-13"], [25, "index-9"], [26, "index-12"], [27, "index-10"], [27, "index-11"], [27, "index-15"], [28, "index-11"], [29, "index-9"], [32, "index-3"], [48, "index-18"], [49, "index-11"], [62, "index-23"], [68, "index-15"], [70, "index-9"], [97, "index-26"], [97, "index-38"], [103, "index-90"], [104, "index-54"], [104, "index-91"], [107, "index-27"], [107, "index-33"]], "energies (field)": [[3, "index-19"]], "energy (field)": [[3, "index-9"], [5, "index-6"], [5, "index-8"], [6, "index-10"], [7, "index-5"], [17, "index-15"], [17, "index-17"], [19, "index-17"], [19, "index-9"], [27, "index-9"], [28, "index-10"], [56, "index-14"], [63, "index-13"], [69, "index-8"], [87, "index-15"], [97, "index-10"], [97, "index-7"]], "entrance_slit_setting (field)": [[3, "index-14"]], "entrance_slit_shape (field)": [[3, "index-13"]], "entrance_slit_size (field)": [[3, "index-15"]], "entry (group attribute)": [[3, "index-2"], [8, "index-2"], [14, "index-2"], [15, "index-2"], [18, "index-2"], [27, "index-2"], [28, "index-2"]], "lens_mode (field)": [[3, "index-11"]], "pass_energy (field)": [[3, "index-16"]], "region_origin (field)": [[3, "index-21"]], "region_size (field)": [[3, "index-22"]], "sensor_size (field)": [[3, "index-20"]], "time_per_channel (field)": [[3, "index-17"], [11, "index-22"]], "i": [[4, "index-28"]], "i (field)": [[4, "index-27"]], "i_axes (group attribute)": [[4, "index-15"]], "idev": [[4, "index-33"]], "idev (field)": [[4, "index-32"]], "mask_indices (group attribute)": [[4, "index-18"]], "nxaperture (base class)": [[4, "index-2"], [37, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxcansas": [[4, "index-0"]], "nxcansas (application definition)": [[4, "index-0"]], "nxcansas (applications)": [[4, "index-102"], [4, "index-104"], [4, "index-106"], [4, "index-115"], [4, "index-13"], [4, "index-21"], [4, "index-25"], [4, "index-28"], [4, "index-3"], [4, "index-33"], [4, "index-36"], [4, "index-39"], [4, "index-42"], [4, "index-48"], [4, "index-50"], [4, "index-55"], [4, "index-59"], [4, "index-73"], [4, "index-84"], [4, "index-96"]], "nxcollection (base class)": [[4, "index-2"], [11, "index-1"], [17, "index-1"], [44, "index-0"], [49, "index-1"], [53, "index-1"], [64, "index-1"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"]], "nxcollimator (base class)": [[4, "index-2"], [14, "index-1"], [15, "index-1"], [45, "index-0"], [64, "index-1"]], "nxnote (base class)": [[4, "index-2"], [37, "index-1"], [49, "index-1"], [53, "index-1"], [54, "index-1"], [70, "index-0"], [79, "index-1"], [87, "index-1"], [88, "index-1"], [93, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "nxprocess (base class)": [[4, "index-2"], [8, "index-1"], [18, "index-1"], [26, "index-1"], [28, "index-1"], [53, "index-1"], [79, "index-0"], [88, "index-1"]], "q": [[4, "index-21"]], "q (field)": [[4, "index-20"], [107, "index-20"]], "q_indices (group attribute)": [[4, "index-16"]], "qdev": [[4, "index-36"]], "qdev (field)": [[4, "index-35"]], "qmean (field)": [[4, "index-44"]], "sasaperture": [[4, "index-50"]], "sascollimation": [[4, "index-55"]], "sasdata": [[4, "index-13"]], "sasdetector": [[4, "index-59"]], "sasentry": [[4, "index-3"]], "sasinstrument": [[4, "index-48"]], "sasnote": [[4, "index-104"]], "sasprocess": [[4, "index-96"]], "sasprocessnote": [[4, "index-102"]], "sassample": [[4, "index-84"]], "sassource": [[4, "index-73"]], "sastransmission_spectrum": [[4, "index-106"]], "sdd (field)": [[4, "index-61"]], "shadowfactor (field)": [[4, "index-46"]], "t (field)": [[4, "index-112"]], "t_axes (group attribute)": [[4, "index-108"]], "tdev": [[4, "index-115"]], "tdev (field)": [[4, "index-114"]], "beam_center_x (field)": [[4, "index-68"], [11, "index-28"], [14, "index-23"], [15, "index-21"], [35, "index-4"], [49, "index-55"], [97, "index-33"]], "beam_center_y (field)": [[4, "index-69"], [11, "index-29"], [14, "index-24"], [15, "index-22"], [35, "index-5"], [49, "index-56"], [97, "index-35"]], "beam_shape (field)": [[4, "index-76"]], "beam_size_x (field)": [[4, "index-81"]], "beam_size_y (field)": [[4, "index-82"]], "cansas": [[4, "index-1"]], "cansas (application definition)": [[4, "index-0"], [4, "index-0"]], "cansas_class (group attribute)": [[4, "index-101"], [4, "index-103"], [4, "index-105"], [4, "index-12"], [4, "index-47"], [4, "index-49"], [4, "index-54"], [4, "index-58"], [4, "index-6"], [4, "index-72"], [4, "index-83"], [4, "index-95"]], "dql": [[4, "index-42"]], "dql (field)": [[4, "index-41"]], "dqw": [[4, "index-39"]], "dqw (field)": [[4, "index-38"]], "date (field)": [[4, "index-98"], [26, "index-10"], [28, "index-8"], [70, "index-4"], [79, "index-7"], [103, "index-41"], [104, "index-41"], [107, "index-18"]], "default (group attribute)": [[4, "index-4"], [107, "index-12"]], "deprecated": [[4, "index-75"], [11, "index-69"], [37, "index-7"], [40, "index-11"], [41, "index-15"], [45, "index-14"], [46, "index-43"], [49, "index-83"], [52, "index-21"], [53, "index-18"], [56, "index-18"], [57, "index-25"], [60, "index-1"], [62, "index-18"], [63, "index-17"], [65, "index-11"], [66, "index-24"], [67, "index-12"], [68, "index-19"], [69, "index-10"], [69, "index-13"], [69, "index-6"], [82, "index-46"], [82, "index-47"], [82, "index-48"], [84, "index-18"], [87, "index-31"], [92, "index-17"], [103, "index-19"], [103, "index-29"], [104, "index-19"], [104, "index-29"], [107, "index-11"]], "details (field)": [[4, "index-89"]], "distance (field)": [[4, "index-57"], [7, "index-7"], [9, "index-9"], [11, "index-23"], [13, "index-10"], [13, "index-7"], [14, "index-16"], [15, "index-14"], [17, "index-12"], [21, "index-16"], [21, "index-9"], [22, "index-11"], [22, "index-19"], [23, "index-17"], [23, "index-9"], [24, "index-13"], [25, "index-17"], [29, "index-13"], [29, "index-21"], [38, "index-4"], [39, "index-4"], [49, "index-27"], [52, "index-18"], [56, "index-12"], [67, "index-4"], [68, "index-8"], [82, "index-44"], [87, "index-4"], [97, "index-31"], [103, "index-55"], [103, "index-69"], [103, "index-70"], [103, "index-72"], [103, "index-80"], [103, "index-81"], [103, "index-89"], [103, "index-91"], [104, "index-58"], [104, "index-69"], [104, "index-70"], [104, "index-71"], [104, "index-73"], [104, "index-81"], [104, "index-82"], [104, "index-90"], [104, "index-92"]], "incident_wavelength (field)": [[4, "index-77"], [11, "index-67"], [39, "index-8"]], "incident_wavelength_spread (field)": [[4, "index-80"], [11, "index-71"], [39, "index-9"]], "lambda (field)": [[4, "index-111"]], "length (field)": [[4, "index-56"], [63, "index-11"], [92, "index-8"]], "mask (group attribute)": [[4, "index-17"]], "name (field attribute)": [[4, "index-11"]], "name (group attribute)": [[4, "index-109"]], "pitch (field)": [[4, "index-66"], [4, "index-93"]], "plotting": [[4, "index-5"], [37, "index-3"], [38, "index-3"], [39, "index-3"], [40, "index-3"], [41, "index-3"], [42, "index-3"], [43, "index-2"], [45, "index-3"], [46, "index-3"], [47, "index-2"], [48, "index-1"], [48, "index-19"], [48, "index-21"], [48, "index-5"], [48, "index-7"], [48, "index-9"], [49, "index-3"], [50, "index-2"], [51, "index-2"], [52, "index-3"], [53, "index-3"], [55, "index-2"], [56, "index-3"], [57, "index-3"], [58, "index-3"], [59, "index-3"], [60, "index-4"], [61, "index-3"], [62, "index-3"], [63, "index-3"], [64, "index-3"], [65, "index-2"], [66, "index-3"], [67, "index-3"], [68, "index-3"], [69, "index-3"], [70, "index-2"], [72, "index-2"], [73, "index-3"], [74, "index-2"], [76, "index-3"], [77, "index-3"], [78, "index-3"], [79, "index-3"], [80, "index-3"], [81, "index-14"], [82, "index-3"], [83, "index-3"], [84, "index-3"], [85, "index-2"], [86, "index-3"], [87, "index-3"], [88, "index-3"], [89, "index-2"], [90, "index-3"], [91, "index-2"], [92, "index-3"], [93, "index-3"], [107, "index-13"], [107, "index-3"], [114, "index-28"], [114, "index-44"], [116, "index-22"], [116, "index-23"], [116, "index-24"], [116, "index-24"], [116, "index-7"], [116, "index-9"], [127, "index-4"], [133, "index-12"], [133, "index-7"], [134, "index-4"], [137, "index-0"], [137, "index-5"], [151, "index-4"], [154, "index-11"]], "radiation (field)": [[4, "index-74"]], "resolutions": [[4, "index-25"]], "resolutions (field attribute)": [[4, "index-24"]], "resolutions_description (field attribute)": [[4, "index-26"]], "roll (field)": [[4, "index-65"], [4, "index-92"]], "run (field)": [[4, "index-10"]], "scaling_factor (field attribute)": [[4, "index-31"], [65, "index-18"], [65, "index-5"]], "shape (field)": [[4, "index-51"], [14, "index-13"], [15, "index-10"], [85, "index-3"], [103, "index-67"], [103, "index-78"], [103, "index-87"], [104, "index-67"], [104, "index-79"], [104, "index-88"]], "signal (group attribute)": [[4, "index-107"], [4, "index-14"], [49, "index-84"], [62, "index-19"], [97, "index-21"], [97, "index-40"], [107, "index-30"]], "slit_length (field)": [[4, "index-62"]], "term (field)": [[4, "index-100"], [74, "index-3"]], "thickness (field)": [[4, "index-86"], [38, "index-6"], [46, "index-23"], [57, "index-7"], [58, "index-11"], [82, "index-39"]], "timestamp (group attribute)": [[4, "index-110"], [4, "index-19"]], "transmission (field)": [[4, "index-87"]], "uncertainties (field attribute)": [[4, "index-113"], [4, "index-23"], [4, "index-30"]], "units (field attribute)": [[4, "index-22"], [4, "index-29"], [4, "index-34"], [4, "index-37"], [4, "index-40"], [4, "index-43"], [4, "index-45"], [74, "index-4"], [97, "index-11"], [97, "index-13"], [97, "index-15"], [97, "index-17"], [97, "index-19"], [97, "index-23"], [97, "index-28"], [97, "index-30"], [97, "index-32"], [97, "index-34"], [97, "index-36"], [107, "index-26"], [107, "index-35"]], "version (group attribute)": [[4, "index-7"], [11, "index-2"]], "wavelength_max (field)": [[4, "index-79"]], "wavelength_min (field)": [[4, "index-78"]], "x_gap (field)": [[4, "index-52"], [86, "index-5"]], "x_pixel_size (field)": [[4, "index-70"], [9, "index-7"], [13, "index-12"], [14, "index-17"], [15, "index-15"], [24, "index-11"], [25, "index-15"], [29, "index-11"], [49, "index-34"], [97, "index-27"]], "x_position (field)": [[4, "index-63"], [4, "index-90"]], "y_gap (field)": [[4, "index-53"], [86, "index-6"]], "y_pixel_size (field)": [[4, "index-71"], [9, "index-8"], [13, "index-13"], [14, "index-18"], [15, "index-16"], [24, "index-12"], [25, "index-16"], [29, "index-12"], [49, "index-35"], [97, "index-29"]], "y_position (field)": [[4, "index-64"], [4, "index-91"]], "yaw (field)": [[4, "index-67"], [4, "index-94"]], "nxdirecttof": [[5, "index-0"]], "nxdirecttof (application definition)": [[5, "index-0"]], "nxdisk_chopper (base class)": [[5, "index-1"], [13, "index-1"], [52, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxfermi_chopper (base class)": [[5, "index-1"], [17, "index-1"], [56, "index-0"], [64, "index-1"], [104, "index-1"]], "directtof (application definition)": [[5, "index-0"], [5, "index-0"]], "rotation_speed (field)": [[5, "index-5"], [5, "index-7"], [52, "index-5"], [56, "index-5"], [92, "index-5"]], "nxfluo": [[6, "index-0"]], "nxfluo (application definition)": [[6, "index-0"]], "nxmonitor (base class)": [[6, "index-1"], [9, "index-1"], [10, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [27, "index-1"], [29, "index-1"], [53, "index-1"], [68, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-7"]], "fluo (application definition)": [[6, "index-0"], [6, "index-0"]], "mode (field)": [[6, "index-12"], [9, "index-14"], [10, "index-13"], [12, "index-14"], [13, "index-16"], [14, "index-27"], [15, "index-25"], [20, "index-25"], [21, "index-14"], [22, "index-17"], [23, "index-15"], [27, "index-13"], [29, "index-22"], [68, "index-4"], [87, "index-25"], [103, "index-92"], [104, "index-93"], [107, "index-24"]], "preset (field)": [[6, "index-13"], [9, "index-15"], [10, "index-14"], [12, "index-15"], [13, "index-17"], [14, "index-28"], [15, "index-26"], [20, "index-26"], [21, "index-15"], [22, "index-18"], [23, "index-16"], [27, "index-14"], [29, "index-23"], [68, "index-7"], [107, "index-25"]], "wavelength (field)": [[6, "index-8"], [10, "index-8"], [12, "index-9"], [14, "index-11"], [29, "index-8"], [32, "index-4"], [46, "index-19"], [49, "index-88"], [56, "index-13"], [62, "index-25"], [69, "index-4"], [92, "index-14"], [103, "index-83"], [104, "index-84"]], "nxindirecttof": [[7, "index-0"]], "nxindirecttof (application definition)": [[7, "index-0"]], "indirecttof (application definition)": [[7, "index-0"], [7, "index-0"]], "polar_angle (field)": [[7, "index-6"], [9, "index-3"], [10, "index-9"], [12, "index-11"], [13, "index-11"], [14, "index-19"], [15, "index-17"], [20, "index-11"], [20, "index-13"], [20, "index-20"], [21, "index-11"], [22, "index-13"], [23, "index-11"], [30, "index-5"], [31, "index-3"], [34, "index-3"], [35, "index-3"], [46, "index-37"], [49, "index-28"], [80, "index-95"], [103, "index-60"], [104, "index-60"]], "nxiqproc": [[8, "index-0"]], "nxiqproc (application definition)": [[8, "index-0"]], "nxparameters (base class)": [[8, "index-1"], [18, "index-1"], [26, "index-1"], [28, "index-1"], [53, "index-1"], [74, "index-0"], [88, "index-1"]], "filenames (field)": [[8, "index-12"], [18, "index-12"]], "iqproc (application definition)": [[8, "index-0"], [8, "index-0"]], "qx (field)": [[8, "index-16"], [18, "index-14"]], "qy (field)": [[8, "index-17"], [18, "index-15"]], "variable (field)": [[8, "index-14"], [48, "index-11"]], "varied_variable (field attribute)": [[8, "index-15"]], "version (field)": [[8, "index-11"], [18, "index-11"], [26, "index-9"], [28, "index-7"], [79, "index-6"], [103, "index-43"], [104, "index-43"]], "nxlauetof": [[9, "index-0"]], "nxlauetof (application definition)": [[9, "index-0"]], "azimuthal_angle (field)": [[9, "index-4"], [14, "index-20"], [15, "index-18"], [21, "index-12"], [22, "index-14"], [23, "index-12"], [46, "index-38"], [49, "index-29"], [80, "index-97"], [103, "index-53"], [104, "index-53"]], "lauetof (application definition)": [[9, "index-0"], [9, "index-0"]], "orientation_matrix (field)": [[9, "index-12"], [20, "index-24"], [29, "index-16"], [46, "index-18"], [57, "index-17"], [82, "index-20"], [83, "index-10"], [107, "index-45"]], "signal (field attribute)": [[9, "index-6"], [29, "index-10"], [48, "index-20"]], "time_of_flight (field)": [[9, "index-10"], [9, "index-17"], [13, "index-19"], [13, "index-9"], [15, "index-13"], [15, "index-28"], [21, "index-10"], [21, "index-18"], [22, "index-12"], [22, "index-21"], [23, "index-10"], [23, "index-19"], [49, "index-4"], [68, "index-13"], [103, "index-93"], [104, "index-61"], [104, "index-94"]], "unit_cell (field)": [[9, "index-13"], [20, "index-23"], [29, "index-17"], [46, "index-10"], [82, "index-17"]], "nxcrystal (base class)": [[10, "index-1"], [20, "index-1"], [46, "index-0"], [64, "index-1"], [69, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "nxmonopd": [[10, "index-0"]], "nxmonopd (application definition)": [[10, "index-0"]], "integral (field)": [[10, "index-15"], [13, "index-18"], [14, "index-29"], [25, "index-23"], [29, "index-24"], [68, "index-11"]], "monopd (application definition)": [[10, "index-0"], [10, "index-0"]], "rotation_angle (field)": [[10, "index-12"], [12, "index-13"], [13, "index-15"], [14, "index-21"], [15, "index-19"], [16, "index-7"], [17, "index-18"], [19, "index-14"], [20, "index-10"], [20, "index-19"], [20, "index-8"], [24, "index-17"], [25, "index-19"], [30, "index-6"], [31, "index-4"], [34, "index-5"], [35, "index-7"], [82, "index-42"]], "nxattenuator (base class)": [[11, "index-1"], [35, "index-1"], [38, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxbeam (base class)": [[11, "index-1"], [39, "index-0"], [64, "index-1"], [82, "index-1"], [95, "index-1"], [97, "index-1"]], "nxdetector_group (base class)": [[11, "index-1"], [50, "index-0"], [64, "index-1"]], "nxdetector_module (base class)": [[11, "index-1"], [49, "index-1"], [51, "index-0"]], "nxmx": [[11, "index-0"]], "nxmx (application definition)": [[11, "index-0"]], "nxtransformations (base class)": [[11, "index-1"], [37, "index-1"], [38, "index-1"], [40, "index-1"], [41, "index-1"], [42, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [56, "index-1"], [57, "index-1"], [58, "index-1"], [59, "index-1"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [64, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [76, "index-1"], [77, "index-1"], [78, "index-1"], [82, "index-1"], [84, "index-1"], [86, "index-1"], [87, "index-1"], [89, "index-0"], [92, "index-1"], [93, "index-1"], [95, "index-1"], [97, "index-1"]], "angular_calibration (field)": [[11, "index-31"], [49, "index-61"]], "angular_calibration_applied (field)": [[11, "index-30"], [49, "index-60"]], "attenuator_transmission (field)": [[11, "index-15"], [35, "index-6"], [38, "index-9"]], "beam_center_derived (field)": [[11, "index-27"]], "bit_depth_readout (field)": [[11, "index-39"], [49, "index-68"]], "count_time (field)": [[11, "index-26"], [49, "index-53"], [68, "index-17"], [107, "index-28"]], "countrate_correction_applied (field)": [[11, "index-38"], [49, "index-67"]], "data_origin (field)": [[11, "index-49"], [51, "index-3"]], "data_size (field)": [[11, "index-50"], [51, "index-4"]], "data_stride (field)": [[11, "index-51"]], "dead_time (field)": [[11, "index-25"], [49, "index-36"]], "depends_on (field attribute)": [[11, "index-56"], [11, "index-61"], [11, "index-66"], [51, "index-10"], [51, "index-17"], [51, "index-24"], [89, "index-8"]], "depends_on (field)": [[11, "index-10"], [11, "index-19"], [37, "index-4"], [38, "index-12"], [40, "index-10"], [41, "index-14"], [42, "index-10"], [45, "index-13"], [46, "index-42"], [49, "index-82"], [52, "index-20"], [56, "index-17"], [57, "index-24"], [58, "index-12"], [59, "index-18"], [61, "index-18"], [62, "index-17"], [63, "index-16"], [66, "index-23"], [67, "index-11"], [68, "index-18"], [69, "index-12"], [76, "index-4"], [77, "index-8"], [78, "index-15"], [82, "index-45"], [84, "index-17"], [86, "index-4"], [87, "index-29"], [92, "index-16"], [93, "index-16"], [100, "index-3"]], "detector_readout_time (field)": [[11, "index-40"], [49, "index-69"]], "distance_derived (field)": [[11, "index-24"]], "end_time_estimated (field)": [[11, "index-6"]], "fast_pixel_direction (field)": [[11, "index-57"], [51, "index-11"]], "flatfield (field)": [[11, "index-33"], [49, "index-63"]], "flatfield_applied (field)": [[11, "index-32"], [49, "index-62"]], "flatfield_error (field)": [[11, "index-34"]], "flatfield_errors (field)": [[11, "index-35"], [49, "index-64"]], "flux (field)": [[11, "index-72"], [39, "index-17"], [87, "index-14"]], "frame_time (field)": [[11, "index-41"], [49, "index-74"]], "gain_setting (field)": [[11, "index-42"], [49, "index-75"]], "group_index (field)": [[11, "index-17"], [50, "index-4"]], "group_names (field)": [[11, "index-16"], [50, "index-3"]], "group_parent (field)": [[11, "index-18"], [50, "index-5"]], "incident_beam_size (field)": [[11, "index-74"]], "incident_polarisation_stokes (field)": [[11, "index-76"]], "incident_wavelength_weight (field)": [[11, "index-68"]], "incident_wavelength_weights (field)": [[11, "index-70"]], "module_offset (field)": [[11, "index-52"], [51, "index-5"]], "mx (application definition)": [[11, "index-0"], [11, "index-0"]], "offset (field attribute)": [[11, "index-55"], [11, "index-60"], [11, "index-65"], [26, "index-14"], [51, "index-15"], [51, "index-22"], [51, "index-8"], [55, "index-6"], [89, "index-6"], [116, "index-31"], [116, "index-34"]], "pixel_mask (field)": [[11, "index-37"], [49, "index-66"]], "pixel_mask_applied (field)": [[11, "index-36"], [49, "index-65"]], "profile (field)": [[11, "index-75"]], "saturation_value (field)": [[11, "index-43"], [49, "index-76"]], "sensor_material (field)": [[11, "index-45"], [49, "index-79"]], "sensor_thickness (field)": [[11, "index-46"], [49, "index-80"]], "short_name (field attribute)": [[11, "index-13"], [11, "index-78"], [64, "index-5"], [87, "index-6"]], "slow_pixel_direction (field)": [[11, "index-62"], [51, "index-18"]], "threshold_energy (field)": [[11, "index-47"], [49, "index-81"]], "time_zone (field)": [[11, "index-14"]], "total_flux (field)": [[11, "index-73"]], "transformation_type (field attribute)": [[11, "index-53"], [11, "index-58"], [11, "index-63"], [51, "index-13"], [51, "index-20"], [51, "index-6"], [89, "index-4"]], "underload_value (field)": [[11, "index-44"], [49, "index-77"]], "vector (field attribute)": [[11, "index-54"], [11, "index-59"], [11, "index-64"], [51, "index-14"], [51, "index-21"], [51, "index-7"], [89, "index-5"], [97, "index-45"], [116, "index-33"]], "nxrefscan": [[12, "index-0"]], "nxrefscan (application definition)": [[12, "index-0"]], "refscan (application definition)": [[12, "index-0"], [12, "index-0"]], "nxreftof": [[13, "index-0"]], "nxreftof (application definition)": [[13, "index-0"]], "reftof (application definition)": [[13, "index-0"], [13, "index-0"]], "nxgeometry (base class)": [[14, "index-1"], [15, "index-1"], [37, "index-1"], [40, "index-1"], [41, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [54, "index-1"], [56, "index-1"], [57, "index-1"], [60, "index-0"], [62, "index-1"], [63, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [73, "index-1"], [82, "index-1"], [84, "index-1"], [87, "index-1"], [90, "index-1"], [92, "index-1"], [103, "index-1"], [104, "index-1"]], "nxsas": [[14, "index-0"], [130, "index-0"]], "nxsas (application definition)": [[14, "index-0"]], "nxshape (base class)": [[14, "index-1"], [15, "index-1"], [46, "index-1"], [60, "index-2"], [61, "index-1"], [66, "index-1"], [85, "index-0"], [95, "index-1"], [103, "index-1"], [104, "index-1"]], "aequatorial_angle (field)": [[14, "index-22"], [14, "index-26"], [15, "index-20"], [15, "index-24"]], "sas (application definition)": [[14, "index-0"], [14, "index-0"]], "size (field)": [[14, "index-14"], [15, "index-11"], [40, "index-5"], [85, "index-4"], [103, "index-68"], [103, "index-79"], [103, "index-88"], [104, "index-68"], [104, "index-80"], [104, "index-89"]], "wavelength_spread (field)": [[14, "index-12"], [92, "index-15"]], "nxsastof": [[15, "index-0"]], "nxsastof (application definition)": [[15, "index-0"]], "sastof (application definition)": [[15, "index-0"], [15, "index-0"]], "nxscan": [[16, "index-0"]], "nxscan (application definition)": [[16, "index-0"]], "scan (application definition)": [[16, "index-0"], [16, "index-0"]], "nxspe": [[17, "index-0"]], "nxspe (application definition)": [[17, "index-0"]], "azimuthal (field)": [[17, "index-8"]], "azimuthal_width (field)": [[17, "index-9"]], "error (field)": [[17, "index-14"]], "fixed_energy (field)": [[17, "index-5"]], "ki_over_kf_scaling (field)": [[17, "index-6"]], "polar (field)": [[17, "index-10"]], "polar_width (field)": [[17, "index-11"]], "program_name (field)": [[17, "index-2"], [53, "index-26"], [88, "index-22"]], "psi (field)": [[17, "index-7"]], "seblock (field)": [[17, "index-19"]], "spe (application definition)": [[17, "index-0"], [17, "index-0"]], "nxsqom": [[18, "index-0"]], "nxsqom (application definition)": [[18, "index-0"]], "en (field)": [[18, "index-17"], [20, "index-18"]], "qz (field)": [[18, "index-16"]], "sqom (application definition)": [[18, "index-0"], [18, "index-0"]], "nxstxm": [[19, "index-0"]], "nxstxm (application definition)": [[19, "index-0"]], "sample_x (field)": [[19, "index-19"]], "sample_y (field)": [[19, "index-18"]], "stxm (application definition)": [[19, "index-0"], [19, "index-0"]], "stxm_scan_type (field)": [[19, "index-15"]], "nxtas": [[20, "index-0"]], "nxtas (application definition)": [[20, "index-0"]], "ef (field)": [[20, "index-9"]], "ei (field)": [[20, "index-7"]], "qh (field)": [[20, "index-15"]], "qk (field)": [[20, "index-16"]], "ql (field)": [[20, "index-17"]], "sgl (field)": [[20, "index-22"]], "sgu (field)": [[20, "index-21"]], "tas (application definition)": [[20, "index-0"], [20, "index-0"]], "nxtofnpd": [[21, "index-0"]], "nxtofnpd (application definition)": [[21, "index-0"]], "detector_number (field)": [[21, "index-8"], [22, "index-10"], [47, "index-5"], [49, "index-10"]], "pre_sample_flightpath (field)": [[21, "index-5"], [22, "index-7"], [23, "index-6"], [53, "index-31"], [88, "index-27"]], "tofnpd (application definition)": [[21, "index-0"], [21, "index-0"]], "nxtofraw": [[22, "index-0"]], "nxtofraw (application definition)": [[22, "index-0"]], "integral_counts (field)": [[22, "index-22"]], "nature (field)": [[22, "index-16"], [23, "index-14"], [103, "index-98"], [104, "index-99"]], "run_number (field)": [[22, "index-6"], [103, "index-12"], [104, "index-12"]], "tofraw (application definition)": [[22, "index-0"], [22, "index-0"]], "nxtofsingle": [[23, "index-0"]], "nxtofsingle (application definition)": [[23, "index-0"]], "tofsingle (application definition)": [[23, "index-0"], [23, "index-0"]], "nxtomo": [[24, "index-0"]], "nxtomo (application definition)": [[24, "index-0"]], "image_key (field)": [[24, "index-10"]], "tomo (application definition)": [[24, "index-0"], [24, "index-0"]], "x_rotation_axis_pixel_position (field)": [[24, "index-14"]], "x_translation (field)": [[24, "index-18"], [25, "index-20"], [29, "index-19"], [82, "index-43"]], "y_rotation_axis_pixel_position (field)": [[24, "index-15"]], "y_translation (field)": [[24, "index-19"], [25, "index-21"], [29, "index-20"]], "z_translation (field)": [[24, "index-20"], [25, "index-22"]], "nxtomophase": [[25, "index-0"]], "nxtomophase (application definition)": [[25, "index-0"]], "sequence_number (field)": [[25, "index-10"], [25, "index-12"], [25, "index-14"], [49, "index-54"]], "tomophase (application definition)": [[25, "index-0"], [25, "index-0"]], "nxtomoproc": [[26, "index-0"]], "nxtomoproc (application definition)": [[26, "index-0"]], "raw_file (field)": [[26, "index-11"], [28, "index-9"]], "scaling (field attribute)": [[26, "index-15"]], "tomoproc (application definition)": [[26, "index-0"], [26, "index-0"]], "transform (field attribute)": [[26, "index-13"]], "x (field)": [[26, "index-16"], [40, "index-6"], [48, "index-28"]], "y (field)": [[26, "index-17"], [40, "index-7"], [48, "index-29"]], "z (field)": [[26, "index-18"], [48, "index-30"]], "nxxas": [[27, "index-0"]], "nxxas (application definition)": [[27, "index-0"]], "xas (application definition)": [[27, "index-0"], [27, "index-0"]], "nxxasproc": [[28, "index-0"]], "nxxasproc (application definition)": [[28, "index-0"]], "xasproc (application definition)": [[28, "index-0"], [28, "index-0"]], "nxxbase": [[29, "index-0"]], "nxxbase (application definition)": [[29, "index-0"]], "frame_start_number (field)": [[29, "index-14"], [49, "index-57"]], "xbase (application definition)": [[29, "index-0"], [29, "index-0"]], "nxxeuler": [[30, "index-0"]], "nxxeuler (application definition)": [[30, "index-0"]], "chi (field)": [[30, "index-7"]], "eulerian cradle": [[30, "index-2"], [36, "index-2"], [116, "index-36"]], "four-circle diffractometer": [[30, "index-1"], [36, "index-1"], [116, "index-37"], [151, "index-5"]], "phi (field)": [[30, "index-8"], [31, "index-6"]], "xeuler (application definition)": [[30, "index-0"], [30, "index-0"]], "nxxkappa": [[31, "index-0"]], "nxxkappa (application definition)": [[31, "index-0"]], "alpha (field)": [[31, "index-7"]], "kappa (field)": [[31, "index-5"]], "xkappa (application definition)": [[31, "index-0"], [31, "index-0"]], "nxxlaue": [[32, "index-0"]], "nxxlaue (application definition)": [[32, "index-0"]], "xlaue (application definition)": [[32, "index-0"], [32, "index-0"]], "nxxlaueplate": [[33, "index-0"]], "nxxlaueplate (application definition)": [[33, "index-0"]], "diameter (field)": [[33, "index-3"], [49, "index-58"], [76, "index-5"]], "xlaueplate (application definition)": [[33, "index-0"], [33, "index-0"]], "nxxnb": [[34, "index-0"]], "nxxnb (application definition)": [[34, "index-0"]], "tilt_angle (field)": [[34, "index-4"]], "xnb (application definition)": [[34, "index-0"], [34, "index-0"]], "nxxrot": [[35, "index-0"]], "nxxrot (application definition)": [[35, "index-0"]], "rotation_angle_step (field)": [[35, "index-8"]], "xrot (application definition)": [[35, "index-0"], [35, "index-0"]], "application definition": [[36, "index-0"]], "class definitions": [[36, "index-0"], [94, "index-0"], [109, "index-0"], [110, "index-0"]], "nxaperture": [[37, "index-0"]], "aperture (base class)": [[37, "index-0"], [37, "index-0"]], "default (file attribute)": [[37, "index-2"], [38, "index-2"], [39, "index-2"], [40, "index-2"], [41, "index-2"], [42, "index-2"], [43, "index-1"], [45, "index-2"], [46, "index-2"], [47, "index-1"], [49, "index-2"], [50, "index-1"], [51, "index-1"], [52, "index-2"], [53, "index-2"], [55, "index-1"], [56, "index-2"], [57, "index-2"], [58, "index-2"], [59, "index-2"], [60, "index-3"], [61, "index-2"], [62, "index-2"], [63, "index-2"], [64, "index-2"], [65, "index-1"], [66, "index-2"], [67, "index-2"], [68, "index-2"], [69, "index-2"], [70, "index-1"], [72, "index-1"], [73, "index-2"], [74, "index-1"], [76, "index-2"], [77, "index-2"], [78, "index-2"], [79, "index-2"], [80, "index-2"], [81, "index-13"], [82, "index-2"], [83, "index-2"], [84, "index-2"], [85, "index-1"], [86, "index-2"], [87, "index-2"], [88, "index-2"], [89, "index-1"], [90, "index-2"], [91, "index-1"], [92, "index-2"], [93, "index-2"], [107, "index-2"]], "material (field)": [[37, "index-5"]], "used in base class": [[37, "index-1"], [38, "index-1"], [39, "index-1"], [40, "index-1"], [41, "index-1"], [42, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [53, "index-1"], [54, "index-1"], [56, "index-1"], [57, "index-1"], [58, "index-1"], [59, "index-1"], [60, "index-2"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [64, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [73, "index-1"], [76, "index-1"], [77, "index-1"], [78, "index-1"], [79, "index-1"], [81, "index-1"], [82, "index-1"], [83, "index-1"], [84, "index-1"], [86, "index-1"], [87, "index-1"], [88, "index-1"], [90, "index-1"], [92, "index-1"], [93, "index-1"]], "nxattenuator": [[38, "index-0"]], "nxoff_geometry (base class)": [[38, "index-1"], [49, "index-1"], [72, "index-0"], [106, "index-1"]], "absorption_cross_section (field)": [[38, "index-8"]], "attenuator (base class)": [[38, "index-0"], [38, "index-0"]], "scattering_cross_section (field)": [[38, "index-7"]], "status (field)": [[38, "index-10"], [40, "index-9"], [57, "index-5"]], "time (field attribute)": [[38, "index-11"], [87, "index-28"]], "nxbeam": [[39, "index-0"]], "beam (base class)": [[39, "index-0"], [39, "index-0"]], "energy_transfer (field)": [[39, "index-7"]], "extent (field)": [[39, "index-11"], [97, "index-12"]], "final_beam_divergence (field)": [[39, "index-16"]], "final_energy (field)": [[39, "index-6"]], "final_polarization (field)": [[39, "index-14"]], "final_wavelength (field)": [[39, "index-12"]], "final_wavelength_spread (field)": [[39, "index-15"]], "incident_beam_divergence (field)": [[39, "index-10"], [97, "index-14"]], "incident_energy (field)": [[39, "index-5"]], "incident_polarization (field)": [[39, "index-13"]], "nxbeam_stop": [[40, "index-0"]], "nxbeam_stop (base class)": [[40, "index-0"], [64, "index-1"]], "beam_stop (base class)": [[40, "index-0"], [40, "index-0"]], "distance_to_detector (field)": [[40, "index-8"]], "nxbending_magnet": [[41, "index-0"]], "nxbending_magnet (base class)": [[41, "index-0"], [64, "index-1"]], "accepted_photon_beam_divergence (field)": [[41, "index-7"]], "bending_magnet (base class)": [[41, "index-0"], [41, "index-0"]], "bending_radius (field)": [[41, "index-5"]], "critical_energy (field)": [[41, "index-4"]], "divergence_x_minus (field)": [[41, "index-11"]], "divergence_x_plus (field)": [[41, "index-10"]], "divergence_y_minus (field)": [[41, "index-13"]], "divergence_y_plus (field)": [[41, "index-12"]], "source_distance_x (field)": [[41, "index-8"]], "source_distance_y (field)": [[41, "index-9"]], "nxcapillary": [[42, "index-0"]], "nxcapillary (base class)": [[42, "index-0"], [64, "index-1"]], "accepting_aperture (field)": [[42, "index-7"]], "capillary (base class)": [[42, "index-0"], [42, "index-0"]], "focal_size (field)": [[42, "index-9"]], "manufacturer (field)": [[42, "index-5"]], "maximum_incident_angle (field)": [[42, "index-6"]], "working_distance (field)": [[42, "index-8"]], "nxcite": [[43, "index-0"]], "nxcite (base class)": [[43, "index-0"]], "bibtex (field)": [[43, "index-7"]], "cite (base class)": [[43, "index-0"], [43, "index-0"]], "doi (field)": [[43, "index-5"]], "endnote (field)": [[43, "index-6"]], "url (field)": [[43, "index-4"]], "nxcollection": [[44, "index-0"]], "collection (base class)": [[44, "index-0"], [44, "index-0"]], "nxcollimator": [[45, "index-0"]], "nxlog (base class)": [[45, "index-1"], [46, "index-1"], [57, "index-1"], [65, "index-0"], [67, "index-1"], [68, "index-1"], [82, "index-1"], [84, "index-1"], [98, "index-1"], [99, "index-1"], [101, "index-1"], [102, "index-1"], [103, "index-1"], [104, "index-1"], [105, "index-1"], [108, "index-1"]], "absorbing_material (field)": [[45, "index-11"], [56, "index-15"]], "blade_spacing (field)": [[45, "index-10"]], "blade_thickness (field)": [[45, "index-9"]], "collimator (base class)": [[45, "index-0"], [45, "index-0"]], "divergence_x (field)": [[45, "index-6"]], "divergence_y (field)": [[45, "index-7"]], "frequency (field)": [[45, "index-8"], [87, "index-18"], [103, "index-49"], [104, "index-49"]], "soller_angle (field)": [[45, "index-5"]], "transmitting_material (field)": [[45, "index-12"], [56, "index-16"]], "nxcrystal": [[46, "index-0"]], "bragg_angle (field)": [[46, "index-39"]], "crystal (base class)": [[46, "index-0"], [46, "index-0"]], "curvature_horizontal (field)": [[46, "index-33"]], "curvature_vertical (field)": [[46, "index-34"]], "cut_angle (field)": [[46, "index-8"]], "cylindrical_orientation_angle (field)": [[46, "index-36"]], "d_spacing (field)": [[46, "index-20"]], "density (field)": [[46, "index-24"], [57, "index-8"], [82, "index-23"], [83, "index-12"], [95, "index-5"]], "is_cylindrical (field)": [[46, "index-35"]], "mosaic_horizontal (field)": [[46, "index-31"]], "mosaic_vertical (field)": [[46, "index-32"]], "order_no (field)": [[46, "index-7"]], "reflection (field)": [[46, "index-22"], [77, "index-6"]], "scattering_vector (field)": [[46, "index-21"]], "segment_columns (field)": [[46, "index-29"]], "segment_gap (field)": [[46, "index-28"]], "segment_height (field)": [[46, "index-26"]], "segment_rows (field)": [[46, "index-30"]], "segment_thickness (field)": [[46, "index-27"]], "segment_width (field)": [[46, "index-25"]], "space_group (field)": [[46, "index-9"], [82, "index-35"], [83, "index-18"]], "temperature_coefficient (field)": [[46, "index-41"]], "unit_cell_a (field)": [[46, "index-11"], [57, "index-10"]], "unit_cell_alpha (field)": [[46, "index-14"], [57, "index-13"]], "unit_cell_b (field)": [[46, "index-12"], [57, "index-11"]], "unit_cell_beta (field)": [[46, "index-15"], [57, "index-14"]], "unit_cell_c (field)": [[46, "index-13"], [57, "index-12"]], "unit_cell_gamma (field)": [[46, "index-16"], [57, "index-15"]], "unit_cell_volume (field)": [[46, "index-17"], [57, "index-16"], [82, "index-18"], [83, "index-8"]], "usage (field)": [[46, "index-4"]], "nxcylindrical_geometry": [[47, "index-0"]], "nxcylindrical_geometry (base class)": [[47, "index-0"], [49, "index-1"]], "cylinders (field)": [[47, "index-4"]], "cylindrical_geometry (base class)": [[47, "index-0"], [47, "index-0"]], "vertices (field)": [[47, "index-3"], [72, "index-3"]], "axisname_indices (file attribute)": [[48, "index-10"]], "nxdata": [[48, "index-0"]], "variable_errors (field)": [[48, "index-17"]], "auxiliary_signals (file attribute)": [[48, "index-4"]], "axes (attribute)": [[48, "index-3"], [114, "index-38"]], "axes (field attribute)": [[48, "index-22"], [97, "index-24"]], "axes (file attribute)": [[48, "index-8"]], "axis (field attribute)": [[48, "index-16"], [49, "index-16"], [49, "index-20"], [49, "index-24"], [49, "index-5"]], "data (base class)": [[48, "index-0"], [48, "index-0"]], "distribution (field attribute)": [[48, "index-13"]], "errors (field)": [[48, "index-24"]], "first_good (field attribute)": [[48, "index-14"]], "last_good (field attribute)": [[48, "index-15"]], "link": [[48, "index-2"], [110, "index-1"], [114, "index-36"], [116, "index-14"], [116, "index-16"], [116, "index-17"], [127, "index-6"], [133, "index-7"]], "long_name (field attribute)": [[48, "index-12"], [48, "index-23"], [49, "index-12"], [49, "index-18"], [49, "index-22"], [49, "index-26"], [49, "index-7"]], "offset (field)": [[48, "index-26"]], "scaling_factor (field)": [[48, "index-25"]], "signal (file attribute)": [[48, "index-6"]], "nxdetector": [[49, "index-0"]], "axes (group attribute)": [[49, "index-85"], [62, "index-20"], [97, "index-20"], [97, "index-39"], [107, "index-31"]], "calibration_date (field)": [[49, "index-51"]], "check_sum (field attribute)": [[49, "index-13"]], "crate (field)": [[49, "index-39"]], "data_errors (field)": [[49, "index-14"]], "detection_gas_path (field)": [[49, "index-38"]], "detector (base class)": [[49, "index-0"], [49, "index-0"]], "efficiency (field)": [[49, "index-87"], [68, "index-14"], [77, "index-7"]], "frequency (field attribute)": [[49, "index-9"]], "gas_pressure (field)": [[49, "index-37"], [93, "index-15"]], "input (field)": [[49, "index-43"]], "layout (field)": [[49, "index-52"]], "local_name (field attribute)": [[49, "index-40"], [49, "index-42"], [49, "index-44"]], "local_name (field)": [[49, "index-32"]], "number_of_cycles (field)": [[49, "index-78"]], "primary (field attribute)": [[49, "index-17"], [49, "index-21"], [49, "index-25"], [49, "index-6"]], "raw_time_of_flight (field)": [[49, "index-8"]], "real_time (field)": [[49, "index-46"]], "serial_number (field)": [[49, "index-31"]], "slot (field)": [[49, "index-41"]], "solid_angle (field)": [[49, "index-33"]], "start (field attribute)": [[49, "index-48"], [49, "index-50"], [52, "index-11"], [55, "index-10"], [65, "index-17"], [65, "index-4"]], "stop_time (field)": [[49, "index-49"]], "trigger_dead_time (field)": [[49, "index-73"]], "trigger_delay_time (field)": [[49, "index-70"]], "trigger_delay_time_set (field)": [[49, "index-71"]], "trigger_internal_delay_time (field)": [[49, "index-72"]], "wavelength_indices (group attribute)": [[49, "index-86"], [62, "index-22"]], "x_pixel_offset (field)": [[49, "index-15"], [103, "index-63"], [103, "index-75"], [104, "index-63"], [104, "index-76"]], "y_pixel_offset (field)": [[49, "index-19"], [103, "index-64"], [104, "index-64"]], "z_pixel_offset (field)": [[49, "index-23"]], "nxdetector_group": [[50, "index-0"]], "detector_group (base class)": [[50, "index-0"], [50, "index-0"]], "group_type (field)": [[50, "index-6"]], "nxdetector_module": [[51, "index-0"]], "detector_module (base class)": [[51, "index-0"], [51, "index-0"]], "dimension": [[51, "index-12"], [51, "index-19"], [114, "index-10"], [114, "index-11"], [114, "index-34"], [114, "index-35"], [114, "index-37"], [114, "index-39"], [114, "index-41"], [114, "index-43"], [114, "index-45"], [114, "index-8"], [114, "index-9"], [116, "index-11"]], "fastest varying": [[51, "index-12"], [114, "index-10"], [114, "index-41"]], "offset_units (field attribute)": [[51, "index-16"], [51, "index-23"], [51, "index-9"], [89, "index-7"]], "slowest varying": [[51, "index-19"], [114, "index-9"]], "nxdisk_chopper": [[52, "index-0"]], "beam_position (field)": [[52, "index-12"]], "delay (field)": [[52, "index-16"]], "disk_chopper (base class)": [[52, "index-0"], [52, "index-0"]], "pair_separation (field)": [[52, "index-8"]], "phase (field)": [[52, "index-15"], [63, "index-7"]], "radius (field)": [[52, "index-13"], [56, "index-6"], [92, "index-6"]], "ratio (field)": [[52, "index-17"]], "slit_angle (field)": [[52, "index-7"]], "slit_edges (field)": [[52, "index-9"]], "slit_height (field)": [[52, "index-14"]], "slits (field)": [[52, "index-6"]], "top_dead_center (field)": [[52, "index-10"]], "wavelength_range (field)": [[52, "index-19"]], "idf_version (file attribute)": [[53, "index-4"], [88, "index-4"]], "nxentry": [[53, "index-0"]], "nxsubentry (base class)": [[53, "index-1"], [88, "index-0"]], "url (field attribute)": [[53, "index-16"], [53, "index-20"], [88, "index-13"], [88, "index-16"]], "comment (field attribute)": [[53, "index-30"], [88, "index-26"]], "configuration (field attribute)": [[53, "index-28"], [88, "index-24"]], "definition_local (field)": [[53, "index-17"], [88, "index-14"]], "entry (base class)": [[53, "index-0"], [53, "index-0"]], "entry_identifier_uuid (field)": [[53, "index-11"]], "features (field)": [[53, "index-13"]], "type (group attribute)": [[53, "index-32"]], "nxenvironment": [[54, "index-0"]], "nxenvironment (base class)": [[54, "index-0"], [82, "index-1"]], "nxsensor (base class)": [[54, "index-1"], [57, "index-1"], [84, "index-0"]], "environment (base class)": [[54, "index-0"], [54, "index-0"]], "short_name (field)": [[54, "index-3"], [84, "index-6"]], "nxevent_data": [[55, "index-0"]], "nxevent_data (base class)": [[55, "index-0"], [64, "index-1"], [103, "index-1"]], "cue_index (field)": [[55, "index-11"], [65, "index-19"]], "cue_timestamp_zero (field)": [[55, "index-9"], [65, "index-16"]], "event_data (base class)": [[55, "index-0"], [55, "index-0"]], "event_id (field)": [[55, "index-4"]], "event_index (field)": [[55, "index-7"], [103, "index-56"]], "event_time_offset (field)": [[55, "index-3"]], "event_time_zero (field)": [[55, "index-5"]], "pulse_height (field)": [[55, "index-8"]], "nxfermi_chopper": [[56, "index-0"]], "fermi_chopper (base class)": [[56, "index-0"], [56, "index-0"]], "height (field)": [[56, "index-10"], [92, "index-12"]], "number (field)": [[56, "index-9"]], "r_slit (field)": [[56, "index-8"]], "slit (field)": [[56, "index-7"]], "width (field)": [[56, "index-11"], [92, "index-13"]], "nxfilter": [[57, "index-0"]], "nxfilter (base class)": [[57, "index-0"], [64, "index-1"]], "coating_material (field)": [[57, "index-21"], [61, "index-14"], [62, "index-13"], [66, "index-15"]], "coating_roughness (field)": [[57, "index-23"], [61, "index-16"], [62, "index-15"], [66, "index-17"]], "filter (base class)": [[57, "index-0"], [57, "index-0"]], "m_value (field)": [[57, "index-18"], [62, "index-10"], [66, "index-11"]], "substrate_material (field)": [[57, "index-19"], [61, "index-11"], [62, "index-11"], [66, "index-12"]], "substrate_roughness (field)": [[57, "index-22"], [61, "index-15"], [62, "index-14"], [66, "index-16"]], "substrate_thickness (field)": [[57, "index-20"], [61, "index-13"], [62, "index-12"], [66, "index-14"]], "nxflipper": [[58, "index-0"]], "nxflipper (base class)": [[58, "index-0"], [64, "index-1"]], "comp_current (field)": [[58, "index-9"]], "comp_turns (field)": [[58, "index-6"]], "flip_current (field)": [[58, "index-8"]], "flip_turns (field)": [[58, "index-5"]], "flipper (base class)": [[58, "index-0"], [58, "index-0"]], "guide_current (field)": [[58, "index-10"]], "guide_turns (field)": [[58, "index-7"]], "nxfresnel_zone_plate": [[59, "index-0"]], "nxfresnel_zone_plate (base class)": [[59, "index-0"]], "central_stop_diameter (field)": [[59, "index-7"]], "central_stop_material (field)": [[59, "index-12"]], "central_stop_thickness (field)": [[59, "index-13"]], "fabrication (field)": [[59, "index-8"]], "focus_parameters (field)": [[59, "index-4"]], "fresnel_zone_plate (base class)": [[59, "index-0"], [59, "index-0"]], "mask_material (field)": [[59, "index-15"]], "mask_thickness (field)": [[59, "index-14"]], "outer_diameter (field)": [[59, "index-5"]], "outermost_zone_width (field)": [[59, "index-6"]], "support_membrane_material (field)": [[59, "index-16"]], "support_membrane_thickness (field)": [[59, "index-17"]], "zone_height (field)": [[59, "index-9"]], "zone_material (field)": [[59, "index-10"]], "zone_support_material (field)": [[59, "index-11"]], "nxgeometry": [[60, "index-0"]], "nxorientation (base class)": [[60, "index-2"], [73, "index-0"], [84, "index-1"], [103, "index-1"], [104, "index-1"]], "nxtranslation (base class)": [[60, "index-2"], [90, "index-0"], [103, "index-1"], [104, "index-1"]], "component_index (field)": [[60, "index-6"]], "geometry (base class)": [[60, "index-0"], [60, "index-0"]], "nxgrating": [[61, "index-0"]], "nxgrating (base class)": [[61, "index-0"], [69, "index-1"]], "deflection_angle (field)": [[61, "index-9"]], "depth (field)": [[61, "index-7"]], "diffraction_order (field)": [[61, "index-8"]], "duty_cycle (field)": [[61, "index-6"]], "grating (base class)": [[61, "index-0"], [61, "index-0"]], "interior_atmosphere (field)": [[61, "index-10"], [62, "index-8"], [66, "index-9"]], "layer_thickness (field)": [[61, "index-17"], [66, "index-22"]], "period (field)": [[61, "index-5"], [87, "index-19"]], "substrate_density (field)": [[61, "index-12"], [66, "index-13"]], "nxguide": [[62, "index-0"]], "nxguide (base class)": [[62, "index-0"], [64, "index-1"]], "bend_angle_x (field)": [[62, "index-6"], [66, "index-7"]], "bend_angle_y (field)": [[62, "index-7"], [66, "index-8"]], "external_material (field)": [[62, "index-9"], [66, "index-10"]], "guide (base class)": [[62, "index-0"], [62, "index-0"]], "incident_angle (field)": [[62, "index-5"], [66, "index-6"]], "number_sections (field)": [[62, "index-16"]], "surface (field)": [[62, "index-24"]], "surface_indices (group attribute)": [[62, "index-21"]], "nxinsertion_device": [[63, "index-0"]], "nxinsertion_device (base class)": [[63, "index-0"], [64, "index-1"]], "bandwidth (field)": [[63, "index-14"]], "gap (field)": [[63, "index-5"]], "harmonic (field)": [[63, "index-15"]], "insertion_device (base class)": [[63, "index-0"], [63, "index-0"]], "k (field)": [[63, "index-10"], [80, "index-7"]], "magnetic_wavelength (field)": [[63, "index-9"]], "poles (field)": [[63, "index-8"]], "power (field)": [[63, "index-12"], [87, "index-9"]], "taper (field)": [[63, "index-6"]], "nxinstrument": [[64, "index-0"]], "nxmirror (base class)": [[64, "index-1"], [66, "index-0"]], "nxmoderator (base class)": [[64, "index-1"], [67, "index-0"], [103, "index-1"], [104, "index-1"]], "nxpolarizer (base class)": [[64, "index-1"], [77, "index-0"], [103, "index-1"], [104, "index-1"]], "nxpositioner (base class)": [[64, "index-1"], [78, "index-0"], [82, "index-1"], [103, "index-1"], [104, "index-1"]], "nxvelocity_selector (base class)": [[64, "index-1"], [69, "index-1"], [92, "index-0"]], "nxxraylens (base class)": [[64, "index-1"], [93, "index-0"]], "instrument (base class)": [[64, "index-0"], [64, "index-0"]], "nxlog": [[65, "index-0"]], "average_value (field)": [[65, "index-9"], [103, "index-17"], [103, "index-27"], [104, "index-17"], [104, "index-27"]], "average_value_error (field)": [[65, "index-10"], [103, "index-18"], [103, "index-28"], [104, "index-18"], [104, "index-28"]], "average_value_errors (field)": [[65, "index-12"], [103, "index-20"], [103, "index-30"], [104, "index-20"], [104, "index-30"]], "log (base class)": [[65, "index-0"], [65, "index-0"]], "maximum_value (field)": [[65, "index-14"], [103, "index-23"], [103, "index-33"], [104, "index-23"], [104, "index-33"]], "minimum_value (field)": [[65, "index-13"], [103, "index-24"], [103, "index-34"], [104, "index-24"], [104, "index-34"]], "raw_value (field)": [[65, "index-7"], [78, "index-7"]], "time (field)": [[65, "index-3"], [103, "index-25"], [103, "index-35"], [104, "index-25"], [104, "index-35"]], "value (field)": [[65, "index-6"], [73, "index-4"], [78, "index-6"], [84, "index-13"], [98, "index-8"], [98, "index-9"], [99, "index-8"], [99, "index-9"], [101, "index-5"], [101, "index-6"], [102, "index-6"], [102, "index-7"], [102, "index-8"], [102, "index-9"], [103, "index-26"], [103, "index-36"], [103, "index-65"], [103, "index-76"], [103, "index-85"], [104, "index-26"], [104, "index-36"], [104, "index-65"], [104, "index-77"], [104, "index-86"], [105, "index-5"], [105, "index-6"], [108, "index-6"], [108, "index-7"], [108, "index-8"], [108, "index-9"]], "nxmirror": [[66, "index-0"]], "even_layer_density (field)": [[66, "index-19"]], "even_layer_material (field)": [[66, "index-18"]], "mirror (base class)": [[66, "index-0"], [66, "index-0"]], "odd_layer_density (field)": [[66, "index-21"]], "odd_layer_material (field)": [[66, "index-20"]], "nxmoderator": [[67, "index-0"]], "coupled (field)": [[67, "index-7"]], "coupling_material (field)": [[67, "index-8"], [103, "index-71"], [104, "index-72"]], "moderator (base class)": [[67, "index-0"], [67, "index-0"]], "poison_depth (field)": [[67, "index-6"]], "poison_material (field)": [[67, "index-9"]], "nxmonitor": [[68, "index-0"]], "monitor (base class)": [[68, "index-0"], [68, "index-0"]], "nominal (field)": [[68, "index-10"]], "range (field)": [[68, "index-9"]], "sampled_fraction (field)": [[68, "index-16"]], "nxmonochromator": [[69, "index-0"]], "energy_error (field)": [[69, "index-9"]], "energy_errors (field)": [[69, "index-11"]], "monochromator (base class)": [[69, "index-0"], [69, "index-0"]], "wavelength_error (field)": [[69, "index-5"]], "wavelength_errors (field)": [[69, "index-7"]], "nxnote": [[70, "index-0"]], "author (field)": [[70, "index-3"], [103, "index-39"], [104, "index-39"]], "file_name (field)": [[70, "index-6"]], "note (base class)": [[70, "index-0"], [70, "index-0"]], "sequence_index (field)": [[70, "index-8"], [79, "index-5"]], "nxobject": [[71, "index-0"]], "nxobject (base class)": [[71, "index-0"]], "object (base class)": [[71, "index-0"], [71, "index-0"]], "nxoff_geometry": [[72, "index-0"]], "detector_faces (field)": [[72, "index-6"]], "faces (field)": [[72, "index-5"]], "off_geometry (base class)": [[72, "index-0"], [72, "index-0"]], "winding_order (field)": [[72, "index-4"]], "nxorientation": [[73, "index-0"]], "orientation (base class)": [[73, "index-0"], [73, "index-0"]], "nxparameters": [[74, "index-0"]], "parameters (base class)": [[74, "index-0"], [74, "index-0"]], "nxpdb": [[75, "index-0"]], "nxpdb (base class)": [[75, "index-0"]], "pdb (base class)": [[75, "index-0"], [75, "index-0"]], "nxpinhole": [[76, "index-0"]], "nxpinhole (base class)": [[76, "index-0"]], "pinhole (base class)": [[76, "index-0"], [76, "index-0"]], "nxpolarizer": [[77, "index-0"]], "composition (field)": [[77, "index-5"]], "polarizer (base class)": [[77, "index-0"], [77, "index-0"]], "nxpositioner": [[78, "index-0"]], "acceleration_time (field)": [[78, "index-13"]], "controller_record (field)": [[78, "index-14"]], "positioner (base class)": [[78, "index-0"], [78, "index-0"]], "soft_limit_max (field)": [[78, "index-11"]], "soft_limit_min (field)": [[78, "index-10"]], "target_value (field)": [[78, "index-8"]], "tolerance (field)": [[78, "index-9"]], "velocity (field)": [[78, "index-12"]], "process (base class)": [[79, "index-0"], [79, "index-0"]], "nxreflections": [[80, "index-0"]], "nxreflections (base class)": [[80, "index-0"]], "background_mean (field)": [[80, "index-75"]], "bounding_box (field)": [[80, "index-73"]], "d (field)": [[80, "index-21"]], "description (field attribute)": [[80, "index-10"], [80, "index-12"], [80, "index-14"], [80, "index-16"], [80, "index-18"], [80, "index-20"], [80, "index-22"], [80, "index-24"], [80, "index-26"], [80, "index-28"], [80, "index-30"], [80, "index-32"], [80, "index-34"], [80, "index-36"], [80, "index-38"], [80, "index-40"], [80, "index-42"], [80, "index-44"], [80, "index-46"], [80, "index-48"], [80, "index-50"], [80, "index-52"], [80, "index-54"], [80, "index-56"], [80, "index-58"], [80, "index-6"], [80, "index-60"], [80, "index-62"], [80, "index-64"], [80, "index-66"], [80, "index-68"], [80, "index-70"], [80, "index-72"], [80, "index-74"], [80, "index-76"], [80, "index-78"], [80, "index-8"], [80, "index-80"], [80, "index-82"], [80, "index-84"], [80, "index-86"], [80, "index-88"], [80, "index-90"], [80, "index-92"], [80, "index-94"], [80, "index-96"], [98, "index-5"], [99, "index-5"], [107, "index-66"]], "description (file attribute)": [[80, "index-1"]], "det_module (field)": [[80, "index-17"]], "entering (field)": [[80, "index-15"]], "experiments (field)": [[80, "index-4"]], "flags (field)": [[80, "index-19"]], "h (field)": [[80, "index-5"]], "id (field)": [[80, "index-11"]], "int_prf (field)": [[80, "index-77"]], "int_prf_errors (field)": [[80, "index-81"]], "int_prf_var (field)": [[80, "index-79"]], "int_sum (field)": [[80, "index-83"]], "int_sum_errors (field)": [[80, "index-87"]], "int_sum_var (field)": [[80, "index-85"]], "l (field)": [[80, "index-9"]], "lp (field)": [[80, "index-89"]], "observed_frame (field)": [[80, "index-37"]], "observed_frame_errors (field)": [[80, "index-41"]], "observed_frame_var (field)": [[80, "index-39"]], "observed_phi (field)": [[80, "index-55"]], "observed_phi_errors (field)": [[80, "index-59"]], "observed_phi_var (field)": [[80, "index-57"]], "observed_px_x (field)": [[80, "index-43"]], "observed_px_x_errors (field)": [[80, "index-47"]], "observed_px_x_var (field)": [[80, "index-45"]], "observed_px_y (field)": [[80, "index-49"]], "observed_px_y_errors (field)": [[80, "index-53"]], "observed_px_y_var (field)": [[80, "index-51"]], "observed_x (field)": [[80, "index-61"]], "observed_x_errors (field)": [[80, "index-65"]], "observed_x_var (field)": [[80, "index-63"]], "observed_y (field)": [[80, "index-67"]], "observed_y_errors (field)": [[80, "index-71"]], "observed_y_var (field)": [[80, "index-69"]], "overlaps (field)": [[80, "index-93"]], "partiality (field)": [[80, "index-23"]], "predicted_frame (field)": [[80, "index-25"]], "predicted_phi (field)": [[80, "index-31"]], "predicted_px_x (field)": [[80, "index-33"]], "predicted_px_y (field)": [[80, "index-35"]], "predicted_x (field)": [[80, "index-27"]], "predicted_y (field)": [[80, "index-29"]], "prf_cc (field)": [[80, "index-91"]], "reflection_id (field)": [[80, "index-13"]], "reflections (base class)": [[80, "index-0"], [80, "index-0"]], "hdf5_version (file attribute)": [[81, "index-8"], [107, "index-4"]], "hdf_version (file attribute)": [[81, "index-7"]], "nx_class (file attribute)": [[81, "index-2"]], "nxroot": [[81, "index-0"]], "nxroot (base class)": [[81, "index-0"], [116, "index-12"]], "nexus_version (file attribute)": [[81, "index-6"]], "xml_version (file attribute)": [[81, "index-9"]], "creator (file attribute)": [[81, "index-11"]], "creator_version (file attribute)": [[81, "index-12"]], "file_name (file attribute)": [[81, "index-4"]], "file_time (file attribute)": [[81, "index-3"]], "file_update_time (file attribute)": [[81, "index-5"]], "h5py_version (file attribute)": [[81, "index-10"], [107, "index-5"]], "root (base class)": [[81, "index-0"], [81, "index-0"]], "nxsample": [[82, "index-0"]], "nxsample_component (base class)": [[82, "index-1"], [83, "index-0"]], "changer_position (field)": [[82, "index-14"], [103, "index-94"], [104, "index-95"]], "component (field)": [[82, "index-29"]], "concentration (field)": [[82, "index-31"]], "direction (field attribute)": [[82, "index-10"], [82, "index-12"], [82, "index-8"]], "external_dac (field)": [[82, "index-40"]], "mass (field)": [[82, "index-22"], [83, "index-11"]], "path_length (field)": [[82, "index-37"]], "path_length_window (field)": [[82, "index-38"]], "point_group (field)": [[82, "index-36"], [83, "index-19"]], "relative_molecular_mass (field)": [[82, "index-24"], [83, "index-13"], [95, "index-7"]], "sample (base class)": [[82, "index-0"], [82, "index-0"]], "sample_component (field)": [[82, "index-30"]], "sample_orientation (field)": [[82, "index-19"], [83, "index-9"]], "scattering_length_density (field)": [[82, "index-33"], [83, "index-16"]], "short_title (field)": [[82, "index-41"]], "ub_matrix (field)": [[82, "index-21"]], "unit_cell_abc (field)": [[82, "index-15"], [83, "index-6"]], "unit_cell_alphabetagamma (field)": [[82, "index-16"], [83, "index-7"]], "unit_cell_class (field)": [[82, "index-34"], [83, "index-17"]], "volume_fraction (field)": [[82, "index-32"], [83, "index-15"]], "nxsample_component": [[83, "index-0"]], "sample_component (base class)": [[83, "index-0"], [83, "index-0"]], "nxsensor": [[84, "index-0"]], "attached_to (field)": [[84, "index-7"]], "external_field_brief (field)": [[84, "index-16"]], "high_trip_value (field)": [[84, "index-11"]], "low_trip_value (field)": [[84, "index-12"]], "measurement (field)": [[84, "index-8"]], "model (field)": [[84, "index-4"]], "run_control (field)": [[84, "index-10"]], "sensor (base class)": [[84, "index-0"], [84, "index-0"]], "value_deriv1 (field)": [[84, "index-14"]], "value_deriv2 (field)": [[84, "index-15"]], "nxshape": [[85, "index-0"]], "direction (field)": [[85, "index-5"]], "shape (base class)": [[85, "index-0"], [85, "index-0"]], "nxslit": [[86, "index-0"]], "nxslit (base class)": [[86, "index-0"]], "slit (base class)": [[86, "index-0"], [86, "index-0"]], "nxsource": [[87, "index-0"]], "bunch_distance (field)": [[87, "index-23"]], "bunch_length (field)": [[87, "index-22"]], "current (field)": [[87, "index-16"]], "emittance_x (field)": [[87, "index-10"]], "emittance_y (field)": [[87, "index-11"]], "last_fill (field)": [[87, "index-27"]], "number_of_bunches (field)": [[87, "index-21"]], "pulse_width (field)": [[87, "index-24"]], "sigma_x (field)": [[87, "index-12"]], "sigma_y (field)": [[87, "index-13"]], "source (base class)": [[87, "index-0"], [87, "index-0"]], "target_material (field)": [[87, "index-20"]], "top_up (field)": [[87, "index-26"]], "voltage (field)": [[87, "index-17"]], "nxsubentry": [[88, "index-0"], [110, "index-2"]], "mime_type (group attribute)": [[88, "index-28"]], "subentry (base class)": [[88, "index-0"], [88, "index-0"]], "axisname (field)": [[89, "index-3"]], "axisname_end (field)": [[89, "index-9"]], "axisname_increment_set (field)": [[89, "index-10"]], "nxtransformations": [[89, "index-0"]], "transformations (base class)": [[89, "index-0"], [89, "index-0"]], "nxtranslation": [[90, "index-0"]], "distances (field)": [[90, "index-4"]], "translation (base class)": [[90, "index-0"], [90, "index-0"]], "nxuser": [[91, "index-0"]], "orcid (field)": [[91, "index-11"]], "address (field)": [[91, "index-6"]], "affiliation (field)": [[91, "index-5"]], "email (field)": [[91, "index-9"]], "fax_number (field)": [[91, "index-8"]], "telephone_number (field)": [[91, "index-7"]], "user (base class)": [[91, "index-0"], [91, "index-0"]], "nxvelocity_selector": [[92, "index-0"]], "num (field)": [[92, "index-9"]], "spwidth (field)": [[92, "index-7"]], "table (field)": [[92, "index-11"]], "twist (field)": [[92, "index-10"]], "velocity_selector (base class)": [[92, "index-0"], [92, "index-0"]], "nxxraylens": [[93, "index-0"]], "aperture (field)": [[93, "index-11"]], "curvature (field)": [[93, "index-10"]], "cylindrical (field)": [[93, "index-6"]], "focus_type (field)": [[93, "index-7"]], "gas (field)": [[93, "index-14"]], "lens_geometry (field)": [[93, "index-4"]], "lens_length (field)": [[93, "index-9"]], "lens_material (field)": [[93, "index-13"]], "lens_thickness (field)": [[93, "index-8"]], "number_of_lenses (field)": [[93, "index-12"]], "symmetric (field)": [[93, "index-5"]], "xraylens (base class)": [[93, "index-0"], [93, "index-0"]], "base class": [[94, "index-0"]], "nxcontainer": [[95, "index-0"]], "nxcontainer (contributed definition)": [[95, "index-0"]], "container (contributed definition)": [[95, "index-0"], [95, "index-0"]], "packing_fraction (field)": [[95, "index-6"]], "used in contributed definition": [[95, "index-1"], [96, "index-1"], [97, "index-1"], [98, "index-1"], [99, "index-1"], [101, "index-1"], [102, "index-1"], [103, "index-1"], [104, "index-1"], [105, "index-1"], [106, "index-1"], [107, "index-1"], [108, "index-1"]], "nxcsg": [[96, "index-0"]], "nxcsg (base class)": [[96, "index-1"], [106, "index-1"]], "nxcsg (contributed definition)": [[96, "index-0"]], "csg (contributed definition)": [[96, "index-0"], [96, "index-0"]], "geometry (field)": [[96, "index-3"]], "operation (field)": [[96, "index-2"]], "nxcxi_ptycho": [[97, "index-0"]], "nxcxi_ptycho (contributed definition)": [[97, "index-0"]], "cxi_ptycho (contributed definition)": [[97, "index-0"], [97, "index-0"]], "incident_beam_energy (field)": [[97, "index-16"]], "incident_energy_spread (field)": [[97, "index-18"]], "interpretation (field attribute)": [[97, "index-25"]], "transformations (field)": [[97, "index-44"]], "translation (field)": [[97, "index-22"]], "vector (field)": [[97, "index-37"]], "x_indices (field)": [[97, "index-41"]], "y_indices (field)": [[97, "index-42"]], "nxelectrostatic_kicker": [[98, "index-0"]], "nxelectrostatic_kicker (contributed definition)": [[98, "index-0"]], "beamline_distance (field)": [[98, "index-3"], [99, "index-3"], [101, "index-3"], [102, "index-3"], [105, "index-3"], [108, "index-3"]], "electrostatic_kicker (contributed definition)": [[98, "index-0"], [98, "index-0"]], "set_current (field)": [[98, "index-6"], [99, "index-6"], [101, "index-4"], [105, "index-4"]], "set_voltage (field)": [[98, "index-7"], [99, "index-7"]], "timing (field)": [[98, "index-4"], [99, "index-4"]], "nxmagnetic_kicker": [[99, "index-0"]], "nxmagnetic_kicker (contributed definition)": [[99, "index-0"]], "magnetic_kicker (contributed definition)": [[99, "index-0"], [99, "index-0"]], "nxquadric": [[100, "index-0"]], "nxquadric (contributed definition)": [[100, "index-0"]], "parameters (field)": [[100, "index-1"]], "quadric (contributed definition)": [[100, "index-0"], [100, "index-0"]], "surface_type (field)": [[100, "index-2"]], "nxquadrupole_magnet": [[101, "index-0"]], "nxquadrupole_magnet (contributed definition)": [[101, "index-0"]], "quadrupole_magnet (contributed definition)": [[101, "index-0"], [101, "index-0"]], "nxseparator": [[102, "index-0"]], "nxseparator (contributed definition)": [[102, "index-0"]], "separator (contributed definition)": [[102, "index-0"], [102, "index-0"]], "set_bfield_current (field)": [[102, "index-4"], [108, "index-4"]], "set_efield_voltage (field)": [[102, "index-5"], [108, "index-5"]], "nxsnsevent": [[103, "index-0"]], "nxsnsevent (contributed definition)": [[103, "index-0"]], "snsbanking_file_name (field)": [[103, "index-37"], [104, "index-37"]], "snsdetector_calibration_id (field)": [[103, "index-44"], [104, "index-44"]], "snsgeometry_file_name (field)": [[103, "index-45"], [104, "index-45"]], "snsmapping_file_name (field)": [[103, "index-38"], [104, "index-38"]], "snstranslation_service (field)": [[103, "index-46"], [104, "index-46"]], "beamline (field)": [[103, "index-47"], [104, "index-47"]], "collection_title (field)": [[103, "index-3"], [104, "index-3"]], "command1 (field)": [[103, "index-40"], [104, "index-40"]], "data_x_y (field)": [[103, "index-54"], [104, "index-56"]], "event_pixel_id (field)": [[103, "index-57"]], "event_time_of_flight (field)": [[103, "index-58"]], "holder (field)": [[103, "index-95"], [104, "index-96"]], "identifier (field)": [[103, "index-96"], [104, "index-97"]], "notes (field)": [[103, "index-9"], [104, "index-9"]], "pixel_id (field)": [[103, "index-59"], [104, "index-59"]], "proton_charge (field)": [[103, "index-10"], [104, "index-10"]], "pulse_time (field)": [[103, "index-61"]], "raw_frames (field)": [[103, "index-11"], [104, "index-11"]], "snsevent (contributed definition)": [[103, "index-0"], [103, "index-0"]], "total_counts (field)": [[103, "index-15"], [103, "index-62"], [104, "index-15"], [104, "index-62"]], "total_uncounted_counts (field)": [[103, "index-16"], [104, "index-16"]], "nxsnshisto": [[104, "index-0"]], "nxsnshisto (contributed definition)": [[104, "index-0"]], "data_x_time_of_flight (field)": [[104, "index-55"]], "data_y_time_of_flight (field)": [[104, "index-57"]], "snshisto (contributed definition)": [[104, "index-0"], [104, "index-0"]], "nxsolenoid_magnet": [[105, "index-0"]], "nxsolenoid_magnet (contributed definition)": [[105, "index-0"]], "solenoid_magnet (contributed definition)": [[105, "index-0"], [105, "index-0"]], "nxquadric (base class)": [[106, "index-1"]], "nxsolid_geometry": [[106, "index-0"]], "nxsolid_geometry (contributed definition)": [[106, "index-0"]], "solid_geometry (contributed definition)": [[106, "index-0"], [106, "index-0"]], "axisname_indices (group attribute)": [[107, "index-32"]], "degc_sp (field)": [[107, "index-22"]], "g0 (field)": [[107, "index-48"]], "g1 (field)": [[107, "index-49"]], "g2 (field)": [[107, "index-50"]], "g4 (field)": [[107, "index-51"]], "nxspecdata": [[107, "index-0"]], "nxspecdata (contributed definition)": [[107, "index-0"]], "spec_comments (file attribute)": [[107, "index-9"]], "spec_date (file attribute)": [[107, "index-7"]], "spec_epoch (file attribute)": [[107, "index-8"]], "spec_file (file attribute)": [[107, "index-6"]], "spec_num_headers (file attribute)": [[107, "index-10"]], "spec_user (field)": [[107, "index-70"]], "temp_sp (field)": [[107, "index-21"]], "_mca1_ (field)": [[107, "index-39"]], "_mca1_channel_ (field)": [[107, "index-40"]], "_mca_ (field)": [[107, "index-37"]], "_mca_channel_ (field)": [[107, "index-38"]], "calib_a (field)": [[107, "index-62"]], "calib_b (field)": [[107, "index-63"]], "calib_c (field)": [[107, "index-64"]], "command (field)": [[107, "index-17"]], "comment (group attribute)": [[107, "index-41"], [107, "index-43"], [107, "index-46"], [107, "index-71"]], "comments (field)": [[107, "index-19"]], "description (group attribute)": [[107, "index-23"], [107, "index-29"], [107, "index-42"], [107, "index-44"], [107, "index-47"], [107, "index-52"], [107, "index-54"], [107, "index-69"], [107, "index-72"]], "elapsed_live_time (field)": [[107, "index-56"]], "elapsed_real_time (field)": [[107, "index-57"]], "first_channel (field attribute)": [[107, "index-67"]], "first_saved (field)": [[107, "index-59"]], "intensity_factor (field)": [[107, "index-36"]], "last_channel (field attribute)": [[107, "index-68"]], "last_saved (field)": [[107, "index-60"]], "number_saved (field)": [[107, "index-58"]], "positioner (field)": [[107, "index-53"]], "preset_time (field)": [[107, "index-55"]], "reduction_coef (field)": [[107, "index-61"]], "roin (field)": [[107, "index-65"]], "scan_number (field)": [[107, "index-15"]], "spec_name (field attribute)": [[107, "index-34"]], "specdata (contributed definition)": [[107, "index-0"], [107, "index-0"]], "nxspin_rotator": [[108, "index-0"]], "nxspin_rotator (contributed definition)": [[108, "index-0"]], "spin_rotator (contributed definition)": [[108, "index-0"], [108, "index-0"]], "contributed definition": [[109, "index-0"], [112, "index-3"]], "multi-modal data": [[110, "index-2"]], "subentry": [[110, "index-2"]], "use of": [[110, "index-2"]], "sphinx (documentation generator)": [[111, "index-0"]], "manual source": [[111, "index-1"]], "niac": [[112, "index-1"], [130, "index-2"], [133, "index-18"], [144, "index-0"], [144, "index-0"]], "nexus webpage": [[112, "index-2"]], "community": [[112, "index-0"]], "webpage": [[112, "index-2"]], "fdl": [[113, "index-1"]], "lgpl": [[113, "index-2"]], "copyright": [[113, "index-0"]], "license": [[113, "index-0"]], "bluesky_": [[114, "index-5"]], "hdf5": [[114, "index-3"], [119, "index-0"], [130, "index-4"]], "idf_": [[114, "index-5"]], "ndattr": [[114, "index-5"]], "nx": [[114, "index-0"], [114, "index-5"], [116, "index-18"]], "nx_": [[114, "index-5"]], "nxclass": [[114, "index-0"]], "nxclass (attribute)": [[114, "index-0"]], "pdbx_": [[114, "index-5"]], "sas_": [[114, "index-5"]], "silx_": [[114, "index-5"]], "udunits": [[114, "index-24"], [114, "index-26"]], "utf-8": [[114, "index-16"], [146, "index-6"]], "unidata udunits": [[114, "index-24"]], "arrays": [[114, "index-19"]], "attribute": [[114, "index-0"], [115, "index-7"], [116, "index-12"], [116, "index-5"], [128, "index-2"], [147, "index-0"]], "axis": [[114, "index-40"]], "binary data": [[114, "index-20"], [146, "index-1"]], "data": [[114, "index-34"]], "date and time": [[114, "index-14"], [114, "index-22"], [114, "index-23"]], "dimension scale": [[114, "index-30"], [114, "index-31"], [114, "index-32"], [116, "index-24"]], "dimension scales": [[114, "index-35"], [114, "index-37"], [114, "index-39"], [114, "index-43"], [114, "index-45"]], "end": [[114, "index-7"]], "enumeration": [[114, "index-25"]], "errors": [[114, "index-7"]], "fixed-length": [[114, "index-18"]], "floating-point numbers": [[114, "index-13"], [114, "index-13"]], "how to find data": [[114, "index-28"]], "images": [[114, "index-21"]], "increment_set": [[114, "index-7"]], "indices": [[114, "index-7"]], "integers": [[114, "index-12"], [114, "index-12"]], "mask": [[114, "index-7"]], "monitor": [[114, "index-27"]], "multi-dimensional": [[114, "index-34"]], "multi-dimensional data": [[114, "index-34"]], "naming": [[114, "index-1"], [115, "index-6"], [116, "index-21"], [151, "index-1"]], "naming convention": [[114, "index-0"]], "numbers": [[114, "index-12"], [114, "index-13"]], "regular expression": [[114, "index-2"]], "reserved prefixes": [[114, "index-4"], [114, "index-5"]], "reserved suffixes": [[114, "index-6"], [114, "index-7"]], "rules": [[114, "index-1"], [114, "index-3"], [115, "index-4"], [115, "index-5"], [115, "index-6"], [116, "index-19"], [116, "index-21"], [116, "index-3"], [133, "index-1"], [151, "index-0"], [151, "index-1"]], "set": [[114, "index-7"]], "signal data": [[114, "index-29"], [116, "index-10"]], "storage order": [[114, "index-11"], [114, "index-8"]], "strings": [[114, "index-15"], [114, "index-17"], [114, "index-18"], [114, "index-19"]], "units": [[114, "index-24"], [115, "index-9"], [116, "index-6"], [116, "index-8"], [134, "index-7"]], "used as nx class prefix": [[114, "index-0"], [116, "index-18"]], "variable-length": [[114, "index-17"]], "weights": [[114, "index-7"]], "hdf": [[115, "index-4"], [116, "index-3"], [128, "index-1"], [128, "index-2"], [154, "index-29"]], "nxdl": [[115, "index-0"], [116, "index-20"], [127, "index-2"], [145, "index-0"], [145, "index-0"], [145, "index-1"]], "xml": [[115, "index-5"], [130, "index-1"]], "choice": [[115, "index-10"]], "flexible name": [[115, "index-8"]], "release": [[115, "index-1"], [115, "index-2"], [132, "index-10"], [132, "index-6"], [132, "index-7"], [132, "index-8"], [132, "index-9"]], "tags": [[115, "index-2"], [115, "index-3"], [132, "index-10"], [132, "index-11"]], "versioning": [[115, "index-1"], [132, "index-9"]], "cif": [[116, "index-38"], [116, "index-42"]], "iucr": [[116, "index-27"], [116, "index-28"]], "mcstas": [[116, "index-27"], [116, "index-41"], [116, "index-43"], [116, "index-44"], [116, "index-45"]], "nx prefix": [[116, "index-19"]], "nexus": [[116, "index-26"], [151, "index-0"]], "nexus link": [[116, "index-14"], [116, "index-14"], [116, "index-17"]], "nexus polar coordinate": [[116, "index-40"]], "sds (scientific data sets)": [[116, "index-4"]], "scientific data sets": [[116, "index-4"]], "address, absolute": [[116, "index-14"]], "address, relative": [[116, "index-14"]], "attributes": [[116, "index-12"]], "automatic plotting": [[116, "index-24"]], "class path": [[116, "index-15"]], "coordinate systems": [[116, "index-26"], [116, "index-27"], [116, "index-28"], [116, "index-30"], [116, "index-39"], [116, "index-40"], [116, "index-41"], [116, "index-42"], [116, "index-43"], [116, "index-44"], [116, "index-45"]], "data field": [[116, "index-4"]], "data group": [[116, "index-1"]], "data item": [[116, "index-4"]], "data object": [[116, "index-4"]], "data set": [[116, "index-4"]], "dataset": [[116, "index-4"]], "default plot": [[116, "index-24"]], "depends on (field attribute)": [[116, "index-35"], [116, "index-35"]], "direction": [[116, "index-33"]], "external file": [[116, "index-16"], [116, "index-17"]], "field": [[116, "index-4"], [116, "index-4"], [128, "index-2"], [133, "index-5"]], "field attribute": [[116, "index-5"], [116, "index-5"], [133, "index-6"], [134, "index-6"]], "file attribute": [[116, "index-12"], [116, "index-12"]], "folder": [[116, "index-1"]], "geometry": [[116, "index-27"], [116, "index-43"], [116, "index-45"]], "group": [[116, "index-1"], [116, "index-1"], [128, "index-2"], [133, "index-4"]], "group attribute": [[116, "index-5"], [116, "index-5"], [133, "index-6"]], "link target (internal attribute)": [[116, "index-13"]], "link, target, attribute": [[116, "index-14"]], "motivation": [[116, "index-24"], [133, "index-0"], [137, "index-0"], [137, "index-0"]], "order (transformation)": [[116, "index-35"]], "rotation": [[116, "index-32"]], "spherical polar": [[116, "index-45"]], "target, attribute": [[116, "index-14"]], "transformation matrices": [[116, "index-29"]], "transformation type (field attribute)": [[116, "index-32"]], "transformations": [[116, "index-30"]], "translation": [[116, "index-32"]], "value (transformation matrix)": [[116, "index-31"]], "napi": [[118, "index-0"], [127, "index-5"], [128, "index-0"], [130, "index-6"], [132, "index-0"], [132, "index-1"], [132, "index-2"], [132, "index-3"], [132, "index-4"], [132, "index-5"], [133, "index-2"], [134, "index-0"], [134, "index-1"], [134, "index-3"], [138, "index-0"], [138, "index-0"], [138, "index-1"], [139, "index-0"], [140, "index-0"], [141, "index-0"], [142, "index-0"], [143, "index-0"], [154, "index-8"]], "examples": [[118, "index-0"], [119, "index-0"], [120, "index-0"], [126, "index-0"], [133, "index-15"], [133, "index-9"]], "epics": [[120, "index-0"]], "ndattribute": [[120, "index-1"]], "nexpy": [[121, "index-2"], [133, "index-16"]], "h5py": [[121, "index-0"], [121, "index-1"]], "matlab": [[126, "index-0"], [154, "index-24"]], "faq": [[127, "index-0"]], "constitution": [[127, "index-3"], [144, "index-1"]], "contribute": [[127, "index-1"]], "bypassing": [[128, "index-0"]], "file format": [[128, "index-0"], [128, "index-1"]], "low-level file format": [[128, "index-0"]], "physical file format": [[128, "index-0"]], "git": [[129, "index-1"]], "repository": [[129, "index-0"], [132, "index-1"]], "hdf4": [[130, "index-5"]], "klosowski, przemys\u0142aw": [[130, "index-7"], [137, "index-4"]], "k\u00f6nnecke, mark": [[130, "index-10"], [137, "index-1"]], "osborn, raymond": [[130, "index-8"]], "riedel, richard": [[130, "index-3"]], "tischler, jonathan": [[130, "index-9"], [137, "index-2"]], "mac os x": [[132, "index-4"]], "microsoft windows": [[132, "index-3"]], "napi installation": [[132, "index-0"], [132, "index-1"], [132, "index-2"], [132, "index-3"], [132, "index-4"], [132, "index-5"]], "nexus definitions": [[132, "index-6"]], "rpm": [[132, "index-2"]], "windows": [[132, "index-3"]], "binary executable": [[132, "index-0"]], "download location": [[132, "index-1"]], "installation": [[132, "index-0"], [132, "index-0"]], "installation; mac os x": [[132, "index-4"]], "installation; rpm": [[132, "index-2"]], "installation; windows": [[132, "index-3"]], "installation; download location": [[132, "index-1"]], "installation; source distribution": [[132, "index-5"]], "notes": [[132, "index-7"]], "precompiled executable": [[132, "index-0"]], "process": [[132, "index-8"]], "source distribution": [[132, "index-5"]], "nexus file": [[133, "index-9"]], "nexus file; minimal": [[133, "index-15"]], "design principles": [[133, "index-3"]], "instrument definitions": [[133, "index-17"]], "introduction": [[133, "index-0"]], "tree structure": [[133, "index-9"]], "api": [[134, "index-0"], [154, "index-32"], [154, "index-33"], [154, "index-34"], [154, "index-35"], [154, "index-36"], [154, "index-37"], [154, "index-38"], [154, "index-39"], [154, "index-40"], [154, "index-41"], [154, "index-42"], [154, "index-43"]], "browser": [[134, "index-9"], [154, "index-3"]], "file": [[134, "index-0"], [154, "index-13"], [154, "index-14"]], "nxbrowse": [[134, "index-10"]], "read and write": [[134, "index-0"]], "read file": [[134, "index-8"]], "write file": [[134, "index-2"]], "issue reporting": [[135, "index-0"]], "mailing lists": [[136, "index-0"]], "nelson, mitchell": [[137, "index-3"]], "dictionary of terms": [[137, "index-0"], [137, "index-7"]], "exchange format": [[137, "index-0"]], "format unification": [[137, "index-0"], [137, "index-6"]], "lexicography": [[137, "index-7"]], "why nexus?": [[137, "index-0"]], "nexus application programming interface": [[138, "index-0"]], "core": [[138, "index-1"]], "c": [[139, "index-0"]], "c++": [[139, "index-0"]], "f77": [[140, "index-0"]], "f90": [[141, "index-0"]], "idl": [[142, "index-0"]], "java": [[143, "index-0"]], "nexus international advisory committee": [[144, "index-0"]], "nexus definition language": [[145, "index-0"]], "iso8601 (data type)": [[146, "index-2"]], "nx_angle (units type)": [[146, "index-14"]], "nx_any (units type)": [[146, "index-15"]], "nx_area (units type)": [[146, "index-16"]], "nx_binary": [[146, "index-1"]], "nx_binary (data type)": [[146, "index-3"]], "nx_boolean (data type)": [[146, "index-4"]], "nx_char (data type)": [[146, "index-5"]], "nx_charge (units type)": [[146, "index-17"]], "nx_cross_section (units type)": [[146, "index-18"]], "nx_current (units type)": [[146, "index-19"]], "nx_date_time (data type)": [[146, "index-7"]], "nx_dimensionless (units type)": [[146, "index-20"]], "nx_emittance (units type)": [[146, "index-21"]], "nx_energy (units type)": [[146, "index-22"]], "nx_float (data type)": [[146, "index-8"]], "nx_flux (units type)": [[146, "index-23"]], "nx_frequency (units type)": [[146, "index-24"]], "nx_int (data type)": [[146, "index-9"]], "nx_length (units type)": [[146, "index-25"]], "nx_mass (units type)": [[146, "index-26"]], "nx_mass_density (units type)": [[146, "index-27"]], "nx_molecular_weight (units type)": [[146, "index-28"]], "nx_number (data type)": [[146, "index-10"]], "nx_period (units type)": [[146, "index-29"]], "nx_per_area (units type)": [[146, "index-30"]], "nx_per_length (units type)": [[146, "index-31"]], "nx_posint (data type)": [[146, "index-11"]], "nx_power (units type)": [[146, "index-32"]], "nx_pressure (units type)": [[146, "index-33"]], "nx_pulses (units type)": [[146, "index-34"]], "nx_scattering_length_density (units type)": [[146, "index-35"]], "nx_solid_angle (units type)": [[146, "index-36"]], "nx_temperature (units type)": [[146, "index-37"]], "nx_time (units type)": [[146, "index-38"]], "nx_time_of_flight (units type)": [[146, "index-39"]], "nx_transformation (units type)": [[146, "index-40"]], "nx_uint (data type)": [[146, "index-12"]], "nx_unitless (units type)": [[146, "index-41"]], "nx_voltage (units type)": [[146, "index-42"]], "nx_volume (units type)": [[146, "index-43"]], "nx_wavelength (units type)": [[146, "index-44"]], "nx_wavenumber (units type)": [[146, "index-45"]], "data type": [[146, "index-0"], [146, "index-0"]], "type": [[146, "index-0"]], "unit category": [[146, "index-13"]], "nxdl attribute": [[147, "index-0"]], "nxdl elements": [[147, "index-0"]], "attribute (nxdl element)": [[147, "index-1"]], "attributetype (nxdl data type)": [[147, "index-12"]], "basiccomponent (nxdl data type)": [[147, "index-24"]], "choice (nxdl element)": [[147, "index-2"]], "choicetype (nxdl data type)": [[147, "index-20"]], "definition (nxdl data type)": [[147, "index-13"]], "definitiontype (nxdl data type)": [[147, "index-14"]], "definitiontypeattr (nxdl data type)": [[147, "index-15"]], "dimensionstype (nxdl data type)": [[147, "index-16"]], "doctype (nxdl data type)": [[147, "index-17"]], "enumeration (nxdl element)": [[147, "index-6"]], "enumerationtype (nxdl data type)": [[147, "index-18"]], "fieldtype (nxdl data type)": [[147, "index-19"]], "grouptype (nxdl data type)": [[147, "index-21"]], "link (nxdl element)": [[147, "index-9"]], "link target": [[147, "index-10"]], "linktype (nxdl data type)": [[147, "index-22"]], "nonnegativeunbounded (nxdl data type)": [[147, "index-28"]], "symbols (nxdl element)": [[147, "index-11"]], "symbolstype (nxdl data type)": [[147, "index-23"]], "validitemname (nxdl data type)": [[147, "index-25"]], "validnxclassname (nxdl data type)": [[147, "index-26"]], "validtargetname (nxdl data type)": [[147, "index-27"]], "revision history": [[150, "index-0"]], "simplest case(s)": [[152, "index-1"]], "strategies": [[152, "index-0"], [152, "index-1"]], "dave (data analysis software)": [[154, "index-15"]], "dawn (data analysis software)": [[154, "index-16"]], "f77; poldi": [[154, "index-32"]], "gda (data acquisition software)": [[154, "index-17"]], "gumtree (data analysis software)": [[154, "index-18"]], "hdfexplorer": [[154, "index-30"]], "hdfview": [[154, "index-31"]], "idl (data analysis software)": [[154, "index-19"]], "idl; axis2000": [[154, "index-33"]], "igor pro (data analysis software)": [[154, "index-20"]], "isaw (data analysis software)": [[154, "index-21"]], "igorpro; hdf5gateway": [[154, "index-34"]], "lamp (data analysis software)": [[154, "index-22"]], "mantid (data analysis software)": [[154, "index-23"]], "nxplot (utility)": [[154, "index-11"]], "nexpy (data analysis software)": [[154, "index-25"]], "opengenie (data analysis software)": [[154, "index-26"]], "pymca (data analysis software)": [[154, "index-27"]], "python; dials": [[154, "index-37"]], "python; mantis": [[154, "index-39"]], "python; sasview": [[154, "index-41"]], "python; h5py": [[154, "index-38"]], "python; nexusformat": [[154, "index-40"]], "cnxvalidate (utility)": [[154, "index-13"]], "conversion": [[154, "index-4"]], "data analysis software": [[154, "index-12"]], "ingestion": [[154, "index-6"]], "inspection": [[154, "index-5"]], "java; dawn": [[154, "index-35"]], "java; nxreader.zip": [[154, "index-36"]], "mixed; focus": [[154, "index-42"]], "mixed; zebra": [[154, "index-43"]], "nxbrowse (utility)": [[154, "index-3"]], "nxconvert (utility)": [[154, "index-4"]], "nxdir (utility)": [[154, "index-5"]], "nxingest (utility)": [[154, "index-6"]], "nxsummary": [[154, "index-9"]], "nxtranslate (utility)": [[154, "index-10"]], "programs": [[154, "index-1"]], "punx (utility)": [[154, "index-14"]], "software": [[154, "index-12"], [154, "index-2"]], "spec2nexus": [[154, "index-28"]], "tools": [[154, "index-29"]], "utilities": [[154, "index-0"]], "validate": [[154, "index-13"], [154, "index-14"]], "validation": [[154, "index-13"], [154, "index-14"], [155, "index-0"]], "nxvalidate": [[155, "index-2"]], "verification": [[155, "index-0"]]}}) \ No newline at end of file +Search.setIndex({"docnames": ["applying-nexus", "authorgroup", "classes/applications/NXarchive", "classes/applications/NXarpes", "classes/applications/NXcanSAS", "classes/applications/NXdirecttof", "classes/applications/NXfluo", "classes/applications/NXindirecttof", "classes/applications/NXiqproc", "classes/applications/NXlauetof", "classes/applications/NXmonopd", "classes/applications/NXmx", "classes/applications/NXrefscan", "classes/applications/NXreftof", "classes/applications/NXsas", "classes/applications/NXsastof", "classes/applications/NXscan", "classes/applications/NXspe", "classes/applications/NXsqom", "classes/applications/NXstxm", "classes/applications/NXtas", "classes/applications/NXtofnpd", "classes/applications/NXtofraw", "classes/applications/NXtofsingle", "classes/applications/NXtomo", "classes/applications/NXtomophase", "classes/applications/NXtomoproc", "classes/applications/NXxas", "classes/applications/NXxasproc", "classes/applications/NXxbase", "classes/applications/NXxeuler", "classes/applications/NXxkappa", "classes/applications/NXxlaue", "classes/applications/NXxlaueplate", "classes/applications/NXxnb", "classes/applications/NXxrot", "classes/applications/index", "classes/base_classes/NXaperture", "classes/base_classes/NXattenuator", "classes/base_classes/NXbeam", "classes/base_classes/NXbeam_stop", "classes/base_classes/NXbending_magnet", "classes/base_classes/NXcapillary", "classes/base_classes/NXcite", "classes/base_classes/NXcollection", "classes/base_classes/NXcollimator", "classes/base_classes/NXcrystal", "classes/base_classes/NXcylindrical_geometry", "classes/base_classes/NXdata", "classes/base_classes/NXdetector", "classes/base_classes/NXdetector_group", "classes/base_classes/NXdetector_module", "classes/base_classes/NXdisk_chopper", "classes/base_classes/NXentry", "classes/base_classes/NXenvironment", "classes/base_classes/NXevent_data", "classes/base_classes/NXfermi_chopper", "classes/base_classes/NXfilter", "classes/base_classes/NXflipper", "classes/base_classes/NXfresnel_zone_plate", "classes/base_classes/NXgeometry", "classes/base_classes/NXgrating", "classes/base_classes/NXguide", "classes/base_classes/NXinsertion_device", "classes/base_classes/NXinstrument", "classes/base_classes/NXlog", "classes/base_classes/NXmirror", "classes/base_classes/NXmoderator", "classes/base_classes/NXmonitor", "classes/base_classes/NXmonochromator", "classes/base_classes/NXnote", "classes/base_classes/NXobject", "classes/base_classes/NXoff_geometry", "classes/base_classes/NXorientation", "classes/base_classes/NXparameters", "classes/base_classes/NXpdb", "classes/base_classes/NXpinhole", "classes/base_classes/NXpolarizer", "classes/base_classes/NXpositioner", "classes/base_classes/NXprocess", "classes/base_classes/NXreflections", "classes/base_classes/NXroot", "classes/base_classes/NXsample", "classes/base_classes/NXsample_component", "classes/base_classes/NXsensor", "classes/base_classes/NXshape", "classes/base_classes/NXslit", "classes/base_classes/NXsource", "classes/base_classes/NXsubentry", "classes/base_classes/NXtransformations", "classes/base_classes/NXtranslation", "classes/base_classes/NXuser", "classes/base_classes/NXvelocity_selector", "classes/base_classes/NXxraylens", "classes/base_classes/index", "classes/contributed_definitions/NXcontainer", "classes/contributed_definitions/NXcsg", "classes/contributed_definitions/NXcxi_ptycho", "classes/contributed_definitions/NXelectrostatic_kicker", "classes/contributed_definitions/NXmagnetic_kicker", "classes/contributed_definitions/NXquadric", "classes/contributed_definitions/NXquadrupole_magnet", "classes/contributed_definitions/NXseparator", "classes/contributed_definitions/NXsnsevent", "classes/contributed_definitions/NXsnshisto", "classes/contributed_definitions/NXsolenoid_magnet", "classes/contributed_definitions/NXsolid_geometry", "classes/contributed_definitions/NXspecdata", "classes/contributed_definitions/NXspin_rotator", "classes/contributed_definitions/index", "classes/index", "colophon", "community", "copyright", "datarules", "defs_intro", "design", "docs_about", "examples/code_napi", "examples/code_native", "examples/epics/index", "examples/h5py/index", "examples/h5py/writer_1_3", "examples/h5py/writer_2_1", "examples/index", "examples/lrmecs/index", "examples/matlab/index", "faq", "fileformat", "github", "history", "index", "installation", "introduction", "introduction-napi", "issues", "mailinglist", "motivations", "napi", "napi-c", "napi-f77", "napi-f90", "napi-idl", "napi-java", "niac", "nxdl", "nxdl-types", "nxdl_desc", "preface", "ref_doc", "revhistory", "rules", "strategies", "user_manual", "utilities", "validation"], "filenames": ["applying-nexus.rst", "authorgroup.rst", "classes/applications/NXarchive.rst", "classes/applications/NXarpes.rst", "classes/applications/NXcanSAS.rst", "classes/applications/NXdirecttof.rst", "classes/applications/NXfluo.rst", "classes/applications/NXindirecttof.rst", "classes/applications/NXiqproc.rst", "classes/applications/NXlauetof.rst", "classes/applications/NXmonopd.rst", "classes/applications/NXmx.rst", "classes/applications/NXrefscan.rst", "classes/applications/NXreftof.rst", "classes/applications/NXsas.rst", "classes/applications/NXsastof.rst", "classes/applications/NXscan.rst", "classes/applications/NXspe.rst", "classes/applications/NXsqom.rst", "classes/applications/NXstxm.rst", "classes/applications/NXtas.rst", "classes/applications/NXtofnpd.rst", "classes/applications/NXtofraw.rst", "classes/applications/NXtofsingle.rst", "classes/applications/NXtomo.rst", "classes/applications/NXtomophase.rst", "classes/applications/NXtomoproc.rst", "classes/applications/NXxas.rst", "classes/applications/NXxasproc.rst", "classes/applications/NXxbase.rst", "classes/applications/NXxeuler.rst", "classes/applications/NXxkappa.rst", "classes/applications/NXxlaue.rst", "classes/applications/NXxlaueplate.rst", "classes/applications/NXxnb.rst", "classes/applications/NXxrot.rst", "classes/applications/index.rst", "classes/base_classes/NXaperture.rst", "classes/base_classes/NXattenuator.rst", "classes/base_classes/NXbeam.rst", "classes/base_classes/NXbeam_stop.rst", "classes/base_classes/NXbending_magnet.rst", "classes/base_classes/NXcapillary.rst", "classes/base_classes/NXcite.rst", "classes/base_classes/NXcollection.rst", "classes/base_classes/NXcollimator.rst", "classes/base_classes/NXcrystal.rst", "classes/base_classes/NXcylindrical_geometry.rst", "classes/base_classes/NXdata.rst", "classes/base_classes/NXdetector.rst", "classes/base_classes/NXdetector_group.rst", "classes/base_classes/NXdetector_module.rst", "classes/base_classes/NXdisk_chopper.rst", "classes/base_classes/NXentry.rst", "classes/base_classes/NXenvironment.rst", "classes/base_classes/NXevent_data.rst", "classes/base_classes/NXfermi_chopper.rst", "classes/base_classes/NXfilter.rst", "classes/base_classes/NXflipper.rst", "classes/base_classes/NXfresnel_zone_plate.rst", "classes/base_classes/NXgeometry.rst", "classes/base_classes/NXgrating.rst", "classes/base_classes/NXguide.rst", "classes/base_classes/NXinsertion_device.rst", "classes/base_classes/NXinstrument.rst", "classes/base_classes/NXlog.rst", "classes/base_classes/NXmirror.rst", "classes/base_classes/NXmoderator.rst", "classes/base_classes/NXmonitor.rst", "classes/base_classes/NXmonochromator.rst", "classes/base_classes/NXnote.rst", "classes/base_classes/NXobject.rst", "classes/base_classes/NXoff_geometry.rst", "classes/base_classes/NXorientation.rst", "classes/base_classes/NXparameters.rst", "classes/base_classes/NXpdb.rst", "classes/base_classes/NXpinhole.rst", "classes/base_classes/NXpolarizer.rst", "classes/base_classes/NXpositioner.rst", "classes/base_classes/NXprocess.rst", "classes/base_classes/NXreflections.rst", "classes/base_classes/NXroot.rst", "classes/base_classes/NXsample.rst", "classes/base_classes/NXsample_component.rst", "classes/base_classes/NXsensor.rst", "classes/base_classes/NXshape.rst", "classes/base_classes/NXslit.rst", "classes/base_classes/NXsource.rst", "classes/base_classes/NXsubentry.rst", "classes/base_classes/NXtransformations.rst", "classes/base_classes/NXtranslation.rst", "classes/base_classes/NXuser.rst", "classes/base_classes/NXvelocity_selector.rst", "classes/base_classes/NXxraylens.rst", "classes/base_classes/index.rst", "classes/contributed_definitions/NXcontainer.rst", "classes/contributed_definitions/NXcsg.rst", "classes/contributed_definitions/NXcxi_ptycho.rst", "classes/contributed_definitions/NXelectrostatic_kicker.rst", "classes/contributed_definitions/NXmagnetic_kicker.rst", "classes/contributed_definitions/NXquadric.rst", "classes/contributed_definitions/NXquadrupole_magnet.rst", "classes/contributed_definitions/NXseparator.rst", "classes/contributed_definitions/NXsnsevent.rst", "classes/contributed_definitions/NXsnshisto.rst", "classes/contributed_definitions/NXsolenoid_magnet.rst", "classes/contributed_definitions/NXsolid_geometry.rst", "classes/contributed_definitions/NXspecdata.rst", "classes/contributed_definitions/NXspin_rotator.rst", "classes/contributed_definitions/index.rst", "classes/index.rst", "colophon.rst", "community.rst", "copyright.rst", "datarules.rst", "defs_intro.rst", "design.rst", "docs_about.rst", "examples/code_napi.rst", "examples/code_native.rst", "examples/epics/index.rst", "examples/h5py/index.rst", "examples/h5py/writer_1_3.rst", "examples/h5py/writer_2_1.rst", "examples/index.rst", "examples/lrmecs/index.rst", "examples/matlab/index.rst", "faq.rst", "fileformat.rst", "github.rst", "history.rst", "index.rst", "installation.rst", "introduction.rst", "introduction-napi.rst", "issues.rst", "mailinglist.rst", "motivations.rst", "napi.rst", "napi-c.rst", "napi-f77.rst", "napi-f90.rst", "napi-idl.rst", "napi-java.rst", "niac.rst", "nxdl.rst", "nxdl-types.rst", "nxdl_desc.rst", "preface.rst", "ref_doc.rst", "revhistory.rst", "rules.rst", "strategies.rst", "user_manual.rst", "utilities.rst", "validation.rst"], "titles": ["1.3. Constructing NeXus Files and Application Definitions", "9.1. Authors", "3.3.2.1. NXarchive", "3.3.2.2. NXarpes", "3.3.2.3. NXcanSAS", "3.3.2.4. NXdirecttof", "3.3.2.5. NXfluo", "3.3.2.6. NXindirecttof", "3.3.2.7. NXiqproc", "3.3.2.8. NXlauetof", "3.3.2.9. NXmonopd", "3.3.2.10. NXmx", "3.3.2.11. NXrefscan", "3.3.2.12. NXreftof", "3.3.2.13. NXsas", "3.3.2.14. NXsastof", "3.3.2.15. NXscan", "3.3.2.16. NXspe", "3.3.2.17. NXsqom", "3.3.2.18. NXstxm", "3.3.2.19. NXtas", "3.3.2.20. NXtofnpd", "3.3.2.21. NXtofraw", "3.3.2.22. NXtofsingle", "3.3.2.23. NXtomo", "3.3.2.24. NXtomophase", "3.3.2.25. NXtomoproc", "3.3.2.26. NXxas", "3.3.2.27. NXxasproc", "3.3.2.28. NXxbase", "3.3.2.29. NXxeuler", "3.3.2.30. NXxkappa", "3.3.2.31. NXxlaue", "3.3.2.32. NXxlaueplate", "3.3.2.33. NXxnb", "3.3.2.34. NXxrot", "3.3.2. Application Definitions", "3.3.1.1. NXaperture", "3.3.1.2. NXattenuator", "3.3.1.3. NXbeam", "3.3.1.4. NXbeam_stop", "3.3.1.5. NXbending_magnet", "3.3.1.6. NXcapillary", "3.3.1.7. NXcite", "3.3.1.8. NXcollection", "3.3.1.9. NXcollimator", "3.3.1.10. NXcrystal", "3.3.1.11. NXcylindrical_geometry", "3.3.1.12. NXdata", "3.3.1.13. NXdetector", "3.3.1.14. NXdetector_group", "3.3.1.15. NXdetector_module", "3.3.1.16. NXdisk_chopper", "3.3.1.17. NXentry", "3.3.1.18. NXenvironment", "3.3.1.19. NXevent_data", "3.3.1.20. NXfermi_chopper", "3.3.1.21. NXfilter", "3.3.1.22. NXflipper", "3.3.1.23. NXfresnel_zone_plate", "3.3.1.24. NXgeometry", "3.3.1.25. NXgrating", "3.3.1.26. NXguide", "3.3.1.27. NXinsertion_device", "3.3.1.28. NXinstrument", "3.3.1.29. NXlog", "3.3.1.30. NXmirror", "3.3.1.31. NXmoderator", "3.3.1.32. NXmonitor", "3.3.1.33. NXmonochromator", "3.3.1.34. NXnote", "3.3.1.35. NXobject", "3.3.1.36. NXoff_geometry", "3.3.1.37. NXorientation", "3.3.1.38. NXparameters", "3.3.1.39. NXpdb", "3.3.1.40. NXpinhole", "3.3.1.41. NXpolarizer", "3.3.1.42. NXpositioner", "3.3.1.43. NXprocess", "3.3.1.44. NXreflections", "3.3.1.45. NXroot", "3.3.1.46. NXsample", "3.3.1.47. NXsample_component", "3.3.1.48. NXsensor", "3.3.1.49. NXshape", "3.3.1.50. NXslit", "3.3.1.51. NXsource", "3.3.1.52. NXsubentry", "3.3.1.53. NXtransformations", "3.3.1.54. NXtranslation", "3.3.1.55. NXuser", "3.3.1.56. NXvelocity_selector", "3.3.1.57. NXxraylens", "3.3.1. Base Class Definitions", "3.3.3.1. NXcontainer", "3.3.3.2. NXcsg", "3.3.3.3. NXcxi_ptycho", "3.3.3.4. NXelectrostatic_kicker", "3.3.3.5. NXmagnetic_kicker", "3.3.3.6. NXquadric", "3.3.3.7. NXquadrupole_magnet", "3.3.3.8. NXseparator", "3.3.3.9. NXsnsevent", "3.3.3.10. NXsnshisto", "3.3.3.11. NXsolenoid_magnet", "3.3.3.12. NXsolid_geometry", "3.3.3.13. NXspecdata", "3.3.3.14. NXspin_rotator", "3.3.3. Contributed Definitions", "3.3. NeXus Class Definitions", "9.2. Colophon", "5. NeXus Community", "9.4. Copyright and Licenses", "1.2.3.2. Rules for Storing Data Items in NeXus Files", "3.1. Introduction to NeXus definitions", "1.2. NeXus Design", "9. About these docs", "2.2.1. Example NeXus programs using NAPI", "2.1.1. Example NeXus C programs using native HDF5 commands", "2.1.5. EPICS Area Detector Examples", "2.1.2. Python Examples using h5py", "h5py example writing the simplest NeXus data file", "h5py example writing a simple NeXus data file with links", "2. Examples of writing and reading NeXus data files", "2.1.4. Viewing 2-D Data from LRMECS", "2.1.3. MATLAB Examples", "1.6. Frequently Asked Questions", "1.2.3.3. Physical File format", "5.3.6. NeXus Repositories", "8. Brief history of NeXus", "User Manual and Reference Documentation", "6. Installation", "1.1. NeXus Introduction", "NAPI: The NeXus Application Programming Interface", "5.3.7. NeXus Issue Reporting", "5.3.2. NeXus Mailing List", "Motivations for the NeXus standard in the Scientific Community", "4. NAPI: NeXus Application Programmer Interface (frozen)", "4.3.1. NAPI C and C++ Interface", "4.3.2. NAPI Fortran 77 Interface", "4.3.3. NAPI Fortran 90 Interface", "4.3.5. NAPI IDL Interface", "4.3.4. NAPI Java Interface", "5.3.1. NIAC: The NeXus International Advisory Committee", "3.2. NXDL: The NeXus Definition Language", "3.2.1.2. NXDL Field Types and Units", "3.2.1.1. NXDL Elements and Field Types", "Representation of data examples", "3. NeXus: Reference Documentation", "9.3. Revision History", "1.2.3.1. Rules for Structuring Information in NeXus Files", "1.4. Strategies for storing information in NeXus data files", "1. NeXus: User Manual", "7. NeXus Utilities", "1.5. Verification and validation of files"], "terms": {"In": [0, 4, 11, 16, 21, 22, 23, 24, 25, 29, 36, 37, 38, 47, 49, 53, 55, 65, 72, 75, 82, 83, 88, 89, 95, 110, 114, 115, 116, 119, 120, 121, 122, 123, 124, 125, 127, 128, 130, 132, 133, 134, 136, 137, 138, 143, 144, 145, 146, 147, 148, 151, 152, 154], "design": [0, 4, 48, 89, 112, 114, 115, 123, 126, 128, 130, 131, 136, 137, 145, 146, 153, 154], "we": [0, 4, 5, 11, 50, 52, 60, 73, 82, 83, 90, 114, 116, 118, 120, 121, 123, 124, 125, 126, 127, 128, 130, 133, 134, 136, 147, 148, 151, 152], "discuss": [0, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 112, 114, 116, 130, 133, 136, 152, 154], "format": [0, 2, 4, 17, 36, 43, 53, 65, 72, 88, 91, 97, 107, 112, 114, 115, 118, 120, 121, 124, 125, 127, 130, 131, 133, 136, 138, 143, 144, 147, 148, 152, 154, 155], "gener": [0, 2, 4, 8, 11, 16, 18, 19, 22, 23, 36, 44, 49, 53, 60, 62, 73, 78, 85, 88, 89, 90, 94, 109, 110, 113, 114, 115, 116, 119, 120, 122, 123, 124, 129, 132, 133, 136, 137, 138, 145, 146, 147, 154], "term": [0, 4, 36, 44, 46, 49, 74, 89, 94, 109, 110, 113, 114, 115, 127, 132, 133, 145, 146, 147, 152], "section": [0, 4, 11, 38, 48, 50, 53, 62, 88, 107, 114, 115, 116, 118, 120, 121, 122, 123, 124, 127, 128, 132, 133, 134, 137, 143, 146, 147, 151, 152, 154], "more": [0, 3, 4, 11, 16, 19, 29, 48, 49, 52, 53, 62, 75, 76, 81, 86, 88, 89, 91, 107, 110, 114, 115, 116, 120, 121, 122, 125, 127, 133, 134, 137, 143, 144, 145, 146, 147, 151, 154, 155], "tutori": [0, 127, 143, 145], "style": [0, 97, 107, 116, 126, 134, 154], "introduct": [0, 11, 116, 119, 121, 122, 124, 131, 143, 149, 153], "how": [0, 4, 11, 46, 48, 49, 53, 59, 79, 85, 88, 95, 107, 111, 112, 114, 116, 118, 119, 120, 121, 122, 127, 128, 132, 133, 137, 143, 145, 147, 148, 152], "i": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 100, 103, 104, 107, 109, 110, 111, 112, 113, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 135, 136, 137, 138, 139, 141, 142, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "given": [0, 11, 16, 36, 39, 49, 50, 51, 62, 66, 82, 89, 94, 100, 109, 114, 115, 116, 119, 120, 121, 127, 133, 147, 154, 155], "As": [0, 11, 18, 55, 82, 83, 95, 110, 112, 114, 116, 121, 122, 125, 127, 133, 137, 141, 143, 148, 151], "exampl": [0, 4, 11, 16, 43, 46, 47, 48, 49, 50, 53, 62, 65, 72, 75, 84, 87, 88, 89, 95, 97, 107, 110, 111, 113, 115, 116, 125, 127, 128, 131, 134, 137, 138, 143, 145, 146, 147, 151, 152, 154], "hypothet": [0, 88, 95, 123, 152], "name": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 45, 48, 49, 50, 53, 54, 60, 64, 70, 75, 78, 79, 80, 81, 82, 83, 84, 87, 88, 89, 91, 95, 97, 103, 104, 107, 110, 116, 118, 119, 120, 121, 122, 125, 126, 127, 128, 130, 133, 134, 137, 138, 141, 143, 145, 148, 151, 154], "If": [0, 4, 11, 19, 21, 22, 23, 38, 46, 47, 48, 49, 53, 55, 57, 59, 65, 72, 75, 76, 80, 82, 83, 86, 88, 89, 95, 110, 111, 114, 115, 116, 120, 127, 129, 132, 133, 134, 138, 143, 145, 146, 147, 148, 151, 152], "you": [0, 4, 110, 111, 114, 116, 118, 119, 120, 122, 125, 127, 129, 132, 133, 134, 136, 138, 143, 145, 147, 148, 151, 152, 154], "ar": [0, 4, 8, 10, 11, 16, 19, 24, 25, 29, 30, 34, 36, 40, 46, 47, 48, 49, 50, 52, 55, 57, 60, 62, 64, 65, 68, 69, 72, 73, 75, 80, 82, 83, 84, 85, 88, 89, 90, 91, 94, 95, 97, 107, 110, 112, 113, 115, 116, 118, 119, 120, 121, 122, 123, 124, 126, 127, 128, 129, 132, 133, 134, 135, 136, 137, 138, 140, 141, 142, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "look": [0, 48, 116, 123, 127, 128, 143, 145, 152], "read": [0, 4, 11, 48, 49, 55, 68, 70, 82, 84, 98, 99, 101, 102, 105, 108, 114, 116, 118, 120, 127, 128, 130, 131, 133, 138, 145, 148, 151, 154], "write": [0, 4, 11, 16, 36, 48, 81, 107, 110, 114, 116, 127, 128, 130, 131, 133, 137, 138, 152, 154], "api": [0, 81, 114, 119, 123, 128, 130, 131, 132, 133, 134, 137, 140, 141, 142], "consult": [0, 114, 125, 127, 143], "napi": [0, 81, 112, 114, 116, 119, 121, 122, 127, 128, 130, 131, 132, 133, 146, 147, 154, 155], "programm": [0, 112, 114, 116, 124, 127, 128, 130, 131, 133, 134, 143, 147], "interfac": [0, 112, 116, 118, 119, 124, 126, 128, 130, 131, 133, 136, 144, 154], "frozen": [0, 107, 124, 131, 134], "chapter": [0, 114, 116, 119, 121, 122, 123, 124, 126, 128, 133, 134, 145, 152], "For": [0, 4, 11, 16, 20, 24, 43, 44, 47, 48, 49, 50, 53, 57, 62, 69, 75, 76, 83, 84, 85, 86, 87, 88, 89, 90, 94, 95, 97, 107, 110, 114, 115, 116, 118, 121, 125, 127, 128, 132, 133, 134, 137, 142, 143, 144, 145, 147, 148, 151, 152], "code": [0, 50, 54, 60, 79, 84, 91, 112, 113, 114, 118, 119, 122, 123, 129, 131, 134, 137, 138, 139, 140, 141, 142, 143, 152, 154], "refer": [0, 4, 9, 37, 38, 40, 43, 45, 48, 49, 52, 60, 62, 66, 67, 68, 73, 76, 80, 86, 87, 94, 95, 107, 111, 114, 115, 116, 120, 121, 122, 123, 124, 127, 128, 133, 143, 144, 147, 148, 151], "altern": [0, 4, 11, 48, 50, 51, 53, 54, 114, 116, 120, 132, 147], "c": [0, 9, 29, 46, 47, 57, 67, 82, 83, 87, 95, 107, 113, 115, 116, 124, 125, 128, 130, 134, 138, 141, 143, 146, 147, 154, 155], "program": [0, 2, 8, 17, 18, 26, 28, 36, 53, 54, 79, 81, 84, 88, 114, 115, 116, 120, 121, 122, 124, 125, 127, 130, 131, 133, 136, 137, 141, 144, 145, 148, 151, 154, 155], "nativ": [0, 118, 124, 128, 134, 137, 138, 143], "hdf5": [0, 4, 81, 89, 97, 107, 110, 114, 115, 116, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 133, 134, 137, 138, 143, 147, 148, 152, 155], "command": [0, 78, 103, 104, 107, 118, 121, 122, 124, 125, 128, 132, 134, 138, 143, 154], "further": [0, 4, 8, 11, 48, 50, 114, 116, 121, 133, 134, 142, 145, 147, 151, 154], "also": [0, 4, 11, 36, 48, 60, 62, 64, 65, 68, 74, 76, 86, 89, 95, 110, 114, 115, 116, 119, 120, 121, 124, 125, 126, 127, 131, 133, 134, 137, 138, 143, 145, 147, 148, 151, 152, 154], "some": [0, 4, 11, 24, 25, 26, 29, 36, 46, 49, 53, 65, 88, 107, 112, 114, 115, 116, 119, 120, 121, 122, 123, 127, 128, 133, 134, 143, 147, 148, 151, 152, 154, 155], "python": [0, 81, 107, 114, 122, 123, 124, 126, 128, 130, 133, 134, 137, 138, 155], "h5py": [0, 81, 107, 114, 124, 126, 128, 133, 137, 154], "packag": [0, 4, 81, 107, 121, 122, 124, 125, 127, 132, 133, 154], "consid": [0, 4, 36, 46, 62, 87, 94, 109, 110, 114, 116, 127, 147, 148, 151, 152], "yourself": [0, 127, 134, 143], "respons": [0, 48, 91, 116, 133, 152], "task": [0, 18, 137], "ensur": [0, 97, 114, 138, 144, 145, 155], "record": [0, 4, 11, 24, 46, 52, 55, 65, 78, 80, 82, 83, 94, 133, 137, 138, 151], "accord": [0, 2, 9, 16, 29, 85, 97, 110, 112, 114, 122, 123, 126, 127, 144, 154], "sake": 0, "simplic": [0, 121], "bear": 0, "strong": [0, 80], "resembl": 0, "simpl": [0, 46, 57, 76, 79, 80, 82, 86, 94, 114, 115, 121, 122, 124, 125, 126, 127, 128, 134, 138, 145, 147, 148, 152, 154], "powder": [0, 10, 21, 22, 23, 36, 82, 116, 151], "diffractomet": [0, 9, 10, 21, 30, 31, 34, 36, 64, 82, 89, 107, 116, 151], "let": [0, 9, 29, 52, 120, 121, 143, 151, 152], "": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 36, 48, 49, 57, 62, 82, 84, 87, 95, 107, 110, 114, 116, 119, 120, 121, 126, 127, 130, 132, 143, 146, 147, 148, 151], "pretend": 0, "cannot": [0, 4, 110, 114, 118, 143, 146, 147, 151], "ani": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 36, 37, 38, 40, 42, 44, 45, 46, 47, 48, 49, 52, 53, 57, 58, 59, 61, 62, 63, 66, 67, 68, 70, 72, 81, 82, 83, 84, 85, 87, 88, 89, 93, 94, 95, 96, 97, 100, 107, 109, 111, 114, 116, 120, 125, 127, 129, 133, 134, 136, 137, 138, 141, 145, 146, 147, 151, 152, 154, 155], "exist": [0, 4, 16, 48, 53, 62, 81, 88, 107, 114, 116, 121, 123, 126, 137, 138, 147, 154], "fiction": 0, "collim": [0, 4, 14, 15, 45, 64, 94, 133], "monochrom": [0, 3, 6, 12, 14, 19, 20, 27, 29, 46, 61, 64, 69, 94, 116, 147, 151, 152], "illumin": 0, "sampl": [0, 2, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 38, 39, 46, 49, 53, 60, 64, 68, 75, 82, 83, 84, 87, 88, 89, 90, 94, 95, 97, 103, 104, 107, 109, 114, 116, 127, 133, 134, 143, 147, 148, 151, 152], "neutron": [0, 1, 2, 4, 8, 10, 11, 12, 14, 15, 18, 20, 21, 24, 25, 26, 29, 36, 39, 47, 52, 53, 55, 58, 62, 67, 68, 87, 92, 94, 103, 104, 109, 112, 116, 127, 128, 130, 133, 134, 136, 137, 144, 145, 146, 152, 154], "select": [0, 3, 5, 11, 48, 56, 69, 84, 104, 114, 115, 125, 137, 147, 148, 151, 152], "wavelength": [0, 4, 6, 10, 11, 12, 14, 29, 32, 39, 46, 49, 52, 56, 57, 62, 63, 66, 68, 69, 82, 83, 87, 92, 94, 95, 103, 104, 116, 127, 133, 146, 147, 148], "diffract": [0, 10, 46, 61, 69, 80, 94, 107, 116, 151], "beam": [0, 4, 10, 11, 14, 15, 19, 24, 25, 27, 32, 34, 35, 36, 38, 39, 40, 41, 42, 44, 46, 49, 52, 53, 56, 57, 60, 61, 62, 63, 64, 68, 76, 82, 84, 87, 88, 92, 93, 94, 95, 97, 107, 114, 116, 121, 152], "collect": [0, 2, 4, 11, 14, 49, 53, 64, 84, 88, 89, 94, 95, 103, 104, 107, 116, 120, 121, 151, 152, 154], "larg": [0, 116, 127, 128, 147, 152, 154], "banana": 0, "shape": [0, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 40, 45, 46, 47, 48, 49, 52, 60, 61, 62, 66, 67, 72, 85, 87, 94, 95, 97, 103, 104, 114, 115, 147], "posit": [0, 4, 10, 11, 14, 15, 18, 19, 21, 22, 23, 24, 35, 37, 38, 40, 41, 42, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 72, 73, 76, 77, 78, 80, 82, 84, 86, 87, 88, 89, 90, 92, 93, 95, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116, 123, 138, 146, 147, 151, 152], "sensit": [0, 10, 121], "detector": [0, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 29, 30, 31, 33, 34, 35, 36, 40, 43, 47, 49, 50, 51, 53, 55, 64, 68, 72, 80, 82, 88, 89, 94, 97, 103, 104, 107, 115, 118, 121, 123, 124, 126, 133, 137, 147, 148, 152], "typic": [0, 4, 11, 19, 46, 49, 93, 94, 107, 115, 116, 133], "like": [0, 4, 10, 11, 16, 18, 39, 49, 54, 82, 83, 94, 114, 116, 119, 126, 127, 129, 133, 143, 146, 151, 152], "plot": [0, 4, 19, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 114, 120, 123, 126, 127, 130, 133, 147, 148, 151, 152, 154], "from": [0, 4, 5, 6, 7, 8, 9, 10, 11, 13, 14, 15, 16, 18, 19, 21, 22, 23, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 41, 46, 48, 49, 52, 53, 55, 57, 64, 68, 70, 74, 75, 80, 81, 82, 83, 87, 88, 89, 94, 95, 97, 98, 99, 101, 102, 103, 104, 105, 107, 108, 109, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 126, 127, 130, 131, 132, 133, 134, 137, 138, 141, 142, 143, 145, 146, 147, 151, 152, 154, 155], "hyne": 0, "There": [0, 4, 24, 48, 55, 65, 88, 89, 97, 112, 114, 116, 120, 127, 130, 133, 134, 136, 145, 146, 148, 151, 154], "background": [0, 11, 49, 80, 133], "plu": [0, 18, 30, 31, 34, 35, 41], "quit": [0, 114, 121, 127, 130, 134, 145, 152], "number": [0, 3, 4, 6, 7, 8, 9, 10, 11, 12, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 41, 46, 47, 48, 49, 50, 51, 52, 53, 54, 56, 57, 58, 62, 63, 72, 73, 79, 80, 81, 82, 83, 84, 87, 88, 91, 92, 93, 95, 97, 103, 104, 107, 112, 116, 122, 124, 127, 128, 130, 133, 138, 141, 143, 146, 147, 148, 151, 152], "peak": [0, 63, 80], "start": [0, 2, 3, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 35, 49, 50, 52, 53, 55, 65, 68, 70, 72, 79, 88, 89, 97, 103, 104, 107, 110, 114, 116, 120, 121, 122, 125, 127, 130, 132, 134, 143, 147, 151, 154], "point": [0, 4, 11, 12, 16, 18, 19, 20, 25, 27, 28, 29, 30, 31, 34, 35, 36, 37, 38, 40, 41, 42, 45, 46, 47, 49, 51, 52, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 83, 84, 86, 87, 89, 90, 92, 93, 97, 107, 114, 115, 116, 120, 121, 122, 123, 127, 137, 143, 146, 147, 148, 151], "empti": [0, 95, 120, 147], "basic": [0, 48, 114, 115, 116, 121, 127, 128, 130, 134, 137, 138, 143, 144, 147, 151, 154], "document": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 113, 114, 115, 116, 124, 125, 126, 130, 132, 133, 134, 137, 138, 139, 144, 147, 148, 151, 154, 155], "next": [0, 51, 114, 116, 118, 120, 121, 122, 123, 125, 127, 134, 141, 151], "figur": [0, 4, 61, 66, 95, 107, 110, 116, 121, 122, 123, 125, 126, 147, 151], "order": [0, 11, 19, 24, 25, 30, 34, 46, 48, 49, 51, 55, 57, 61, 65, 70, 72, 79, 82, 83, 95, 100, 112, 115, 116, 118, 119, 121, 137, 138, 141, 143, 147, 151], "arriv": [0, 65, 130], "follow": [0, 4, 11, 16, 24, 46, 49, 57, 75, 76, 80, 82, 83, 86, 89, 95, 114, 115, 116, 118, 121, 122, 123, 125, 127, 133, 134, 138, 141, 142, 143, 144, 146, 147, 148, 151], "requir": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 46, 47, 48, 49, 53, 75, 89, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 110, 114, 115, 116, 122, 126, 127, 132, 133, 137, 138, 145, 146, 151, 152, 155], "each": [0, 3, 4, 11, 12, 13, 14, 15, 16, 18, 19, 21, 22, 23, 24, 25, 27, 28, 29, 30, 31, 34, 35, 36, 37, 39, 46, 47, 48, 49, 50, 51, 52, 53, 55, 57, 61, 62, 64, 66, 72, 75, 82, 83, 88, 89, 94, 95, 97, 107, 109, 110, 114, 115, 116, 118, 119, 120, 121, 122, 124, 132, 133, 134, 137, 141, 143, 146, 147, 148, 151, 152, 154], "compon": [0, 4, 21, 22, 23, 37, 38, 39, 40, 41, 42, 45, 46, 47, 49, 51, 52, 53, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 72, 73, 75, 76, 77, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93, 94, 96, 110, 114, 116, 122, 128, 133, 137, 138, 145, 147, 151], "group": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 112, 118, 119, 120, 121, 122, 123, 125, 126, 127, 128, 130, 133, 134, 137, 138, 143, 144, 145, 148, 154], "add": [0, 4, 114, 116, 120, 121, 123, 126, 133, 134, 143, 146, 147], "nxinstrument": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 53, 88, 89, 94, 97, 103, 104, 107, 110, 114, 116, 120, 121, 123, 126, 127, 133, 134, 147, 148, 151, 152], "what": [0, 4, 26, 62, 114, 120, 122, 127, 147, 148, 151], "go": [0, 55, 116, 119, 127, 132, 136, 145, 147], "while": [0, 4, 19, 48, 64, 110, 114, 115, 121, 125, 127, 130, 137, 143, 147, 148, 151, 154], "option": [0, 4, 5, 10, 11, 19, 24, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 115, 116, 118, 120, 122, 125, 127, 132, 142, 143, 145, 151, 154], "urg": 0, "strongli": [0, 11, 53, 127, 137], "provid": [0, 2, 4, 11, 19, 21, 22, 23, 36, 37, 38, 42, 48, 49, 50, 53, 75, 88, 93, 96, 109, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 127, 128, 130, 133, 134, 137, 138, 139, 145, 147, 151, 154], "support": [0, 11, 30, 34, 59, 81, 114, 116, 120, 121, 122, 123, 124, 126, 127, 128, 130, 134, 137, 138, 147, 151, 152, 154], "default": [0, 4, 11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 114, 115, 116, 120, 123, 125, 126, 127, 130, 132, 133, 137, 143, 146, 147, 148, 151, 152, 154], "nxsampl": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 34, 35, 39, 53, 75, 83, 88, 94, 97, 103, 104, 116, 127, 133, 134, 148, 151, 152], "nxmonitor": [0, 6, 9, 10, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 53, 88, 94, 97, 103, 104, 107, 127, 133, 134, 151], "structur": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 111, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 133, 134, 137, 138, 144, 145, 147, 148, 152, 154, 155], "entri": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 48, 49, 53, 55, 62, 65, 66, 68, 72, 75, 81, 82, 86, 88, 89, 91, 97, 103, 104, 107, 110, 114, 116, 118, 120, 121, 122, 123, 126, 127, 128, 133, 143, 147, 148, 151, 152], "nxentri": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 48, 75, 81, 88, 94, 95, 97, 103, 104, 107, 110, 114, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 133, 134, 143, 147, 148, 152], "now": [0, 24, 48, 60, 73, 94, 114, 116, 120, 121, 128, 130, 132, 136, 154], "variou": [0, 4, 8, 64, 82, 83, 107, 116, 122, 127, 130, 131, 137, 138, 145, 147, 151, 154], "shell": [0, 143], "draw": [0, 4, 116, 137], "identifi": [0, 2, 4, 11, 48, 49, 50, 53, 61, 88, 91, 103, 104, 114, 115, 116, 120, 121, 123, 127, 128, 130, 133, 134, 138, 147, 148, 154], "all": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 112, 114, 115, 116, 119, 121, 122, 124, 126, 127, 130, 132, 133, 134, 136, 137, 138, 143, 144, 145, 147, 151, 154], "etc": [0, 2, 8, 11, 39, 43, 49, 50, 54, 68, 84, 91, 95, 107, 114, 116, 127, 133, 151, 152], "valu": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 38, 39, 40, 42, 45, 46, 48, 49, 51, 52, 53, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 73, 75, 77, 78, 80, 81, 82, 83, 84, 85, 87, 88, 89, 93, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 114, 115, 116, 118, 119, 120, 121, 126, 127, 128, 133, 137, 141, 143, 146, 148, 152, 154], "aim": [0, 110], "experi": [0, 2, 4, 6, 11, 14, 15, 24, 26, 27, 36, 40, 49, 53, 80, 87, 88, 94, 95, 97, 103, 104, 107, 109, 114, 116, 127, 133, 137, 151, 152, 154], "good": [0, 4, 11, 48, 114, 120, 122, 130, 137, 143, 151, 154], "possibl": [0, 4, 18, 49, 53, 60, 89, 110, 114, 115, 116, 122, 127, 133, 137, 147, 151], "strive": [0, 116, 130, 151], "captur": [0, 116, 151], "much": [0, 116, 127, 133, 136, 137, 138, 143, 151], "practic": [0, 4, 24, 52, 53, 60, 116, 137, 143, 147, 151], "With": [0, 4, 49, 55, 88, 114, 122, 134, 137, 145], "manual": [0, 43, 111, 113, 115, 116, 118, 120, 123, 124, 125, 134, 139, 147, 152, 154], "base": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 97, 104, 107, 109, 110, 112, 114, 115, 121, 122, 127, 129, 130, 132, 133, 134, 137, 145, 146, 147, 148, 152, 154, 155], "class": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 112, 114, 115, 121, 122, 127, 128, 129, 130, 131, 134, 138, 143, 144, 145, 146, 147, 149, 151, 152], "find": [0, 48, 53, 88, 110, 116, 120, 127, 133, 137, 138, 143, 148, 151], "your": [0, 20, 29, 110, 114, 116, 120, 124, 127, 132, 133, 143, 151, 152, 154], "suitabl": [0, 14, 107, 147, 151], "togeth": [0, 4, 11, 44, 49, 50, 55, 73, 90, 114, 116, 121, 133, 147, 151], "under": [0, 11, 49, 52, 65, 80, 95, 109, 113, 115, 116, 125, 126, 132, 154, 155], "Then": [0, 110, 114, 116, 121, 134, 143, 147, 151, 152], "match": [0, 48, 52, 55, 65, 72, 114, 143, 147], "them": [0, 24, 95, 107, 112, 114, 120, 121, 129, 130, 133, 138, 143, 151], "wish": [0, 120, 123, 128, 136, 145, 146, 152], "mai": [0, 2, 4, 11, 36, 42, 46, 48, 50, 52, 53, 55, 57, 62, 68, 75, 78, 82, 83, 84, 85, 89, 95, 107, 110, 111, 114, 115, 116, 118, 120, 121, 122, 123, 125, 127, 133, 134, 141, 143, 144, 145, 147, 148, 151, 152, 154, 155], "d": [0, 4, 14, 15, 36, 46, 48, 49, 80, 107, 114, 116, 120, 121, 122, 124, 126, 128, 134, 137, 147, 148, 151, 152], "reflect": [0, 46, 62, 66, 77, 80, 94, 107, 114, 127, 147], "type": [0, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 16, 18, 19, 24, 25, 26, 27, 29, 38, 42, 45, 46, 49, 50, 51, 52, 53, 54, 56, 57, 58, 63, 66, 67, 68, 70, 75, 77, 80, 82, 84, 85, 87, 88, 89, 92, 93, 97, 100, 103, 104, 116, 118, 120, 121, 122, 127, 132, 133, 134, 137, 141, 143, 145, 148, 151, 154], "its": [0, 2, 4, 11, 16, 36, 37, 38, 39, 40, 41, 42, 45, 46, 48, 49, 50, 52, 53, 56, 57, 58, 59, 61, 62, 63, 64, 66, 67, 68, 69, 76, 77, 78, 82, 84, 85, 86, 87, 88, 89, 92, 93, 114, 115, 116, 120, 123, 127, 128, 133, 138, 144, 147, 151, 154, 155], "angl": [0, 3, 4, 7, 9, 10, 12, 13, 14, 15, 16, 17, 19, 20, 21, 22, 23, 24, 25, 30, 31, 34, 35, 36, 42, 45, 46, 48, 49, 52, 57, 61, 62, 66, 73, 80, 82, 85, 89, 92, 95, 103, 104, 107, 114, 116, 118, 121, 123, 127, 133, 145, 146, 147], "toward": [0, 7, 37, 38, 40, 49, 67, 76], "incom": [0, 27, 28, 36], "tell": [0, 120, 122, 125], "nxcrystal": [0, 10, 20, 64, 69, 94, 103, 104, 107, 115, 116, 147, 148, 152], "right": [0, 72, 73, 89, 90, 95, 116, 120, 122, 125, 127], "field": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 118, 121, 122, 127, 128, 133, 134, 137, 144, 145, 148, 151, 152, 154], "can": [0, 2, 4, 8, 9, 11, 14, 15, 16, 19, 21, 22, 23, 26, 29, 35, 37, 38, 46, 47, 48, 49, 50, 53, 57, 61, 62, 65, 68, 70, 72, 75, 76, 79, 82, 83, 84, 86, 88, 94, 95, 97, 114, 115, 116, 118, 120, 121, 122, 124, 125, 127, 129, 132, 133, 134, 137, 138, 140, 141, 143, 145, 147, 151, 152, 154, 155], "found": [0, 11, 48, 107, 114, 116, 132, 133, 134, 143, 147, 154], "after": [0, 2, 18, 48, 49, 64, 85, 103, 104, 107, 115, 119, 125, 127, 130, 133, 141, 142, 151], "ad": [0, 4, 48, 70, 89, 110, 114, 115, 116, 118, 121, 127, 128, 134, 147, 152], "d_space": [0, 46], "rotation_angl": [0, 10, 12, 13, 14, 15, 16, 17, 19, 20, 24, 25, 30, 31, 34, 35, 82, 116, 151], "even": [0, 11, 62, 66, 114, 116, 120, 127, 133, 134, 138, 143, 145, 151, 154, 155], "whole": [0, 11, 47, 49, 72, 114, 116, 151], "miss": [0, 4, 48, 65, 114], "do": [0, 11, 48, 53, 61, 89, 114, 115, 116, 120, 125, 127, 128, 132, 133, 138, 143, 147, 151, 154], "despair": 0, "contact": [0, 91, 94, 111, 127, 132], "suggest": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 34, 35, 44, 48, 62, 75, 84, 91, 95, 97, 103, 104, 114, 115, 116, 121, 137, 147, 152], "give": [0, 11, 16, 21, 22, 23, 29, 41, 49, 51, 53, 75, 88, 107, 114, 116, 121, 133, 143], "littl": [0, 114, 116, 143, 152], "check": [0, 49, 119, 120, 121, 126, 134, 138, 143, 145, 147, 155], "duplic": [0, 36, 97, 110, 114, 123, 127], "suffici": [0, 95, 114, 127, 144], "proce": [0, 114, 143], "enhanc": [0, 116], "A": [0, 4, 11, 36, 37, 38, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 61, 62, 66, 67, 68, 69, 74, 75, 76, 77, 78, 82, 83, 84, 86, 88, 89, 92, 94, 95, 109, 114, 115, 116, 118, 120, 121, 123, 126, 127, 128, 130, 131, 132, 137, 143, 146, 147, 148, 151, 154], "elabor": 0, "suppos": [0, 76, 86, 114, 116, 120, 127, 143], "contain": [0, 4, 11, 16, 19, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 107, 109, 114, 115, 116, 118, 121, 122, 124, 125, 127, 132, 133, 134, 136, 137, 138, 145, 147, 148, 151, 152, 154], "put": [0, 97, 120, 121, 127, 138, 141, 143, 151], "up": [0, 3, 48, 78, 85, 87, 90, 93, 95, 96, 106, 114, 116, 124, 125, 127, 133, 138, 147, 151, 152], "quick": [0, 121, 151], "count": [0, 4, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 24, 25, 27, 29, 46, 48, 49, 57, 68, 82, 83, 95, 103, 104, 107, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 151], "versu": [0, 14, 15, 27, 28, 36, 46], "two": [0, 4, 9, 11, 30, 31, 35, 48, 49, 51, 65, 75, 88, 97, 107, 110, 114, 115, 116, 118, 120, 121, 125, 126, 127, 128, 130, 134, 138, 143, 144, 145, 147, 148, 151], "theta": [0, 4, 9, 30, 31, 35, 107, 116, 134], "polar_angl": [0, 7, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 30, 31, 34, 35, 46, 49, 80, 103, 104, 114, 116, 118, 125, 134, 147, 151], "seen": [0, 49, 67, 87, 116, 154], "link": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 114, 119, 124, 127, 128, 130, 133, 138, 145, 148, 151, 154], "appropri": [0, 11, 19, 26, 48, 75, 89, 104, 114, 116, 120, 123, 127, 138, 143, 146, 147, 151, 152], "item": [0, 4, 11, 46, 48, 57, 60, 110, 115, 116, 120, 121, 122, 125, 127, 133, 138, 143, 144, 145, 151, 154], "case": [0, 4, 10, 11, 36, 38, 47, 49, 52, 62, 65, 72, 75, 82, 83, 89, 107, 109, 110, 114, 115, 116, 121, 122, 123, 127, 128, 132, 133, 134, 137, 138, 146, 147, 148], "both": [0, 4, 10, 14, 19, 48, 64, 65, 68, 73, 103, 104, 114, 115, 116, 123, 127, 129, 133, 137, 138, 143, 144, 145, 146, 148, 151, 152, 154, 155], "live": [0, 107, 116], "nxdetector": [0, 3, 4, 6, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 33, 34, 35, 43, 47, 50, 51, 55, 64, 72, 94, 97, 103, 104, 114, 116, 120, 121, 123, 126, 133, 147, 148, 151, 152], "choos": [0, 38, 116, 123, 125, 127, 128, 147], "probabl": [0, 60, 62], "least": [0, 4, 48, 53, 115, 116, 120, 121, 122, 127, 144, 147, 151], "normal": [0, 3, 9, 11, 29, 34, 49, 72, 89, 107, 114, 116, 119, 123, 129, 147, 151, 152], "experiment": [0, 11, 95, 112, 114, 116, 133, 137, 151], "run": [0, 2, 4, 22, 53, 65, 84, 88, 103, 104, 122, 126, 127, 132, 133, 138, 151, 154], "against": [0, 48, 65, 107, 114, 116, 130, 147, 151, 152, 154, 155], "other": [0, 4, 11, 19, 21, 22, 23, 46, 47, 48, 49, 52, 53, 57, 59, 65, 70, 75, 81, 82, 83, 88, 90, 94, 95, 107, 109, 110, 114, 115, 116, 120, 121, 126, 127, 128, 131, 133, 134, 136, 137, 138, 144, 145, 147, 151, 152, 154], "necessari": [0, 4, 9, 14, 15, 29, 48, 49, 62, 69, 95, 114, 115, 116, 121, 123, 133, 134, 137, 138, 141, 145, 147], "know": [0, 11, 49, 51, 82, 83, 95, 120, 123, 133, 138], "condit": [0, 8, 54, 84, 94, 116, 137], "especi": [0, 39, 49, 116, 143, 151], "monitor": [0, 6, 9, 10, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 52, 53, 57, 68, 82, 84, 88, 94, 97, 103, 104, 107, 116, 127, 133, 151], "convent": [0, 2, 3, 9, 14, 15, 27, 28, 29, 46, 57, 80, 82, 83, 95, 97, 107, 116, 123, 154], "control": [0, 9, 11, 12, 13, 14, 15, 19, 24, 25, 29, 36, 54, 78, 84, 94, 107, 114, 116, 120, 147, 151, 154], "level": [0, 11, 50, 53, 97, 110, 114, 115, 116, 118, 121, 122, 127, 130, 133, 137, 143, 147, 148, 151, 154], "addit": [0, 4, 11, 37, 48, 49, 53, 54, 60, 70, 82, 88, 89, 94, 110, 114, 115, 116, 121, 122, 123, 126, 130, 133, 136, 145, 146, 147, 152, 154], "within": [0, 4, 11, 16, 19, 39, 46, 57, 82, 83, 88, 89, 95, 114, 115, 116, 118, 120, 123, 127, 133, 134, 137, 138, 142, 145, 147], "thei": [0, 11, 49, 55, 62, 65, 68, 84, 91, 95, 107, 114, 116, 126, 127, 133, 137, 138, 142, 143, 145, 146, 147, 151, 152, 154, 155], "out": [0, 4, 34, 38, 40, 48, 53, 55, 57, 88, 103, 104, 107, 114, 116, 119, 121, 122, 126, 127, 132, 143, 146, 147, 148, 151, 154], "titl": [0, 2, 3, 4, 5, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 48, 49, 53, 70, 82, 87, 88, 97, 103, 104, 107, 114, 116, 121, 125, 131, 133, 134, 137, 145, 146, 148, 151], "user": [0, 2, 4, 11, 21, 22, 23, 49, 53, 82, 88, 89, 91, 94, 103, 104, 107, 110, 115, 116, 118, 123, 125, 127, 128, 130, 133, 134, 137, 138, 144, 147, 151, 154, 155], "time": [0, 2, 3, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 36, 38, 39, 46, 48, 49, 52, 53, 55, 57, 65, 68, 78, 79, 81, 82, 84, 87, 88, 94, 95, 97, 98, 99, 103, 104, 107, 115, 116, 118, 120, 121, 122, 123, 130, 133, 134, 137, 143, 146, 147, 151, 154, 155], "desir": [0, 76, 86, 114, 116, 121], "sourc": [0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 111, 115, 116, 120, 126, 127, 129, 131, 134, 135, 136, 137, 142, 143, 145, 146, 147, 148, 151, 154], "anoth": [0, 4, 19, 21, 22, 23, 48, 53, 73, 75, 88, 114, 116, 120, 121, 123, 125, 127, 130, 134, 137, 138, 143, 145, 146, 147, 151, 152, 154], "descript": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 114, 120, 121, 122, 123, 126, 130, 134, 137, 138, 141, 147, 148, 152, 154], "verifi": 0, "conform": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 107, 115, 116, 118, 121, 144, 145, 147, 148, 155], "encapsul": [0, 133], "similar": [0, 4, 68, 120, 121, 133, 134, 138, 147, 151], "one": [0, 4, 11, 19, 24, 29, 48, 49, 51, 52, 53, 75, 77, 78, 81, 82, 87, 88, 89, 91, 107, 114, 115, 116, 120, 121, 122, 124, 127, 130, 133, 138, 143, 146, 147, 148, 151, 152, 154], "abov": [0, 4, 11, 16, 49, 82, 97, 110, 114, 115, 116, 118, 120, 121, 122, 125, 132, 133, 134, 137, 148, 151, 154], "One": [0, 4, 20, 48, 82, 83, 89, 94, 96, 114, 116, 120, 121, 122, 123, 125, 130, 132, 143, 147], "easi": [0, 116, 120, 127, 130, 133, 134, 152, 154], "wai": [0, 11, 16, 18, 19, 24, 48, 64, 82, 114, 116, 121, 125, 126, 127, 128, 131, 133, 134, 137, 143, 145, 147, 151, 155], "work": [0, 11, 42, 49, 107, 114, 116, 120, 121, 127, 130, 132, 133, 134, 137, 138, 143, 144, 147, 154, 155], "through": [0, 10, 11, 19, 38, 48, 51, 52, 55, 62, 76, 82, 86, 89, 95, 112, 114, 116, 133, 134, 138, 143, 147, 152, 154], "along": [0, 4, 11, 19, 24, 29, 38, 51, 58, 60, 61, 62, 82, 84, 85, 89, 92, 114, 116, 120, 144, 151], "kei": [0, 24, 53, 88, 107, 120, 121, 143], "decis": [0, 53, 138], "influenc": [0, 11, 49], "our": [0, 121, 123, 125, 138, 152], "particular": [0, 4, 48, 55, 62, 75, 89, 110, 114, 115, 116, 133, 138, 144, 145, 146, 147, 151], "choic": [0, 4, 19, 46, 57, 81, 114, 116, 120, 127, 143, 145], "metadata": [0, 4, 107, 114, 115, 120, 121, 126, 127, 145, 154, 155], "organ": [0, 53, 88, 129, 133, 137, 144, 147, 154], "so": [0, 4, 24, 28, 30, 31, 34, 35, 53, 97, 114, 116, 127, 132, 133, 136, 137, 138, 141, 143, 146, 147, 151, 152, 154], "introductori": 0, "stuff": [0, 121], "u": [0, 1, 4, 9, 29, 107, 114, 116, 118, 121, 122, 123, 130, 143, 146, 151, 152], "defin": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 112, 114, 115, 116, 119, 120, 123, 127, 130, 133, 134, 138, 141, 143, 145, 146, 147, 152, 154], "ha": [0, 3, 4, 8, 10, 11, 17, 34, 49, 50, 52, 62, 65, 75, 81, 82, 89, 100, 107, 114, 115, 116, 120, 121, 122, 123, 125, 127, 130, 133, 134, 137, 138, 143, 147, 148, 151, 152, 154, 155], "commun": [0, 4, 109, 110, 116, 124, 127, 128, 130, 131, 132, 136, 144, 151, 154], "actual": [0, 4, 11, 14, 15, 35, 42, 48, 49, 53, 68, 88, 89, 95, 114, 115, 116, 118, 121, 123, 127, 132, 133, 146, 148, 152], "bit": [0, 11, 49, 80, 114, 120, 123, 125, 137, 143, 151], "thing": [0, 26, 49, 116, 119, 130, 145, 146, 151], "first": [0, 4, 8, 11, 16, 18, 25, 29, 46, 47, 48, 49, 52, 61, 72, 84, 86, 96, 107, 112, 114, 115, 116, 118, 120, 121, 123, 125, 126, 127, 130, 137, 143, 147, 151, 152, 154, 155], "part": [0, 11, 29, 36, 49, 62, 67, 95, 107, 114, 115, 118, 121, 128, 133, 134, 137, 140, 141, 143, 145, 147, 148, 151, 154], "guid": [0, 58, 62, 64, 114, 128, 133, 135, 147], "principl": [0, 115, 145], "guidanc": [0, 11, 121], "must": [0, 4, 11, 19, 26, 36, 46, 48, 49, 52, 57, 60, 72, 80, 82, 83, 88, 95, 97, 107, 110, 114, 115, 116, 120, 121, 127, 134, 137, 143, 147, 155], "analysi": [0, 3, 4, 11, 14, 15, 27, 28, 36, 43, 49, 53, 74, 79, 88, 94, 116, 120, 121, 122, 123, 125, 127, 130, 131, 133, 134, 145, 151], "Not": [0, 107, 109, 116, 123, 138], "less": [0, 11, 49, 147], "Of": [0, 114, 121, 152], "cours": [0, 24, 25, 114, 121], "depend": [0, 4, 11, 37, 38, 40, 41, 42, 45, 46, 48, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 83, 84, 86, 87, 89, 92, 93, 95, 97, 100, 107, 114, 116, 132, 137, 154, 155], "scienc": [0, 1, 112, 128, 133, 136, 137, 144, 154], "being": [0, 4, 19, 97, 114, 115, 116, 118, 122, 130, 137, 142, 147, 152, 154], "senior": 0, "scientist": [0, 112, 116, 133, 137, 145, 151, 152, 154, 155], "unsur": [0, 120], "perhap": [0, 11, 54, 64, 87, 120, 128, 152], "call": [0, 46, 62, 73, 88, 104, 114, 116, 118, 119, 121, 123, 125, 128, 130, 133, 134, 138, 143, 148, 154], "intern": [0, 49, 62, 75, 109, 112, 113, 114, 116, 130, 133, 134, 138, 145, 152], "meet": [0, 53, 60, 112, 130, 136, 137, 144, 154], "domain": [0, 115, 133, 137, 154], "expert": [0, 151], "haggl": 0, "when": [0, 2, 4, 10, 11, 19, 47, 48, 49, 50, 51, 52, 53, 62, 65, 68, 75, 76, 81, 82, 86, 88, 89, 94, 107, 114, 115, 116, 120, 121, 122, 123, 127, 130, 133, 134, 137, 138, 142, 143, 145, 146, 147, 148, 152, 154], "peopl": [0, 127, 128, 130, 133, 151], "tend": 0, "everyth": [0, 69, 125, 143], "might": [0, 11, 48, 49, 60, 62, 94, 95, 107, 110, 114, 115, 116, 120, 121, 127, 133, 143, 147, 148, 152, 155], "come": [0, 55, 116], "test": [0, 118, 120, 134, 136, 138, 143, 147], "question": [0, 24, 111, 116, 131, 152, 153, 154], "common": [0, 4, 9, 11, 29, 36, 46, 49, 55, 57, 62, 65, 89, 112, 114, 115, 116, 120, 121, 127, 128, 130, 133, 134, 137, 144, 145, 147], "onli": [0, 11, 29, 46, 48, 49, 51, 52, 53, 57, 59, 60, 61, 72, 75, 81, 82, 83, 94, 95, 97, 114, 115, 116, 120, 121, 122, 125, 127, 130, 132, 133, 136, 138, 143, 145, 146, 147, 148, 151, 152], "belong": [0, 115], "purpos": [0, 51, 68, 114, 118, 127, 133, 138, 144, 147, 154, 155], "author": [0, 70, 91, 103, 104, 109, 117, 126, 131, 145], "upstream": [0, 60, 61, 63, 87, 95], "softwar": [0, 3, 4, 11, 14, 15, 27, 28, 43, 48, 49, 72, 107, 114, 116, 120, 122, 124, 127, 128, 130, 133, 144, 145, 147, 152, 154, 155], "who": [0, 114, 121, 127, 128, 133, 134, 136, 151, 155], "consum": [0, 36, 116, 147], "expect": [0, 4, 17, 28, 32, 48, 69, 97, 103, 114, 116, 120, 121, 132, 137, 138, 146, 147], "certain": [0, 4, 11, 36, 48, 49, 53, 107, 114, 116, 121, 122, 123, 138, 145, 152, 154, 155], "well": [0, 107, 109, 110, 112, 114, 116, 127, 128, 132, 133, 135, 137, 143, 145, 147, 152, 154, 155], "place": [0, 4, 9, 30, 35, 44, 47, 70, 75, 76, 86, 107, 110, 112, 114, 116, 120, 122, 123, 127, 143, 148, 151, 152], "On": [0, 116, 125, 127, 138, 151], "hand": [0, 72, 73, 89, 90, 116, 127], "develop": [0, 112, 116, 118, 127, 128, 130, 132, 133, 134, 135, 137, 138, 142, 143, 144, 154, 155], "analyz": [0, 4, 7, 46, 94, 112, 116, 127, 133, 137, 143, 147, 152], "novel": 0, "better": [0, 114, 122, 127, 134, 137, 143, 154, 155], "err": 0, "side": [0, 46, 57, 76, 114], "either": [0, 4, 5, 6, 9, 10, 11, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 48, 49, 68, 96, 104, 107, 109, 110, 114, 115, 116, 120, 123, 124, 127, 132, 133, 145, 147, 148, 151, 152, 154], "rietveld": 0, "refin": 0, "profil": [0, 11, 39, 57, 80, 116], "kind": [0, 18, 55, 112, 116, 141], "radiat": [0, 4, 11, 14, 15, 49, 67, 87, 116, 127, 146, 152], "probe": [0, 2, 3, 4, 6, 8, 10, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 87, 97, 103, 104, 114], "long": [0, 4, 48, 49, 109, 110, 116, 127, 134, 151], "element": [0, 3, 4, 11, 21, 22, 23, 46, 48, 49, 51, 55, 57, 62, 76, 80, 82, 83, 85, 86, 94, 95, 98, 99, 101, 102, 105, 106, 108, 114, 115, 116, 120, 123, 127, 145, 152, 154], "usual": [0, 4, 10, 24, 40, 48, 59, 62, 67, 74, 89, 94, 114, 116, 143, 151, 154], "would": [0, 4, 8, 11, 14, 15, 24, 35, 43, 49, 65, 75, 87, 89, 90, 95, 114, 115, 116, 127, 129, 133, 137, 138, 143, 147, 148, 151, 152, 154], "nice": [0, 116], "temperatur": [0, 2, 3, 4, 8, 11, 17, 29, 46, 48, 53, 57, 65, 67, 82, 83, 84, 88, 103, 104, 107, 114, 116, 133, 146, 151, 152], "shown": [0, 4, 48, 53, 81, 88, 107, 114, 115, 116, 120, 121, 122, 123, 125, 133, 137, 147, 148, 151], "summar": [0, 4], "measur": [0, 2, 4, 8, 11, 13, 19, 24, 25, 26, 29, 34, 48, 49, 52, 53, 55, 62, 65, 67, 68, 80, 84, 88, 93, 94, 95, 114, 116, 122, 123, 127, 133, 154], "incid": [0, 4, 11, 14, 38, 39, 42, 46, 61, 62, 66, 68, 82, 94, 95, 97, 116], "lambda": [0, 4, 14, 107, 116, 133], "worri": 0, "too": [0, 16, 55, 114, 116, 151], "hold": [0, 19, 26, 30, 31, 34, 35, 48, 95, 109, 114, 121, 136, 143, 151], "reveal": 0, "secret": 0, "easier": [0, 121, 125, 133, 143], "were": [0, 65, 111, 116, 120, 121, 126, 127, 130, 137, 152], "At": [0, 11, 16, 49, 53, 55, 114, 115, 116, 128, 130, 138, 155], "stage": [0, 89, 130], "advis": [0, 53, 137], "pull": [0, 112, 127, 129], "studi": [0, 116, 134, 143], "notic": [0, 119, 120, 127], "quickli": [0, 152], "realiz": 0, "been": [0, 3, 4, 10, 11, 17, 34, 49, 62, 82, 89, 114, 116, 120, 122, 123, 125, 126, 127, 130, 133, 134, 138, 143, 145, 147, 148, 152, 154, 155], "just": [0, 4, 19, 65, 107, 110, 114, 116, 120, 121, 133, 134, 143, 151, 152], "path": [0, 3, 11, 21, 22, 23, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95, 96, 97, 100, 115, 116, 120, 121, 122, 123, 126, 127, 128, 133, 137, 142, 143, 147, 152, 154], "string": [0, 4, 19, 37, 38, 40, 41, 42, 45, 46, 48, 49, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 75, 77, 78, 82, 84, 87, 89, 92, 93, 103, 104, 107, 114, 115, 116, 119, 120, 121, 134, 138, 143, 146, 147, 148], "turn": [0, 58, 89, 132, 148], "syntax": [0, 111, 114, 116, 145, 147, 148], "conveni": [0, 19], "great": [0, 151], "confirm": 0, "view": [0, 116, 122, 124, 127, 128, 133, 134, 135, 137, 143, 145, 152, 154], "scan": [0, 4, 10, 11, 12, 16, 19, 20, 27, 29, 30, 31, 34, 35, 36, 49, 68, 78, 82, 97, 107, 114, 119, 121, 122, 127, 133, 134, 147, 154], "seem": [0, 121, 127, 143], "solut": [0, 143, 154], "But": [0, 4, 9, 11, 29, 49, 114, 116, 123, 127, 147, 154], "detail": [0, 4, 11, 43, 49, 70, 82, 95, 103, 104, 115, 116, 121, 132, 133, 134, 136, 138, 142, 143, 144, 147, 151, 154, 155], "branch": 0, "thu": [0, 4, 5, 11, 16, 48, 49, 51, 52, 55, 95, 114, 115, 116, 130, 133, 137, 143, 147, 151, 152, 154], "continu": [0, 112, 116, 124, 127, 133, 137, 154], "schemat": [0, 134], "inspect": [0, 127], "nxsourc": [0, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 32, 64, 94, 97, 103, 104, 151], "polar": [0, 7, 9, 10, 12, 13, 14, 15, 17, 20, 21, 22, 23, 30, 31, 34, 35, 39, 46, 49, 62, 64, 77, 80, 94, 103, 104, 114], "still": [0, 4, 116, 127, 134, 136, 137, 154], "done": [0, 16, 89, 120, 121, 138, 143], "upon": [0, 114, 116, 130], "content": [0, 4, 16, 30, 31, 34, 35, 70, 79, 107, 112, 114, 115, 116, 118, 120, 121, 122, 125, 126, 127, 128, 133, 134, 138, 143, 145, 147, 148, 154, 155], "make": [0, 4, 48, 53, 55, 65, 89, 93, 95, 96, 106, 107, 114, 119, 121, 127, 132, 133, 134, 138, 143, 147, 151, 152, 154], "tabl": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 121, 122, 123, 125, 141, 145, 146, 147, 152], "mxinstrument": 0, "get": [0, 20, 38, 48, 107, 116, 120, 121, 125, 127, 132, 143, 152, 154], "concern": [0, 127, 133, 136, 144], "stop": [0, 4, 40, 49, 59, 64, 118], "problem": [0, 4, 120, 122, 127, 129, 130, 135, 138], "solv": [0, 143, 151], "correspond": [0, 4, 11, 19, 29, 46, 48, 50, 55, 57, 65, 72, 75, 82, 83, 89, 95, 114, 116, 127, 151], "occur": [0, 55, 87, 116], "bewild": 0, "serv": [0, 133, 138, 143, 151, 154], "dictionari": [0, 11, 75, 114, 116, 120, 121, 133, 147], "most": [0, 4, 11, 39, 49, 72, 87, 110, 114, 116, 127, 132, 133, 138, 143, 145, 147, 148, 150, 152, 154], "possibli": [0, 4, 48, 53, 56, 88, 94, 147, 148, 151], "have": [0, 4, 11, 12, 19, 29, 42, 48, 49, 50, 51, 52, 53, 60, 61, 62, 80, 89, 91, 95, 97, 107, 111, 114, 115, 116, 119, 120, 121, 122, 125, 126, 127, 128, 130, 132, 133, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154, 155], "keep": [0, 4, 114, 119, 120, 127, 133, 138, 143], "altogeth": 0, "introduc": [0, 4, 116, 151], "pleas": [0, 26, 52, 65, 111, 114, 116, 124, 127, 129, 132, 138, 143, 147, 154], "feel": [0, 132, 143], "free": [0, 4, 87, 89, 113, 114, 132, 136, 145], "via": [0, 4, 97, 115, 129, 132, 137, 147, 154, 155], "mail": [0, 112, 127, 132], "xml": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 115, 116, 124, 130, 133, 134, 137, 138, 143, 145, 147, 154], "edit": [0, 120, 125, 130, 145, 147], "fire": 0, "editor": [0, 1, 111, 120, 126, 145, 147], "open": [0, 4, 24, 52, 62, 76, 86, 91, 114, 116, 118, 119, 121, 125, 126, 127, 133, 134, 137, 138, 143, 154], "schema": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 103, 104, 107, 114, 115, 145, 147], "worth": [0, 127], "load": [0, 121, 125, 126], "xsd": [0, 114, 120, 133, 145, 147], "help": [0, 29, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 116, 120, 121, 127, 132, 133, 134, 147, 152], "proper": [0, 11, 116, 119, 121], "alwai": [0, 4, 9, 24, 29, 44, 55, 75, 97, 112, 114, 116, 127, 147, 151], "templat": [0, 64], "below": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 52, 72, 97, 114, 116, 119, 120, 121, 122, 123, 135, 143, 147, 154], "It": [0, 3, 4, 12, 14, 15, 18, 20, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 107, 110, 114, 115, 116, 120, 121, 123, 127, 133, 134, 136, 138, 143, 146, 147, 151, 152, 154], "chang": [0, 4, 39, 46, 48, 49, 57, 81, 95, 116, 120, 127, 130, 132, 135, 143, 151, 152], "version": [0, 2, 4, 8, 11, 17, 18, 19, 26, 28, 46, 53, 57, 75, 79, 81, 82, 83, 88, 95, 97, 103, 104, 107, 109, 113, 115, 116, 118, 120, 121, 122, 126, 127, 130, 133, 138, 143, 147, 151, 154, 155], "0": [0, 4, 11, 24, 48, 49, 51, 53, 59, 60, 62, 68, 80, 84, 107, 113, 114, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 130, 132, 133, 134, 141, 143, 146, 147, 148, 151, 154, 155], "encod": [0, 85, 95, 116, 137], "utf": [0, 114, 146], "8": [0, 11, 49, 80, 114, 116, 118, 119, 120, 121, 126, 133, 134, 138, 141, 146, 147, 148, 154, 155], "x": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 35, 36, 37, 38, 39, 40, 41, 42, 45, 47, 48, 49, 50, 52, 59, 61, 62, 66, 67, 68, 72, 73, 76, 80, 82, 86, 87, 89, 90, 93, 94, 97, 103, 104, 107, 112, 114, 116, 118, 120, 121, 126, 127, 128, 133, 136, 137, 144, 145, 147, 151, 154], "rai": [0, 1, 2, 3, 4, 6, 8, 10, 11, 12, 14, 15, 18, 19, 20, 24, 25, 26, 27, 29, 36, 39, 42, 50, 59, 61, 87, 93, 94, 107, 112, 116, 127, 128, 130, 133, 136, 137, 144, 145, 147, 151, 154], "copyright": [0, 117, 131, 134, 143], "2008": [0, 130], "2022": [0, 107, 109, 113], "advisori": [0, 62, 109, 112, 113, 114, 130, 133, 152], "committe": [0, 62, 109, 112, 113, 114, 127, 130, 133, 152], "librari": [0, 4, 81, 107, 114, 116, 121, 122, 123, 128, 129, 132, 133, 138, 154, 155], "redistribut": 0, "modifi": [0, 4, 115, 120, 143, 154, 155], "gnu": [0, 113, 132], "lesser": [0, 113, 116, 132], "public": [0, 113, 132, 136, 137, 151, 154, 155], "licens": [0, 117, 131, 132], "publish": [0, 113, 131, 133], "foundat": 0, "later": [0, 65, 90, 114, 116, 128, 133, 148], "distribut": [0, 4, 32, 39, 48, 69, 87, 134, 138, 140, 141, 143, 154], "hope": 0, "without": [0, 4, 53, 68, 114, 116, 121, 126, 127, 128, 133, 134, 137, 143, 146, 147], "warranti": 0, "impli": [0, 134, 137], "merchant": 0, "fit": [0, 4, 19, 48, 80, 95, 114, 143, 151], "FOR": 0, "see": [0, 4, 11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 103, 104, 107, 110, 114, 115, 116, 120, 121, 122, 123, 126, 127, 128, 130, 132, 134, 135, 142, 143, 145, 146, 147, 148, 151, 152, 154, 155], "should": [0, 4, 11, 19, 20, 21, 22, 23, 43, 46, 48, 49, 52, 53, 57, 65, 72, 75, 76, 80, 82, 83, 86, 87, 88, 89, 91, 95, 97, 110, 114, 116, 118, 127, 129, 130, 132, 133, 134, 136, 137, 143, 145, 146, 147, 151, 152], "receiv": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 49, 68, 107, 130, 137, 144], "copi": [0, 121, 126, 127, 134, 143, 145], "inc": [0, 118], "59": [0, 114], "templ": 0, "suit": [0, 10], "330": [0, 147], "boston": 0, "ma": 0, "02111": 0, "1307": 0, "usa": [0, 1, 137], "http": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 111, 112, 113, 114, 115, 116, 118, 120, 121, 122, 125, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 147, 150, 154, 155], "www": [0, 2, 4, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 112, 113, 114, 116, 120, 121, 125, 127, 128, 130, 131, 133, 136, 137, 138, 144, 147, 154], "nexusformat": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 113, 114, 115, 116, 125, 127, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 147, 150, 154, 155], "org": [0, 2, 4, 11, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 111, 112, 113, 114, 116, 120, 121, 125, 127, 128, 130, 131, 132, 133, 136, 137, 138, 139, 144, 145, 147, 154], "nx__template__": 0, "extend": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 133, 137, 154], "nxobject": [0, 2, 3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 133, 147], "categori": [0, 75, 133, 145], "xmln": [0, 120, 133], "xsi": [0, 120, 133], "w3": [0, 4, 114, 120, 133], "2001": [0, 120, 130, 133, 134], "xmlschema": [0, 120, 133], "instanc": [0, 4, 36, 49, 60, 62, 65, 94, 106, 107, 110, 115, 116, 120, 127, 133, 143, 147, 152], "schemaloc": [0, 133], "0b": 0, "doc": [0, 4, 111, 115, 116, 120, 121, 131, 133, 138, 145, 154], "renam": [0, 119, 143], "nxwoni": 0, "locat": [0, 3, 4, 11, 14, 15, 16, 27, 28, 36, 37, 38, 39, 40, 41, 42, 45, 46, 49, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 85, 86, 87, 88, 90, 92, 93, 94, 110, 114, 116, 120, 121, 123, 126, 127, 132, 133, 134, 147, 151, 152, 154, 155], "root": [0, 11, 54, 81, 94, 114, 116, 121, 122, 126, 130, 147, 148, 151], "attribut": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 118, 119, 121, 122, 123, 126, 127, 128, 130, 133, 134, 137, 138, 143, 145, 146, 148, 151, 154], "shorthand": 0, "includ": [0, 2, 4, 9, 11, 29, 43, 47, 49, 52, 53, 62, 68, 72, 75, 82, 86, 88, 95, 97, 109, 110, 112, 114, 115, 116, 118, 119, 127, 128, 130, 133, 134, 138, 143, 144, 145, 146, 147, 154, 155], "nx_float": [0, 2, 4, 5, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 38, 39, 40, 41, 42, 45, 46, 48, 49, 52, 53, 55, 56, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 69, 73, 77, 80, 82, 83, 84, 85, 87, 88, 90, 92, 93, 95, 97, 98, 99, 101, 102, 103, 104, 105, 107, 108, 114, 116, 133, 146, 152], "unit": [0, 2, 3, 4, 5, 7, 9, 10, 11, 12, 13, 14, 15, 17, 18, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 34, 35, 38, 39, 40, 41, 42, 45, 46, 47, 48, 49, 51, 52, 53, 55, 56, 57, 58, 59, 61, 62, 63, 65, 66, 67, 68, 69, 72, 73, 74, 75, 76, 77, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93, 95, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 116, 118, 119, 120, 121, 122, 123, 126, 128, 133, 134, 138, 145], "nx_angl": [0, 3, 4, 7, 9, 10, 12, 13, 14, 15, 17, 20, 21, 22, 23, 24, 25, 30, 31, 34, 35, 39, 41, 42, 45, 46, 49, 52, 57, 61, 62, 63, 66, 80, 82, 83, 89, 92, 103, 104, 133, 146], "dimens": [0, 3, 4, 8, 11, 16, 18, 19, 29, 36, 46, 48, 49, 51, 65, 68, 82, 84, 85, 86, 94, 100, 107, 115, 116, 118, 121, 141, 145, 146, 148, 151], "rank": [0, 4, 11, 19, 48, 49, 114, 116, 119, 134, 143], "dim": [0, 8, 118, 119, 134], "index": [0, 2, 4, 11, 47, 48, 50, 55, 60, 62, 65, 70, 72, 79, 80, 103, 107, 114, 116, 120, 148, 151, 154], "ndet": [0, 7, 10, 21, 22, 23, 114], "mean": [0, 3, 4, 11, 16, 49, 62, 80, 85, 107, 110, 114, 116, 127, 133, 137, 143, 147, 148, 151, 152], "intuit": [0, 133], "relev": [0, 4, 36, 39, 43, 82, 110, 116, 127, 133, 151, 155], "specifi": [0, 4, 11, 39, 46, 48, 49, 51, 52, 53, 57, 65, 75, 80, 82, 83, 84, 88, 89, 95, 107, 114, 115, 116, 120, 121, 132, 133, 134, 138, 143, 146, 147, 148, 152, 154], "set": [0, 3, 4, 11, 16, 19, 25, 36, 44, 46, 48, 49, 53, 59, 78, 89, 94, 95, 96, 98, 99, 101, 102, 105, 107, 108, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 127, 128, 132, 134, 137, 138, 143, 145, 147, 148, 151, 154], "size": [0, 3, 4, 9, 11, 13, 14, 15, 24, 25, 29, 39, 40, 42, 45, 49, 51, 60, 68, 76, 85, 86, 87, 94, 97, 103, 104, 114, 116, 120, 121, 130, 133, 137, 138, 143, 146, 151], "tag": [0, 11, 49, 115, 130, 143, 154], "determin": [0, 4, 14, 15, 21, 22, 23, 48, 53, 79, 88, 95, 114, 138, 147, 148], "These": [0, 4, 11, 16, 19, 24, 25, 26, 46, 47, 48, 49, 57, 72, 97, 107, 110, 111, 112, 114, 116, 119, 120, 121, 124, 126, 128, 130, 133, 134, 137, 143, 145, 146, 147, 148, 151], "plain": [0, 70, 119], "integ": [0, 4, 11, 48, 49, 50, 80, 114, 116, 118, 125, 133, 138, 141, 146, 147, 148, 151], "variabl": [0, 4, 8, 16, 39, 48, 61, 65, 78, 82, 85, 107, 114, 115, 116, 120, 133, 141, 143, 146, 147, 151], "express": [0, 4, 89, 91, 114, 115, 116, 137, 145, 147, 148], "tof": [0, 5, 7, 9, 13, 21, 22, 23, 36, 49, 114], "clever": 0, "reader": [0, 48, 114, 116, 121, 134, 137, 154], "between": [0, 4, 13, 14, 15, 24, 25, 36, 46, 52, 59, 61, 63, 73, 78, 82, 83, 87, 97, 107, 114, 116, 122, 127, 130, 133, 137, 138, 143, 145, 152, 154], "nxmonopd": [0, 36], "sinc": [0, 4, 12, 14, 15, 44, 46, 48, 57, 65, 115, 116, 118, 120, 121, 122, 123, 127, 128, 130, 133, 137, 138, 145, 147, 151], "essenti": [0, 27, 116, 127], "ident": [0, 4, 88, 89, 116, 121, 137, 141], "yourselv": 0, "cooki": 0, "spot": 0, "send": 0, "review": [0, 109, 115, 130], "correct": [0, 10, 11, 24, 25, 28, 49, 80, 95, 112, 116, 127, 132, 138, 145], "per": [0, 3, 4, 11, 19, 24, 49, 78, 82, 83, 94, 114, 120, 146], "comment": [0, 53, 62, 88, 107, 137], "cure": 0, "year": [0, 127, 130, 143, 144], "final": [0, 26, 36, 39, 89, 116, 121, 125, 134, 143], "becom": [0, 107, 114, 116, 122, 133, 137, 147, 151, 154], "befor": [0, 11, 21, 22, 23, 46, 48, 51, 53, 64, 88, 89, 90, 95, 107, 109, 114, 116, 120, 125, 132, 133, 134, 143, 151, 154], "accept": [0, 41, 42, 49, 109, 110, 114, 120, 122, 125, 127, 137, 144, 147], "curat": [0, 112], "period": [0, 52, 61, 87, 94, 114, 146, 147], "gain": [0, 11, 42, 49, 62, 121, 137, 152], "sort": [0, 4, 25, 49, 114, 116, 133, 154], "bug": [0, 130, 131], "shall": [0, 133], "written": [0, 4, 9, 29, 48, 81, 114, 115, 118, 120, 121, 122, 123, 126, 127, 134, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154, 155], "stylesheet": 0, "text": [0, 4, 11, 48, 52, 70, 75, 79, 111, 114, 115, 120, 121, 126, 127, 145, 146, 147, 148, 151], "xsl": 0, "href": 0, "nxdlformat": 0, "symbol": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 116, 145, 148, 151, 152], "here": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 48, 62, 89, 97, 114, 115, 116, 120, 121, 122, 125, 127, 128, 133, 143, 147, 151, 154], "coordin": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 52, 72, 73, 76, 80, 82, 83, 86, 89, 97, 131, 144, 147, 151], "dataset": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 95, 97, 114, 116, 118, 119, 120, 121, 122, 123, 125, 126, 128, 133, 138, 143, 147, 148, 151, 152, 154], "same": [0, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 49, 51, 52, 53, 55, 60, 65, 72, 75, 80, 82, 84, 89, 91, 95, 107, 114, 115, 116, 118, 119, 120, 121, 123, 126, 127, 134, 138, 141, 143, 146, 147, 148, 151, 152, 154], "monochromat": [0, 10, 11, 12, 14, 29, 36, 116, 152], "singl": [0, 4, 10, 11, 19, 22, 23, 29, 31, 32, 33, 34, 36, 46, 47, 48, 49, 50, 52, 53, 57, 61, 65, 66, 72, 82, 83, 87, 107, 114, 116, 118, 120, 122, 127, 130, 137, 143, 147, 151, 152], "start_tim": [0, 2, 3, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 27, 29, 49, 53, 68, 88, 97, 103, 104, 114, 134, 146], "nx_date_tim": [0, 2, 3, 4, 5, 6, 7, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 38, 49, 52, 53, 55, 65, 68, 70, 79, 81, 82, 87, 88, 97, 103, 104, 107, 114, 115, 146], "offici": [0, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 53, 88, 97, 103, 104, 107], "enumer": [0, 46, 52, 57, 87, 114, 143, 145, 146], "electron": [0, 2, 3, 4, 8, 10, 11, 12, 18, 19, 21, 22, 23, 24, 25, 26, 29, 36, 49, 53, 55, 59, 87, 88, 152], "nx_wavelength": [0, 4, 10, 11, 12, 14, 29, 32, 39, 46, 49, 52, 56, 62, 63, 69, 92, 103, 104, 146], "optimum": [0, 10, 46], "axi": [0, 3, 4, 11, 19, 20, 24, 26, 36, 37, 38, 40, 45, 47, 48, 49, 51, 52, 62, 66, 67, 68, 76, 85, 86, 87, 89, 90, 92, 93, 94, 100, 107, 116, 121, 133, 138, 146, 148, 151, 154], "nx_int": [0, 3, 4, 6, 8, 9, 10, 11, 12, 13, 15, 16, 18, 20, 21, 22, 23, 24, 25, 26, 27, 29, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 60, 61, 62, 63, 65, 72, 77, 80, 82, 87, 88, 92, 93, 97, 103, 104, 107, 114, 116, 133, 146], "signal": [0, 4, 9, 10, 11, 21, 22, 23, 27, 28, 29, 32, 48, 49, 52, 53, 62, 84, 88, 97, 103, 107, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 138, 148, 151, 152], "alreadi": [0, 4, 10, 11, 49, 114, 116, 120, 121, 123, 125, 126, 128, 130, 137, 147], "effici": [0, 10, 48, 49, 68, 77, 127, 128, 137], "rotat": [0, 2, 4, 5, 10, 12, 13, 14, 15, 16, 17, 19, 20, 24, 25, 30, 31, 34, 35, 36, 46, 52, 56, 82, 87, 89, 92, 94, 103, 104, 108, 109, 116, 125, 133, 146, 151], "diagram": [0, 10, 82, 133], "obtain": [0, 4, 10, 82, 115, 132, 138, 147, 154], "omega": [0, 4, 10, 82], "2theta": [0, 10, 46, 82], "tradit": [0, 10, 49, 82, 116], "mode": [0, 3, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 34, 49, 55, 65, 68, 87, 103, 104, 107, 114, 120, 138, 147, 151], "preset": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 68, 107], "clock": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 49, 52, 65, 68, 107, 146], "timer": [0, 6, 9, 10, 12, 13, 14, 15, 20, 21, 22, 23, 27, 29, 68, 107], "integr": [0, 10, 13, 14, 20, 22, 24, 25, 29, 49, 68, 80, 130, 154], "nx_ani": [0, 3, 10, 12, 13, 14, 20, 24, 25, 26, 29, 35, 39, 46, 48, 49, 62, 65, 68, 78, 82, 84, 116, 146], "total": [0, 10, 11, 13, 14, 19, 20, 24, 25, 29, 41, 49, 52, 63, 65, 68, 103, 104], "target": [0, 6, 9, 10, 12, 13, 14, 15, 16, 20, 21, 22, 23, 24, 25, 27, 29, 30, 31, 34, 35, 78, 87, 95, 97, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116, 119, 120, 123, 126, 127, 128], "far": [0, 116, 127], "capabl": [0, 116, 128, 137, 154], "handi": 0, "reli": [0, 133, 154], "retriev": [0, 133, 152, 154], "subject": 0, "regular": [0, 19, 114, 115, 147, 151], "pattern": [0, 4, 48, 52, 87, 94, 97, 114, 137, 147], "note": [0, 4, 11, 19, 37, 39, 41, 46, 48, 51, 52, 53, 54, 62, 65, 70, 72, 79, 81, 87, 88, 89, 103, 104, 107, 110, 114, 116, 121, 122, 126, 130, 133, 134, 138, 143, 146, 147, 148, 151, 154, 155], "length": [0, 4, 11, 14, 15, 16, 35, 46, 48, 49, 57, 59, 63, 80, 82, 83, 85, 87, 89, 92, 93, 100, 114, 116, 119, 126, 134, 141, 143, 146, 147, 148, 151, 152], "limit": [0, 4, 29, 78, 114, 116, 130, 136, 138, 143, 144, 147], "63": [0, 114, 147], "charact": [0, 82, 114, 115, 116, 133, 134, 138, 141, 147], "impos": [0, 114, 130], "sensibl": [0, 18, 114, 133, 155], "separ": [0, 46, 49, 52, 57, 61, 63, 82, 83, 85, 88, 95, 102, 107, 109, 114, 121, 131, 133, 136, 138, 143, 147, 151, 154], "multi": [0, 4, 46, 65, 66, 80, 87, 88, 94, 110, 116, 127, 128, 137, 147], "word": [0, 21, 22, 23, 53, 78, 88, 114, 137, 147, 148], "underscor": [0, 114], "someth": [0, 4, 29, 49, 119, 120, 143, 147, 152], "databas": [0, 2, 54, 91], "ahead": 0, "nxarchiv": [0, 36], "context": [0, 4, 147, 151], "mention": [0, 89, 116, 127, 154], "adher": [0, 110, 151], "second": [0, 4, 8, 11, 18, 29, 46, 47, 49, 72, 84, 86, 91, 96, 107, 114, 116, 120, 147, 152], "often": [0, 4, 8, 29, 49, 52, 65, 68, 116, 133, 137, 147], "want": [0, 5, 82, 83, 120, 121, 127, 133, 134, 138, 143, 147, 152], "complet": [0, 11, 40, 94, 95, 114, 115, 116, 120, 127, 132, 133, 144, 147, 151, 154], "state": [0, 58, 68, 82, 95, 107, 109, 116, 132, 134, 154], "abl": [0, 110, 114, 127, 143], "went": 0, "wrong": [0, 143, 146], "unsatisfactori": 0, "site": [0, 120, 132, 134], "polici": [0, 144], "boss": [0, 116], "current": [0, 19, 58, 87, 98, 99, 101, 102, 105, 108, 114, 115, 116, 121, 126, 127, 130, 132, 134, 135, 137, 138, 144, 146, 147, 154], "head": [0, 106, 109, 116], "mani": [0, 4, 11, 49, 51, 69, 85, 111, 116, 124, 125, 127, 130, 136, 137, 143, 145, 147, 151, 152, 154], "nxuser": [0, 2, 21, 22, 23, 53, 88, 94, 103, 104, 107, 151], "knock": 0, "silli": 0, "over": [0, 11, 17, 49, 68, 82, 114, 116, 138, 143, 147], "scientif": [0, 36, 125, 127, 128, 130, 131, 134, 144, 145, 147, 151, 154, 155], "account": [0, 8, 11, 49, 90, 95], "depart": 0, "sad": 0, "ask": [0, 116, 130, 131, 152, 153, 154], "preposter": 0, "bill": 0, "judgment": 0, "allow": [0, 4, 11, 16, 24, 25, 64, 65, 76, 78, 79, 81, 86, 91, 95, 114, 115, 116, 127, 130, 133, 134, 136, 137, 142, 143, 145, 147, 151, 152, 154], "prefix": [0, 114, 115, 116, 120, 132], "nx": [0, 19, 26, 48, 81, 114, 115, 116, 118, 120, 121, 125, 127, 133, 134, 147, 151, 152], "multipl": [0, 4, 8, 11, 19, 46, 48, 49, 50, 51, 62, 66, 70, 72, 79, 80, 82, 83, 88, 94, 114, 116, 127, 143, 147, 151], "relat": [0, 4, 11, 40, 48, 49, 52, 87, 94, 116, 120, 121, 122, 123, 130, 136, 144, 147, 151, 152], "result": [0, 4, 26, 36, 39, 74, 80, 112, 114, 116, 120, 130, 133, 151, 154], "interpret": [0, 4, 97, 107, 116, 142, 155], "standalon": [0, 120], "e": [0, 4, 11, 18, 19, 20, 38, 39, 48, 49, 50, 53, 54, 65, 68, 70, 76, 78, 82, 84, 86, 88, 89, 91, 94, 95, 107, 114, 116, 132, 133, 134, 137, 138, 143, 146, 147, 151, 152], "mind": [0, 3, 4, 127], "stai": [0, 127], "constant": [0, 49, 61, 82, 107, 116, 120, 143], "across": [0, 49, 84, 116, 137, 147], "reduct": [0, 8, 14, 15, 18, 28, 52, 65, 107, 114, 133, 145, 151, 154], "encourag": [0, 48, 110, 112, 114, 127, 133, 137], "implement": [0, 4, 16, 36, 48, 114, 116, 127, 128, 133, 134, 135, 137, 138, 143, 151, 154], "nxprocess": [0, 4, 8, 18, 26, 28, 53, 88, 94, 114, 116, 151], "preserv": [0, 107, 114, 123, 152], "proven": [0, 79], "achiev": [0, 55, 97, 116], "pete": [1, 111, 125], "r": [1, 46, 56, 57, 82, 84, 89, 100, 114, 121, 134], "jemian": [1, 111], "anl": [1, 111, 130, 137], "gov": [1, 111, 154], "advanc": [1, 133, 137, 147], "photon": [1, 11, 19, 41, 49, 59, 137], "argonn": [1, 130, 137], "nation": [1, 128, 130, 137, 154], "laboratori": [1, 29, 82, 116, 130, 137, 154, 155], "il": 1, "frederick": 1, "akeroyd": 1, "freddi": 1, "stfc": [1, 114], "ac": [1, 114, 154], "uk": [1, 114, 154], "rutherford": [1, 154], "appleton": [1, 154], "didcot": 1, "stuart": 1, "campbel": 1, "campbellsi": 1, "ornl": [1, 103, 104, 109, 130], "oak": [1, 137, 154], "ridg": [1, 137, 154], "tn": 1, "przemek": [1, 130, 137], "klosowski": [1, 130, 134, 137], "nist": [1, 4, 126, 130, 137, 154], "maryland": 1, "gaithersburg": 1, "md": [1, 120, 154], "mark": [1, 27, 75, 114, 119, 130, 132, 137, 146, 147, 151], "k\u00f6nneck": [1, 130, 137], "koenneck": [1, 119, 134], "psi": [1, 17, 120, 130, 154], "ch": [1, 120], "paul": [1, 126, 137], "scherrer": 1, "institut": [1, 130, 133, 137, 154], "5232": 1, "villigen": 1, "switzerland": [1, 137], "osborn": [1, 130, 134, 137], "rosborn": 1, "peter": 1, "f": [1, 107, 121, 122, 123, 133, 154], "peterson": 1, "petersonpf": 1, "spallat": [1, 2, 4, 87, 103, 104, 109], "tobia": 1, "richter": 1, "esss": 1, "se": [1, 54], "european": [1, 114, 130, 137], "lund": 1, "sweden": 1, "joachim": 1, "wuttk": 1, "j": [1, 4, 11, 39, 47, 49, 51, 55, 72, 84, 107, 114, 118, 133, 146, 147], "fz": 1, "juelich": 1, "de": 1, "forschungszentrum": 1, "j\u00fclich": 1, "centr": [1, 45, 52, 66, 68, 76, 86, 92, 152], "heinz": 1, "maier": 1, "leibnitz": 1, "zentrum": 1, "garch": 1, "germani": 1, "statu": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115, 116, 118, 124, 127, 131, 154], "applic": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 48, 53, 81, 88, 94, 97, 103, 104, 109, 110, 112, 114, 115, 124, 127, 128, 129, 130, 131, 133, 136, 137, 143, 144, 145, 147, 151, 152, 153, 154, 155], "definit": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 122, 124, 125, 127, 129, 130, 131, 133, 134, 136, 137, 138, 141, 144, 149, 150, 151, 152, 153, 154, 155], "thi": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 130, 131, 132, 133, 134, 136, 137, 138, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "data": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 48, 49, 50, 51, 53, 55, 61, 62, 64, 65, 66, 68, 70, 75, 79, 80, 81, 82, 84, 88, 94, 95, 97, 103, 104, 107, 109, 110, 112, 116, 118, 119, 120, 127, 128, 130, 131, 134, 136, 137, 138, 141, 142, 144, 145, 146, 147, 153, 155], "archiv": [2, 36, 109, 110, 132, 136, 144, 154], "icat": [2, 36], "icatproject": [2, 36], "No": [2, 3, 4, 5, 17, 33, 37, 38, 39, 40, 41, 42, 43, 44, 45, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 61, 63, 64, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 76, 77, 78, 79, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115, 125, 147], "cite": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 115], "nx_char": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 107, 108, 114, 115, 116, 118, 120, 128, 134, 143, 146], "experiment_identifi": [2, 53, 88, 103, 104], "uniqu": [2, 4, 11, 50, 53, 64, 88, 89, 91, 107, 114, 116, 120, 128, 137, 147], "experiment_descript": [2, 53, 88], "brief": [2, 53, 84, 88, 131, 133, 134, 143], "object": [2, 4, 43, 53, 71, 72, 73, 76, 85, 86, 88, 90, 94, 95, 110, 121, 127, 130, 143, 145, 147, 148, 151], "collection_identifi": [2, 53, 88, 103, 104], "id": [2, 4, 11, 29, 47, 50, 53, 55, 72, 75, 80, 88, 91, 103, 104, 116], "daq": [2, 49], "file": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 46, 48, 49, 53, 67, 70, 72, 75, 81, 88, 94, 97, 103, 104, 107, 109, 110, 115, 125, 127, 130, 131, 132, 137, 138, 141, 142, 143, 145, 146, 147, 148, 153, 154], "collection_descript": [2, 53, 88], "summari": [2, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 114, 147, 154], "criteria": [2, 53, 88], "entry_identifi": [2, 53, 88, 103, 104], "facil": [2, 4, 11, 50, 53, 81, 87, 88, 91, 94, 103, 104, 107, 114, 127, 133, 137, 147, 151, 154, 155], "end_tim": [2, 11, 12, 13, 14, 16, 19, 24, 25, 53, 68, 88, 97, 103, 104, 114, 134, 146], "durat": [2, 22, 23, 53, 65, 88, 103, 104], "nx_time": [2, 3, 11, 49, 52, 53, 55, 65, 68, 87, 88, 98, 99, 103, 104, 146], "todo": [2, 3, 62, 107], "need": [2, 4, 11, 16, 24, 39, 48, 49, 53, 62, 72, 78, 81, 84, 88, 89, 95, 97, 107, 114, 115, 116, 119, 120, 121, 123, 127, 132, 133, 137, 138, 141, 143, 145, 147, 148, 151, 154], "collection_tim": [2, 53, 88], "run_cycl": [2, 53, 88], "revis": [2, 53, 62, 88, 114, 117, 131, 143, 147], "recalibr": 2, "reprocess": [2, 53, 88], "nexu": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 43, 44, 48, 53, 55, 62, 64, 70, 71, 75, 80, 81, 88, 89, 94, 96, 97, 104, 107, 109, 111, 113, 125, 126, 127, 131, 141, 142, 146, 147, 148, 155], "nxdl": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 114, 115, 116, 127, 129, 130, 131, 132, 133, 134, 136, 148, 149, 154, 155], "which": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 97, 100, 104, 107, 110, 112, 114, 116, 118, 119, 120, 121, 122, 123, 127, 128, 130, 132, 133, 134, 136, 137, 138, 143, 145, 146, 147, 148, 151, 152, 154], "obligatori": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 49, 51, 53, 62, 81, 88, 97, 103, 104, 107], "The": [2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 40, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 60, 62, 65, 66, 67, 68, 69, 72, 73, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 93, 94, 95, 96, 97, 106, 107, 109, 111, 112, 113, 114, 115, 118, 119, 120, 121, 122, 123, 124, 125, 127, 128, 129, 130, 131, 132, 133, 135, 136, 137, 138, 140, 141, 142, 143, 146, 147, 148, 149, 151, 154, 155], "us": [2, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 107, 109, 110, 111, 115, 116, 122, 123, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 141, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "release_d": 2, "releas": [2, 114, 115, 120, 130, 131, 134, 137, 140, 141, 143, 154, 155], "pd": 2, "role": [2, 91, 103, 104, 114], "facility_user_id": [2, 91, 103, 104], "burocraci": 2, "instrument": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 39, 43, 46, 49, 52, 53, 62, 64, 68, 84, 88, 94, 97, 103, 104, 107, 114, 116, 120, 121, 123, 125, 126, 127, 133, 137, 144, 145, 147, 148, 151, 152, 154, 155], "puls": [2, 4, 49, 52, 55, 64, 67, 68, 87, 103, 135, 137, 146, 150, 152], "reactor": [2, 4, 55, 64, 87], "synchrotron": [2, 4, 19, 63, 87, 93, 94, 133, 136, 147, 151], "muon": [2, 4, 53, 87, 88, 112, 114, 127, 133, 137, 144, 145, 154], "anod": [2, 4, 87], "fix": [2, 3, 4, 17, 51, 82, 87, 89, 114, 116, 120, 130, 138, 143, 146], "tube": [2, 4, 47, 50, 87, 95, 116], "sample_id": 2, "calibr": [2, 11, 28, 49, 53, 82, 88, 103, 104, 116, 127], "normalis": [2, 19, 43, 68, 82], "simul": [2, 39, 60, 82, 116], "none": [2, 19, 43, 44, 47, 48, 50, 51, 55, 65, 70, 71, 72, 74, 75, 80, 82, 85, 89, 91, 100, 147], "sample_environ": 2, "chemical_formula": [2, 46, 57, 82, 83, 95, 116], "chemic": [2, 46, 57, 82, 83, 95, 116, 133], "formula": [2, 46, 57, 82, 83, 95, 116], "cif": [2, 46, 57, 75, 82, 83, 95, 114, 116], "preparation_d": [2, 82], "situat": [2, 48, 60, 82, 114, 115, 116, 127, 147, 152], "environ": [2, 8, 82, 116, 133, 137, 142, 143, 154], "air": [2, 82], "vacuum": [2, 61, 62, 66, 82], "oxid": 2, "atmospher": [2, 61, 62, 66, 82], "dehydr": 2, "nx_temperatur": [2, 3, 4, 11, 17, 46, 57, 67, 82, 103, 104, 146], "magnetic_field": [2, 41, 82, 84, 151, 152], "nx_current": [2, 41, 58, 87, 98, 99, 101, 102, 105, 108, 146], "electric_field": [2, 82, 84], "nx_voltag": [2, 82, 87, 98, 99, 101, 102, 105, 108, 146], "stress_field": [2, 82], "nx_unitless": [2, 11, 22, 46, 56, 61, 62, 63, 66, 73, 77, 80, 82, 89, 92, 95, 103, 104, 133, 146], "pressur": [2, 4, 48, 49, 82, 83, 84, 93, 114, 133, 146, 147], "nx_pressur": [2, 49, 82, 93, 146], "rest": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 145], "web": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 120, 127, 132, 144], "page": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 127, 132, 143, 144, 154], "html": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 118, 120, 121, 122, 127, 130, 131, 136, 137, 138, 139, 142, 144, 147, 154], "end": [2, 11, 12, 13, 14, 16, 19, 24, 25, 53, 55, 63, 68, 76, 86, 87, 88, 89, 97, 103, 104, 114, 116, 118, 120, 126, 147, 151], "date": [2, 4, 11, 26, 28, 48, 49, 70, 79, 81, 82, 87, 103, 104, 107, 124, 127, 146], "cycl": [2, 49, 53, 61, 88], "electr": [2, 78, 82, 83, 94, 146], "magnet": [2, 41, 52, 63, 64, 82, 83, 84, 94, 99, 101, 102, 105, 108, 109, 133, 152], "prepar": [2, 82, 115, 138, 145], "stress": [2, 82, 83, 84], "github": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 114, 115, 116, 120, 121, 125, 127, 129, 130, 132, 134, 135, 138, 139, 140, 141, 142, 143, 145, 147, 150, 154, 155], "com": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 112, 114, 115, 116, 120, 121, 125, 127, 129, 130, 132, 134, 135, 138, 139, 140, 141, 142, 143, 145, 147, 150, 154, 155], "blob": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 116, 120, 134, 138, 142, 154], "main": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 114, 116, 118, 119, 121, 125, 130, 134, 136, 145], "an": [3, 4, 6, 10, 11, 12, 13, 14, 15, 16, 19, 20, 22, 24, 26, 27, 30, 31, 33, 34, 35, 36, 37, 38, 41, 42, 44, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 59, 60, 61, 62, 63, 65, 66, 68, 69, 70, 75, 76, 79, 80, 81, 82, 84, 85, 86, 88, 89, 91, 93, 94, 95, 96, 97, 100, 102, 107, 109, 110, 114, 115, 116, 118, 119, 121, 122, 123, 125, 126, 127, 128, 130, 132, 133, 134, 137, 138, 141, 142, 143, 145, 146, 147, 148, 151, 152, 154, 155], "angular": [3, 11, 36, 45, 49, 52, 63, 89], "resolv": [3, 4, 11, 36, 49, 53, 81, 88, 107, 114, 116, 130, 135, 143, 147, 151], "photo": [3, 36, 116], "spectroscopi": [3, 27, 36, 151], "drawn": 3, "hemispher": 3, "analys": [3, 7, 8, 20], "nxdata": [3, 4, 6, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 103, 104, 107, 115, 118, 119, 120, 121, 122, 123, 125, 126, 127, 130, 133, 134, 137, 138, 146, 147, 148, 151, 152], "nxmonochrom": [3, 6, 7, 12, 14, 19, 27, 29, 64, 94, 116, 151, 152], "entry1": [3, 14, 15, 27, 28, 118, 143, 147, 151], "entry2": [3, 14, 15, 27, 28, 147, 151], "energi": [3, 5, 6, 7, 11, 17, 18, 19, 27, 28, 32, 36, 39, 41, 42, 48, 49, 56, 59, 63, 69, 87, 95, 97, 107, 114, 137, 146, 147, 148, 151, 152, 154], "nx_number": [3, 4, 8, 11, 14, 15, 17, 18, 19, 46, 47, 48, 49, 51, 52, 55, 57, 62, 65, 68, 72, 76, 78, 80, 86, 87, 89, 97, 100, 107, 116, 146, 147, 148, 151], "nx_energi": [3, 5, 7, 11, 17, 18, 20, 39, 41, 49, 56, 63, 69, 87, 146], "lens_mod": 3, "len": [3, 42, 93, 94, 120, 121, 141], "acquisition_mod": [3, 49], "swept": 3, "entrance_slit_shap": 3, "curv": [3, 56, 94, 116], "straight": 3, "entrance_slit_set": 3, "dial": [3, 80, 154], "entranc": 3, "slit": [3, 4, 52, 56, 76, 86, 94], "entrance_slit_s": 3, "nx_length": [3, 4, 7, 9, 11, 13, 14, 15, 17, 20, 21, 22, 23, 24, 25, 29, 33, 35, 38, 39, 40, 41, 42, 45, 46, 47, 49, 51, 52, 53, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 72, 76, 80, 82, 83, 85, 86, 87, 88, 89, 90, 92, 93, 97, 98, 99, 101, 102, 103, 104, 105, 108, 146], "pass_energi": 3, "time_per_channel": [3, 11], "clearli": [3, 114, 146], "appli": [3, 4, 11, 17, 48, 49, 51, 65, 80, 82, 83, 89, 107, 116, 118, 119, 130, 146, 147, 151], "method": [3, 43, 48, 49, 65, 110, 114, 116, 118, 119, 122, 130, 137, 143, 147], "sensor_s": 3, "2": [3, 4, 11, 14, 15, 24, 36, 39, 48, 49, 50, 51, 52, 61, 62, 68, 72, 75, 80, 87, 95, 103, 107, 116, 120, 121, 123, 124, 126, 128, 130, 132, 133, 134, 141, 143, 145, 146, 147, 148, 151, 154, 155], "raw": [3, 4, 5, 6, 7, 8, 13, 14, 15, 18, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 49, 65, 78, 103, 104, 110, 114, 130, 133], "activ": [3, 125, 127, 138, 144], "region_origin": 3, "origin": [3, 11, 26, 28, 29, 37, 38, 40, 41, 42, 44, 45, 46, 47, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 70, 72, 73, 76, 77, 78, 81, 82, 84, 85, 86, 87, 90, 92, 93, 103, 104, 107, 114, 116, 120, 122, 123, 125, 127, 128, 138, 147, 151], "rectangular": [3, 11, 18, 40, 50, 114], "region": [3, 49, 107], "readout": [3, 11, 49], "region_s": 3, "acquisit": [3, 43, 49, 53, 65, 88, 107, 114, 116, 133, 137, 154], "pass": [3, 38, 52, 57, 94, 95, 116, 138, 143, 147], "sensor": [3, 11, 29, 49, 52, 54, 57, 84, 94], "channel": [3, 11, 13, 107, 116, 118], "cansa": [4, 36, 114, 130], "standard": [4, 11, 36, 38, 46, 48, 49, 57, 65, 69, 80, 82, 83, 95, 96, 110, 112, 114, 115, 116, 118, 121, 127, 130, 132, 133, 134, 138, 143, 145, 147, 151, 152], "store": [4, 11, 16, 18, 19, 25, 36, 39, 48, 49, 55, 65, 70, 73, 82, 94, 107, 118, 119, 121, 122, 123, 125, 126, 127, 128, 130, 131, 133, 134, 137, 141, 142, 143, 145, 147, 148, 151, 153], "reduc": [4, 8, 14, 18, 19, 36, 38, 49, 57, 82, 94, 110, 120, 138, 143, 145, 151], "small": [4, 14, 36, 53, 88, 116, 123, 127, 133, 144, 145, 147, 148], "scatter": [4, 14, 34, 36, 38, 39, 46, 48, 82, 83, 90, 95, 116, 127, 130, 133, 136, 137, 145, 146, 147, 154], "cansas1d": 4, "1": [4, 9, 11, 20, 23, 24, 27, 28, 29, 32, 46, 48, 49, 50, 53, 57, 62, 68, 70, 75, 79, 80, 82, 83, 84, 87, 89, 95, 97, 103, 104, 107, 109, 110, 113, 115, 116, 118, 119, 120, 121, 122, 123, 125, 126, 127, 128, 130, 132, 133, 134, 141, 143, 144, 145, 146, 147, 148, 151, 152, 154, 155], "io": [4, 114, 118, 120, 121, 122, 154, 155], "cansas2012": 4, "nxcansas_exampl": 4, "minimum": [4, 19, 36, 65, 78, 103, 104, 110, 115, 116, 122, 127, 133, 138, 147, 151], "describ": [4, 11, 36, 37, 43, 46, 47, 48, 50, 53, 55, 59, 61, 62, 66, 69, 72, 73, 75, 76, 80, 84, 86, 87, 88, 89, 90, 94, 110, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 127, 128, 132, 133, 134, 137, 138, 145, 146, 147, 148, 151, 152, 154], "full": [4, 11, 30, 31, 34, 35, 46, 49, 52, 53, 78, 80, 84, 88, 95, 120, 122, 123, 127, 130, 143, 154], "imag": [4, 11, 16, 19, 24, 25, 33, 48, 49, 51, 53, 65, 70, 88, 97, 114, 116, 132, 147, 151, 152, 154], "inform": [4, 11, 12, 16, 21, 22, 23, 36, 37, 39, 42, 48, 49, 53, 54, 55, 60, 65, 70, 73, 75, 79, 82, 88, 91, 93, 94, 95, 110, 112, 114, 115, 116, 118, 120, 122, 127, 130, 131, 132, 133, 134, 137, 138, 143, 145, 147, 153, 154, 155], "specif": [4, 11, 19, 48, 49, 62, 89, 95, 104, 107, 110, 114, 115, 116, 119, 120, 124, 127, 133, 134, 136, 138, 144, 145, 147, 152, 154, 155], "dimension": [4, 11, 48, 49, 51, 65, 75, 118, 121, 138, 147, 151], "sa": [4, 14, 15, 36, 151, 154], "consist": [4, 11, 50, 51, 62, 83, 89, 94, 114, 115, 116, 134, 146], "vec": 4, "q": [4, 8, 18, 20, 36, 46, 100, 107, 146], "extern": [4, 54, 62, 66, 70, 82, 84, 94, 130], "practis": 4, "wa": [4, 8, 11, 18, 26, 28, 43, 46, 53, 55, 57, 59, 62, 65, 68, 70, 79, 80, 81, 88, 107, 114, 115, 116, 118, 120, 121, 122, 123, 126, 128, 130, 133, 134, 136, 137, 138, 143, 145, 147, 151, 154], "acquir": [4, 14, 15, 49, 107, 120, 137, 152], "process": [4, 14, 18, 26, 28, 36, 53, 59, 74, 78, 79, 88, 94, 95, 116, 120, 127, 133, 137, 143, 145, 147, 154], "yet": [4, 107, 116, 154, 155], "To": [4, 11, 62, 88, 95, 97, 110, 114, 120, 121, 123, 125, 127, 132, 134, 137, 144, 151], "cansas_class": 4, "map": [4, 47, 55, 75, 114, 116, 151, 154], "nx_class": [4, 81, 88, 114, 116, 118, 119, 120, 121, 122, 123, 126, 128, 133, 146, 152], "sasentri": 4, "sasdata": 4, "sasdetector": 4, "sasinstru": 4, "sasnot": 4, "nxnote": [4, 37, 49, 53, 54, 79, 87, 88, 93, 94, 103, 104, 107, 116], "sasprocess": 4, "sasprocessnot": 4, "nxcollect": [4, 11, 17, 49, 53, 62, 64, 88, 94, 97, 103, 104, 116, 120], "sastransmiss": 4, "sastransmission_spectrum": 4, "sassampl": 4, "sassourc": 4, "chosen": [4, 89, 114, 116, 130], "system": [4, 29, 36, 46, 52, 57, 76, 80, 82, 83, 86, 95, 128, 129, 130, 133, 137, 138, 142, 143, 147, 154], "direct": [4, 5, 7, 11, 14, 15, 19, 24, 25, 26, 29, 35, 36, 38, 41, 45, 46, 49, 51, 52, 62, 73, 76, 82, 85, 87, 89, 94, 97, 114, 116, 125], "y": [4, 9, 11, 13, 14, 15, 19, 24, 25, 26, 29, 35, 37, 38, 40, 41, 45, 47, 48, 49, 52, 62, 66, 67, 68, 72, 73, 76, 80, 82, 86, 87, 89, 90, 97, 103, 104, 114, 116, 120, 121, 126, 147], "z": [4, 11, 19, 24, 25, 26, 29, 37, 38, 40, 45, 47, 48, 49, 52, 62, 66, 67, 68, 72, 73, 76, 82, 86, 87, 89, 90, 114, 115, 116, 147], "ax": [4, 11, 19, 24, 32, 48, 49, 62, 84, 85, 89, 90, 97, 103, 107, 116, 118, 119, 121, 122, 123, 126, 128, 133, 134, 138, 146, 148, 151, 152], "short": [4, 11, 49, 54, 64, 82, 84, 87, 128, 133, 152, 154], "i_ax": 4, "q_indic": 4, "nx_per_length": [4, 58, 100, 146], "nxapertur": [4, 64, 76, 86, 94, 103, 104, 147], "nxcollim": [4, 14, 15, 64, 94], "child": [4, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 121, 147], "techniqu": [4, 14, 15, 36, 88, 110, 116, 127, 155], "replac": [4, 48, 88, 114, 116, 120, 143, 151, 152], "numer": [4, 11, 61, 66, 75, 114, 116, 122, 123, 154], "engin": [4, 40, 41, 63, 67, 87, 114, 116, 121, 145, 147, 154], "unidata": [4, 114], "udunit": [4, 114], "compat": [4, 97, 109, 114, 137, 144], "instruct": [4, 114, 118, 120, 123, 125, 132, 143, 147], "deriv": [4, 9, 11, 26, 28, 29, 80, 82, 84, 114, 115, 119, 147], "declar": [4, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 107, 115, 116, 120, 137, 145, 147, 151], "ambigu": [4, 53, 81, 88, 107, 114, 116, 146, 147], "than": [4, 11, 19, 46, 48, 49, 52, 53, 57, 60, 65, 75, 80, 81, 88, 89, 91, 97, 107, 110, 114, 115, 116, 120, 121, 123, 127, 128, 132, 137, 145, 146, 147, 148, 151, 154, 155], "represent": [4, 11, 16, 47, 114, 115, 116, 125, 133, 137, 146, 147, 151], "Such": [4, 11, 19, 48, 53, 88, 89, 107, 110, 114, 115, 116, 120, 151], "subentri": [4, 53, 88, 107], "recogn": [4, 46, 57, 82, 83, 88, 95, 114, 121, 123, 137], "could": [4, 11, 39, 48, 49, 50, 54, 61, 82, 94, 114, 115, 121, 133, 145, 146, 147, 152], "els": [4, 29, 49, 73, 90, 116, 121, 125], "repres": [4, 11, 16, 29, 49, 50, 53, 64, 75, 88, 115, 116, 121, 125, 127, 130, 133, 136, 137, 143, 147, 148, 151], "identif": [4, 54, 64, 84, 91], "en": [4, 18, 20, 107, 114, 118, 121, 122, 145, 147], "entiti": [4, 133, 134, 138, 147], "associ": [4, 11, 48, 53, 68, 82, 107, 116, 118, 119, 120, 122, 130, 132, 133, 136, 145, 147, 151], "correl": [4, 65, 80], "vector": [4, 11, 39, 46, 51, 73, 84, 85, 89, 97, 116, 147], "magnitud": 4, "sasdata01": 4, "sure": [4, 89, 120, 125], "sever": [4, 11, 29, 49, 62, 112, 114, 116, 120, 130, 133, 137, 147, 151, 154], "mask_indic": 4, "indic": [4, 11, 17, 24, 26, 46, 47, 48, 49, 50, 51, 53, 62, 72, 80, 82, 97, 107, 114, 115, 116, 119, 126, 128, 141, 146, 147, 148], "relationship": [4, 48, 114, 127], "vari": [4, 8, 11, 16, 49, 51, 82, 85, 114, 137, 151], "paramet": [4, 8, 18, 26, 28, 46, 53, 54, 57, 59, 63, 74, 82, 83, 85, 88, 94, 100, 103, 104, 107, 116, 118, 120, 133, 138, 141, 147], "temperature_indic": [4, 48, 114, 151], "pressure_indic": [4, 48, 114], "arrai": [4, 11, 13, 16, 19, 26, 30, 31, 34, 35, 39, 41, 46, 48, 49, 50, 51, 55, 61, 65, 66, 68, 75, 80, 82, 83, 85, 97, 107, 115, 116, 118, 120, 133, 134, 137, 141, 143, 145, 146, 147, 148, 151, 152, 154], "independ": [4, 11, 48, 107, 114, 147, 154], "everi": [4, 48, 52, 55, 65, 72, 114, 127, 130, 133, 144, 147, 152, 154], "five": [4, 55, 65], "list": [4, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 27, 28, 29, 30, 31, 32, 34, 35, 46, 47, 48, 52, 55, 57, 59, 61, 62, 72, 80, 82, 83, 87, 89, 95, 107, 110, 112, 114, 115, 116, 121, 124, 127, 132, 133, 134, 140, 141, 145, 147, 148, 154], "intens": [4, 11, 18, 19, 38, 49, 57, 63, 80, 87, 94, 95, 107, 125], "5": [4, 11, 49, 50, 75, 80, 95, 114, 116, 118, 119, 120, 121, 130, 134, 143, 147, 148, 154, 155], "zero": [4, 46, 48, 55, 65, 89, 107, 114, 116, 118, 146, 147], "3": [4, 9, 11, 24, 29, 46, 47, 48, 49, 50, 51, 53, 57, 72, 77, 80, 82, 83, 88, 89, 90, 97, 103, 104, 107, 113, 116, 120, 121, 122, 126, 128, 130, 132, 133, 134, 143, 146, 147, 154], "4": [4, 11, 49, 50, 62, 80, 81, 95, 114, 116, 118, 120, 121, 126, 130, 132, 133, 134, 138, 141, 143, 147, 148, 154], "three": [4, 11, 47, 48, 51, 85, 89, 114, 116, 118, 130, 133, 137, 143, 148, 152, 154], "t": [4, 48, 84, 89, 107, 114, 118, 120, 121, 122, 123, 126, 127, 138, 145, 146], "mask": [4, 11, 49, 59, 80, 114], "boolean": [4, 11], "where": [4, 9, 11, 14, 15, 30, 35, 46, 48, 49, 52, 55, 57, 62, 68, 73, 80, 81, 82, 83, 84, 89, 90, 95, 107, 114, 115, 120, 121, 123, 127, 130, 133, 137, 143, 146, 147, 148, 151, 152, 154], "fals": [4, 11, 48, 49, 146, 147], "true": [4, 11, 48, 49, 97, 120, 146, 147], "timestamp": [4, 52, 55, 65, 120, 121, 126], "iso": [4, 11, 114, 121], "8601": [4, 11, 114, 121], "accompani": [4, 114], "geometri": [4, 5, 7, 11, 14, 15, 31, 36, 37, 38, 40, 41, 45, 46, 47, 49, 51, 52, 56, 57, 60, 62, 63, 66, 67, 68, 69, 72, 73, 76, 82, 84, 86, 87, 89, 90, 92, 93, 94, 96, 97, 106, 107, 109], "pi": 4, "sin": 4, "warn": [4, 44, 110, 114, 119, 147, 151], "valid": [4, 11, 44, 49, 64, 75, 81, 94, 95, 104, 110, 114, 115, 116, 118, 119, 121, 127, 130, 131, 133, 138, 145, 146, 147, 153], "m": [4, 11, 57, 62, 66, 80, 107, 114, 116, 126, 127, 134, 146], "nm": [4, 87, 146], "prefer": [4, 47, 48, 53, 107, 114, 116, 127, 146, 151], "angstrom": [4, 69, 146], "uncertainti": [4, 48, 49, 65, 116], "flexibl": [4, 115, 116, 133], "q_uncertainti": 4, "estim": [4, 11, 49, 65, 80], "By": [4, 11, 114, 121, 127, 137, 143, 147], "deviat": [4, 48, 49, 65, 69, 80, 92, 114], "special": [4, 11, 49, 55, 94, 109, 110, 116, 133], "width": [4, 11, 17, 46, 56, 59, 85, 87, 92], "subdirectori": [4, 133, 147], "constitu": 4, "report": [4, 11, 112, 123, 127, 129, 131, 147], "resolut": [4, 12, 14, 53, 80, 88], "princip": 4, "qdev": 4, "smear": 4, "dqw": 4, "dql": 4, "demonstr": [4, 118, 120, 124, 151], "unanticip": 4, "assum": [4, 9, 11, 14, 15, 29, 45, 46, 57, 65, 82, 83, 89, 95, 107, 114, 116, 120, 121, 127, 134, 146, 152], "function": [4, 11, 36, 42, 61, 62, 65, 66, 82, 83, 94, 114, 118, 119, 126, 127, 133, 134, 138, 143], "approxim": [4, 19, 49], "equat": 4, "gaussian": [4, 11, 46], "resolutions_descript": 4, "lorentzian": 4, "squar": [4, 100], "9": [4, 11, 20, 49, 80, 114, 115, 118, 120, 121, 128, 148, 154, 155], "triangular": 4, "sawtooth": 4, "outward": 4, "vertic": [4, 24, 41, 46, 47, 72, 92, 116], "edg": [4, 47, 52, 61, 116], "larger": [4, 11, 112, 127, 155], "inward": 4, "smaller": [4, 11, 51, 127, 143], "bin": [4, 13, 49, 118, 120, 121, 122, 123, 133, 138, 143, 147, 148, 151], "rang": [4, 11, 49, 52, 53, 68, 88, 89, 114, 118, 121, 137, 147, 152], "contribut": [4, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110, 111, 114, 115, 116, 124, 127, 129, 131, 133, 136, 145, 147, 154, 155], "assess": 4, "subgroup": [4, 114, 115, 116, 148], "form": [4, 11, 47, 49, 62, 72, 75, 95, 100, 114, 116, 130, 133, 137, 144, 145, 147, 152, 154, 155], "absolut": [4, 11, 49, 52, 65, 90, 116, 120, 121, 122, 145, 147], "sigma": [4, 87], "differenti": [4, 138], "cross": [4, 38, 107], "volum": [4, 26, 36, 46, 57, 72, 82, 83, 95, 114, 116, 127, 146, 151], "solid": [4, 49, 67, 96, 109, 146], "cm": [4, 58, 87, 146], "sr": [4, 146], "atom": 4, "arbitrari": [4, 11, 30, 34, 48, 51, 65, 75, 97, 116], "ratio": [4, 52], "meaningless": 4, "present": [4, 11, 46, 48, 49, 54, 57, 59, 60, 65, 75, 82, 83, 95, 114, 115, 116, 120, 127, 130, 137, 138, 147, 152, 154, 155], "few": [4, 116, 121, 127, 143, 145], "fortun": 4, "area": [4, 11, 14, 15, 16, 29, 36, 39, 49, 51, 87, 114, 124, 132, 146, 152], "consider": [4, 112], "improv": [4, 62, 112, 147], "aris": [4, 116], "automat": [4, 11, 53, 88, 114, 121, 134, 136, 151], "convert": [4, 11, 49, 55, 60, 75, 114, 116, 121, 127, 137, 138, 141, 143, 154], "canon": [4, 116, 152], "differ": [4, 16, 26, 46, 48, 49, 52, 62, 63, 68, 78, 81, 89, 91, 95, 96, 107, 114, 115, 116, 121, 122, 125, 127, 128, 130, 137, 143, 147, 148, 151, 152], "indiscrimin": 4, "analyt": 4, "restrict": [4, 19, 84, 110, 114, 115, 146], "meaning": [4, 116], "fraction": [4, 68, 82, 83, 95, 114], "densiti": [4, 11, 46, 57, 58, 61, 66, 82, 83, 95, 116, 122, 146], "directli": [4, 11, 48, 49, 114, 116, 118, 121, 122, 123, 126, 128, 129, 132, 137, 145, 147], "factor": [4, 11, 48, 52, 65, 80, 107], "scale": [4, 11, 17, 26, 48, 65, 68, 94, 107, 114, 116, 118, 147, 148, 151], "sai": [4, 55, 65, 75, 127, 147, 148], "treat": [4, 19, 110, 151], "unknown": [4, 100, 107, 147], "handl": [4, 114, 116, 119, 121, 134, 138, 143, 145], "m2": 4, "m3": 4, "cm2": 4, "cm3": 4, "g": [4, 11, 38, 39, 49, 50, 53, 54, 68, 70, 78, 82, 84, 88, 89, 91, 94, 95, 107, 114, 116, 121, 126, 132, 133, 137, 146, 147, 152], "idev": [4, 127], "1d": [4, 116, 151], "scaling_factor": [4, 48, 65], "k": [4, 11, 47, 49, 51, 55, 63, 72, 80, 84, 88, 107, 114, 118, 120, 146, 147, 151], "multipli": [4, 46, 57, 82, 83, 89, 95, 114], "uniti": 4, "i_scal": 4, "i_scaling_dev": 4, "exact": [4, 36, 47, 51, 115, 116, 121, 137, 148], "those": [4, 11, 49, 100, 115, 116, 119, 121, 123, 127, 137, 145, 151, 155], "high": [4, 11, 49, 52, 84, 116, 121, 125, 133, 137, 154], "bons": 4, "hart": 4, "perpendicular": [4, 46, 116], "low": [4, 52, 53, 61, 84, 88, 110, 125, 133, 143, 154], "qmean": 4, "higher": [4, 75, 107, 114, 120, 121, 147], "shadowfactor": 4, "nx_dimensionless": [4, 20, 38, 49, 55, 57, 63, 68, 77, 146], "pixel": [4, 9, 11, 13, 14, 15, 19, 24, 25, 29, 35, 47, 49, 51, 72, 80, 97, 103, 104, 114, 115, 116, 147, 151], "affect": 4, "penumbra": 4, "ncnr": [4, 154], "barker": 4, "pedersen": 4, "1995": [4, 130, 137], "appl": [4, 133], "cryst": [4, 46, 57, 82, 133], "28": [4, 114, 121], "105": 4, "114": 4, "carefulli": [4, 123], "ignor": 4, "anlysi": 4, "nxbeam": [4, 11, 40, 64, 76, 82, 86, 94, 95, 97], "properti": [4, 11, 26, 36, 39, 49, 94, 114, 116], "downstream": [4, 60, 63, 90, 95], "apertur": [4, 12, 37, 42, 64, 85, 93, 94, 103, 104], "variat": [4, 11, 19, 25, 36, 68, 121, 123], "nxpinhol": [4, 94], "nxslit": [4, 94], "sasapertur": 4, "pinhol": [4, 76, 94], "blade": [4, 37, 45], "soller": [4, 45], "x_gap": [4, 86], "y_gap": [4, 86], "diverg": [4, 39, 41, 45, 97], "sascollim": 4, "amount": [4, 38, 143], "insert": [4, 63, 64, 94, 114, 145, 152], "san": [4, 14, 40, 127], "distanc": [4, 7, 9, 11, 13, 14, 15, 17, 21, 22, 23, 24, 25, 29, 38, 39, 40, 41, 42, 49, 52, 53, 56, 64, 67, 68, 78, 82, 87, 88, 90, 97, 98, 99, 101, 102, 103, 104, 105, 108, 114, 116], "sdd": 4, "previou": [4, 49, 116, 121, 123, 136, 151], "camera": [4, 16, 32, 33, 35, 36, 120], "crystal": [4, 10, 22, 23, 29, 31, 32, 33, 34, 36, 46, 57, 64, 69, 77, 82, 83, 94, 103, 104, 107, 116, 148, 152], "slit_length": 4, "x_posit": 4, "y_posit": 4, "roll": 4, "about": [4, 48, 53, 79, 88, 89, 111, 112, 116, 118, 120, 122, 123, 127, 130, 131, 132, 133, 134, 137, 143, 144, 147, 151, 154], "pitch": 4, "yaw": 4, "beam_center_x": [4, 11, 14, 15, 35, 49, 97, 114], "center": [4, 9, 11, 14, 15, 23, 29, 35, 37, 38, 40, 49, 52, 62, 67, 76, 82, 85, 87, 90, 97, 114, 116, 128, 138], "hit": [4, 11, 14, 15, 35, 49, 143], "plane": [4, 11, 34, 39, 45, 46, 52, 62, 66, 68, 76, 86, 87, 100, 116], "outsid": [4, 11, 14, 15, 35, 49, 62, 66, 89, 114, 116], "physic": [4, 11, 14, 15, 26, 36, 48, 49, 85, 114, 116, 130, 133, 138], "real": [4, 8, 49, 60, 97, 100, 107, 118, 121, 134, 138, 141], "neg": [4, 45, 52, 60, 64, 66, 67, 87, 116, 147], "beam_center_i": [4, 11, 14, 15, 35, 49, 97], "x_pixel_s": [4, 9, 13, 14, 15, 24, 25, 29, 49, 97], "scalar": [4, 11, 39, 49, 68, 73, 75, 100, 116, 118, 128, 133, 147, 151], "y_pixel_s": [4, 9, 13, 14, 15, 24, 25, 29, 49, 97], "deprec": [4, 11, 37, 40, 41, 45, 46, 49, 52, 53, 56, 57, 60, 62, 63, 65, 66, 67, 68, 69, 82, 83, 84, 87, 92, 103, 104, 107, 109, 116, 146, 147], "issu": [4, 11, 53, 65, 69, 82, 103, 104, 112, 114, 116, 129, 130, 138, 143, 147, 150, 151, 154], "765": 4, "redund": 4, "uv": [4, 87], "laser": [4, 87], "optic": [4, 62, 87, 94], "ion": [4, 49, 84, 87], "plasma": [4, 87], "ultraviolet": [4, 87], "visibl": [4, 87], "light": [4, 63, 87, 94, 116], "positron": [4, 87], "proton": [4, 87, 103, 104], "beam_shap": 4, "incident_wavelength": [4, 11, 39], "wavelength_min": 4, "lowest": [4, 11, 49], "wavelength_max": 4, "highest": 4, "incident_wavelength_spread": [4, 11, 39], "fwhm": [4, 11, 39, 42, 92], "beam_size_x": 4, "beam_size_i": 4, "thick": [4, 11, 38, 45, 46, 49, 57, 58, 59, 61, 62, 66, 82, 93], "transmiss": [4, 11, 35, 38, 42, 46, 57, 82, 83], "i_0": 4, "dimensionless": [4, 89], "abil": 4, "spectrum": [4, 11, 19, 41, 63, 116, 147], "instead": [4, 37, 40, 41, 45, 46, 49, 52, 53, 56, 57, 62, 63, 66, 67, 68, 69, 82, 84, 87, 92, 114, 116, 118, 120, 123, 132, 147, 151], "elsewher": [4, 107, 121, 127, 147], "step": [4, 12, 14, 15, 16, 35, 79, 89, 114, 116, 125, 137, 147, 151], "Be": [4, 111, 120, 125, 132, 151], "yyyi": [4, 121], "mm": [4, 82, 121], "ddthh": [4, 121], "ss": [4, 121], "dd": 4, "hh": 4, "tr": [4, 114], "datetim": [4, 114, 120, 121], "wikipedia": [4, 114, 145, 147], "wiki": [4, 48, 114, 130, 132, 145, 147], "iso_8601": 4, "take": [4, 11, 49, 53, 88, 96, 97, 100, 115, 119, 121, 127, 143, 147], "subprocess": 4, "anyth": [4, 44, 53, 79, 116, 154], "cover": [4, 14, 15, 29, 36, 70, 94, 110, 147, 151], "transmission_spectrum": 4, "sastransmission_spectrum01": 4, "t_ax": 4, "tdev": 4, "gap": [4, 11, 46, 49, 63, 86], "spread": [4, 11, 14, 39, 92, 97], "max": [4, 78], "min": [4, 78], "nxtofraw": [5, 7, 36], "spectromet": [5, 7, 20, 36], "nxdisk_chopp": [5, 13, 64, 94, 103, 104], "nxfermi_chopp": [5, 17, 64, 94, 104], "definitli": 5, "rotation_spe": [5, 52, 56, 92], "chopper": [5, 13, 17, 21, 22, 23, 52, 53, 55, 56, 64, 88, 94, 103, 104, 133, 152], "fermi_chopp": [5, 17, 64, 104], "disk_chopp": [5, 64, 103, 104], "nx_frequenc": [5, 11, 45, 52, 56, 87, 92, 103, 104, 146], "speed": [5, 52, 56, 78, 92, 127, 137], "disk": [5, 52, 64, 103, 104, 114, 127, 132], "fermi": [5, 17, 56, 64, 94, 104], "fluoresc": [6, 36, 147, 154], "ne": [6, 19, 32, 143, 148, 151], "nvar": 8, "taken": [8, 25, 49, 65, 90, 95, 138, 143, 147, 148], "nqx": 8, "nqy": 8, "nxparamet": [8, 18, 26, 28, 53, 88, 94, 116, 151], "input": [8, 18, 49, 56, 92, 121, 122, 123, 137, 151], "filenam": [8, 18, 120, 121, 126, 143, 151], "output": [8, 11, 18, 49, 63, 72, 120, 121, 122, 123, 133, 154, 155], "eventu": [8, 18, 110], "client": [8, 48, 121, 148], "multidimension": [8, 48, 49, 114, 116, 133, 141], "varied_vari": 8, "p": [8, 48, 100, 107, 114, 134, 151], "mf": 8, "qx": [8, 18, 127], "qy": [8, 18], "laue": [9, 32, 33, 36, 46, 154], "nxpixel": [9, 14, 15, 29], "nypixel": [9, 14, 15, 29], "ntof": [9, 13, 15, 114], "flight": [9, 11, 13, 15, 21, 22, 23, 36, 49, 68, 103, 104, 114, 116, 133, 134, 146, 152], "planar": 9, "2d": [9, 11, 114, 151], "azimuthal_angl": [9, 14, 15, 21, 22, 23, 46, 49, 80, 103, 104, 114, 116], "azimuth": [9, 14, 15, 17, 21, 22, 23, 46, 49, 80, 103, 104], "nx_posint": [9, 29, 48, 49, 70, 79, 146], "time_of_flight": [9, 13, 15, 21, 22, 23, 49, 68, 103, 104, 114, 118, 125, 134], "nx_time_of_flight": [9, 13, 15, 21, 22, 23, 49, 55, 68, 103, 104, 146], "orientation_matrix": [9, 20, 29, 46, 57, 82, 83, 107], "orient": [9, 17, 20, 29, 37, 38, 40, 41, 42, 45, 46, 49, 52, 54, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 73, 76, 77, 78, 82, 83, 84, 85, 86, 87, 89, 92, 93, 95, 100, 103, 104, 107, 116, 127], "matrix": [9, 20, 29, 46, 57, 82, 83, 89, 100, 107, 116], "buse": [9, 29, 46, 57, 82, 83, 107], "levi": [9, 29, 46, 57, 82, 83, 107], "strictli": [9, 29], "ub": [9, 29, 82, 107], "bow": [9, 29], "usag": [9, 29, 46, 49, 57, 115, 116, 143, 144, 151, 154], "thie": 9, "nearli": [9, 29, 116, 133, 141], "unit_cel": [9, 20, 29, 46, 82, 114], "6": [9, 11, 20, 29, 46, 49, 73, 80, 82, 97, 103, 104, 109, 114, 116, 118, 120, 121, 126, 128, 134, 147, 148, 154], "cell": [9, 20, 29, 46, 57, 82, 83, 95], "b": [9, 29, 46, 47, 48, 57, 82, 83, 96, 107, 116, 121, 126, 147], "alpha": [9, 29, 31, 46, 57, 82, 83, 116], "beta": [9, 29, 46, 57, 82, 83], "gamma": [9, 29, 34, 46, 57, 82, 83], "again": [9, 29, 134, 138, 143, 151], "primari": [9, 11, 20, 49, 107, 114], "macromolecular": [11, 36], "crystallographi": [11, 36, 82, 83, 116], "mx": 11, "produc": [11, 19, 53, 75, 88, 111, 116, 118, 120, 128, 133, 137, 147], "modul": [11, 49, 51, 80, 94, 126, 138], "datarank": [11, 48], "np": [11, 12, 16, 18, 19, 20, 27, 28, 29, 30, 31, 34, 35, 49, 51, 68, 120, 151], "slowest": [11, 49, 51, 114], "third": [11, 18, 29, 47, 49, 114, 147], "known": [11, 48, 49, 74, 78, 107, 114, 115, 116, 120, 130, 134, 137, 138, 147], "groupindex": 11, "hierarch": [11, 50, 116, 128, 133, 154], "parent": [11, 47, 48, 50, 51, 72, 116, 147], "top": [11, 50, 52, 53, 87, 97, 114, 116, 118, 127, 128, 133, 138, 141, 143, 152], "nxattenu": [11, 35, 57, 64, 94, 103, 104], "nxdetector_group": [11, 64, 94], "nxdetector_modul": [11, 49, 50, 94, 116], "nxtransform": [11, 37, 38, 40, 41, 42, 45, 46, 49, 52, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 68, 69, 73, 76, 77, 78, 82, 84, 86, 87, 92, 93, 94, 95, 97, 100, 114, 116, 146], "recommend": [11, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 114, 116, 124, 127, 130, 132, 137, 146, 152], "file_nam": [11, 70, 81, 118, 121, 126, 134], "file_tim": [11, 81, 118, 120, 121, 126, 134], "nxroot": [11, 94, 107, 116, 120], "utc": [11, 114], "suffix": [11, 114, 147], "avoid": [11, 48, 114, 116, 127, 143, 147], "confus": [11, 89, 114, 116], "local": [11, 45, 49, 53, 73, 85, 86, 88, 114, 115, 116, 118, 132, 137, 138, 143, 146, 147], "zone": [11, 59, 94, 114, 146], "beamlin": [11, 37, 39, 44, 45, 47, 64, 66, 72, 94, 97, 98, 99, 101, 102, 103, 104, 105, 108, 116, 133, 151], "time_zon": 11, "last": [11, 37, 38, 40, 41, 42, 45, 46, 48, 49, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 81, 82, 84, 86, 87, 92, 93, 107, 114, 147], "fill": [11, 87, 93, 118], "accur": 11, "observ": [11, 38, 80, 137], "abort": [11, 151], "otherwis": [11, 39, 49, 52, 53, 107, 114, 115, 143, 146, 147, 151], "prevent": [11, 127], "omit": [11, 46, 48, 51, 53, 57, 59, 82, 83, 89, 95, 114, 134, 147], "end_time_estim": 11, "avail": [11, 36, 48, 53, 114, 125, 131, 132, 133, 134, 136, 138, 143, 144, 145, 147, 152, 154], "frame": [11, 24, 25, 29, 49, 51, 75, 80, 89, 103, 104, 114], "depends_on": [11, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 100, 116], "anywher": [11, 116, 145, 151], "goniomet": [11, 89], "jet": [11, 87], "transform": [11, 26, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 97, 146], "reason": [11, 16, 43, 48, 49, 114, 127, 133, 137, 151, 152], "mainli": [11, 39], "accommod": [11, 133], "xfel": [11, 154], "shot": 11, "exposur": [11, 49, 89, 114, 120], "vocabulari": 11, "mmcif": [11, 75], "wwpdb": [11, 75], "mmcif_pdbx_v50": 11, "dic": [11, 75], "_diffrn_sourc": 11, "pdbx_synchrotron_beamlin": 11, "highli": [11, 46, 116], "short_nam": [11, 54, 64, 84, 87], "acronym": [11, 64, 87], "offset": [11, 26, 48, 49, 51, 55, 89, 92, 103, 104, 114, 116, 147], "attenu": [11, 35, 38, 64, 94, 95, 103, 104], "attenuator_transmiss": [11, 35, 38], "detector_group": [11, 64], "logic": [11, 50, 51, 82, 94, 116, 147], "own": [11, 49, 50, 62, 88, 114, 115, 127, 128, 133], "decompos": [11, 50], "endstat": [11, 50], "group_nam": [11, 50], "group_index": [11, 50], "hierarchi": [11, 16, 21, 22, 23, 29, 50, 53, 75, 88, 110, 114, 116, 122, 133, 138, 148, 151, 154], "group_par": [11, 50], "det": [11, 50, 80], "four": [11, 30, 36, 41, 50, 116, 133, 138, 151], "dtl": [11, 50], "dtr": [11, 50], "dll": [11, 50, 143], "dlr": [11, 50], "howev": [11, 48, 60, 65, 68, 75, 114, 116, 133, 136, 143, 145, 146, 154], "position": [11, 64, 78, 82, 94, 103, 104, 107, 151, 152], "chain": [11, 37, 38, 40, 41, 42, 45, 46, 49, 51, 52, 56, 57, 58, 59, 61, 62, 63, 66, 67, 68, 69, 75, 76, 77, 78, 82, 84, 86, 87, 89, 92, 93, 114, 116, 121], "manufactur": [11, 42, 49, 59, 120, 130], "model": [11, 48, 49, 54, 84, 95, 114, 116, 120, 121, 134], "dectector": 11, "preced": [11, 115, 147], "calcul": [11, 12, 14, 68, 82, 95, 114, 116, 120], "distance_deriv": 11, "nx_boolean": [11, 17, 46, 48, 49, 67, 80, 84, 87, 93, 146], "rather": [11, 48, 49, 60, 75, 97, 110, 114, 116, 120, 121, 123, 128, 132, 145, 147, 148], "delector": 11, "dead_tim": [11, 49], "dead": [11, 49, 52, 152], "count_tim": [11, 49, 68, 107], "elaps": [11, 49, 65, 68, 82, 107], "beam_center_deriv": 11, "quantiti": [11, 26, 84], "angular_calibration_appli": [11, 49], "angular_calibr": [11, 49], "flatfield_appli": [11, 49], "flat": [11, 24, 45, 46, 49, 66], "flatfield": [11, 49], "compress": [11, 118, 120, 128, 138], "flatfield_error": [11, 49], "plural": 11, "error": [11, 17, 48, 49, 65, 69, 80, 103, 104, 110, 116, 119, 120, 121, 134, 143, 145, 147], "pixel_mask_appli": [11, 49], "pixel_mask": [11, 49, 114], "32": [11, 48, 49, 114, 125, 141, 143, 151], "blind": [11, 49], "unwant": [11, 49], "undesir": [11, 49], "respond": [11, 49], "noisi": [11, 49], "undefin": [11, 49, 114, 146, 147], "cluster": [11, 46, 49, 57, 82, 83, 95], "problemat": [11, 49], "7": [11, 49, 80, 114, 116, 118, 120, 121, 128, 134, 148, 154], "around": [11, 49, 52, 80, 89, 116, 133, 151], "beamstop": [11, 40, 49], "30": [11, 49, 114, 120, 121, 128, 152], "31": [11, 49, 114, 121, 122, 123, 128], "virtual": [11, 49, 88, 97, 116], "corner": [11, 49], "interpol": [11, 49], "0x0000ffff": [11, 49], "upper": [11, 49, 80, 84, 114, 121, 147], "byte": [11, 49, 116, 133, 134, 137, 138, 141, 143, 147], "sole": [11, 49], "reject": [11, 49], "unless": [11, 46, 49, 57, 82, 83, 95, 107], "lower": [11, 49, 80, 84, 114, 125, 127, 147], "depth": [11, 49, 61, 67], "fewer": [11, 49], "permiss": [11, 49, 53, 110], "pixel_mask_n": [11, 49], "n": [11, 46, 48, 49, 52, 68, 78, 80, 84, 116, 119, 126, 128, 134], "bad": [11, 49, 132], "shadow": [11, 49], "pixel_mask_2": [11, 49], "cumul": [11, 49], "bitwis": [11, 49], "OR": [11, 49], "countrate_correction_appli": [11, 49], "rate": [11, 49, 84], "bit_depth_readout": [11, 49], "detector_readout_tim": [11, 49], "millisecond": [11, 49], "import": [11, 14, 40, 42, 49, 51, 89, 95, 97, 111, 114, 116, 118, 120, 121, 122, 123, 137, 138, 143, 145, 148, 152], "frame_tim": [11, 49], "exposure_tim": [11, 49], "gain_set": [11, 49], "saturation_valu": [11, 49], "goe": [11, 49, 103, 104, 120], "satur": [11, 49], "invalid": [11, 24, 49, 114, 151], "underload_valu": [11, 49], "equal": [11, 49, 89, 114, 147, 148], "greater": [11, 49, 52, 62, 80, 116, 133, 146, 147], "sensor_materi": [11, 49], "sens": [11, 49, 52, 116, 152], "scintil": [11, 49, 68], "materi": [11, 37, 45, 46, 49, 56, 57, 59, 61, 62, 66, 67, 77, 87, 93, 95, 103, 104], "sensor_thick": [11, 49], "threshold_energi": [11, 49], "counter": [11, 49, 107, 120], "adjust": [11, 49], "optim": [11, 49], "threshold": [11, 49], "ccd": [11, 49], "plate": [11, 33, 49, 59, 84, 94], "cmo": [11, 49], "non": [11, 38, 47, 65, 72, 76, 86, 121, 128, 147, 154, 155], "perform": [11, 14, 15, 42, 116, 120, 125, 137, 138, 143, 151, 154], "detector_modul": [11, 49], "oper": [11, 87, 96, 114, 116, 134, 136, 138, 147, 154], "sync": 11, "pars": [11, 48, 114, 121, 127], "definiton": 11, "hyperslab": [11, 51], "span": [11, 154], "entir": [11, 49, 116, 144, 147, 155], "data_origin": [11, 51], "slow": [11, 51, 114], "fast": [11, 49, 51, 114, 127], "data_s": [11, 51], "data_strid": 11, "stride": [11, 114], "module_offset": [11, 51], "regard": [11, 51, 116, 152], "transformation_typ": [11, 51, 89, 116, 146], "translat": [11, 24, 25, 29, 51, 60, 82, 89, 94, 97, 103, 104, 116, 133, 146, 154], "fast_pixel_direct": [11, 51], "fastest": [11, 49, 51, 52, 114], "itself": [11, 21, 22, 23, 51, 53, 84, 88, 116, 134, 137, 145], "slow_pixel_direct": [11, 51], "monchromat": 11, "permit": [11, 46, 114, 116, 127, 146, 147], "presenc": [11, 147], "absenc": 11, "incident_wavelength_x": 11, "polychromat": 11, "rel": [11, 52, 55, 65, 73, 76, 82, 83, 86, 89, 90, 95, 98, 99, 101, 102, 105, 108, 116, 120, 121, 147], "weight": [11, 114, 146], "incident_wavelength_weight": 11, "variant": [11, 137], "837": 11, "flux": [11, 19, 39, 87, 146], "nx_flux": [11, 39, 87, 146], "total_flux": 11, "incident_beam_s": 11, "airi": 11, "diamet": [11, 33, 49, 59, 76, 85, 93], "hat": 11, "incident_polarisation_stok": 11, "incident_wavelength_spectrum": 11, "storag": [11, 19, 87, 94, 112, 116, 123, 124, 127, 128, 130, 137, 147, 151], "ring": [11, 19, 87, 94, 147], "pdbx_synchrotron_sit": 11, "polaris": 11, "stoke": 11, "countrat": [11, 49], "underload": [11, 49], "reflectomet": [12, 13, 36], "doe": [12, 29, 49, 82, 89, 114, 116, 127, 128, 133, 136, 138, 152, 155], "xsize": [13, 23, 24, 25, 114, 151], "ysize": [13, 23, 24, 25, 114, 151], "meant": [14, 116, 121, 143], "sax": [14, 40, 88, 94, 127, 151], "wsa": 14, "graze": 14, "gisa": 14, "nxgeometri": [14, 15, 37, 40, 41, 45, 46, 49, 52, 54, 56, 57, 62, 63, 66, 67, 68, 69, 73, 82, 84, 85, 87, 90, 92, 94, 103, 104], "nxshape": [14, 15, 46, 60, 61, 66, 94, 95, 103, 104, 116], "wavelength_spread": [14, 92], "delta_lambda": 14, "delta": 14, "nxcylind": [14, 15, 85], "nxbox": [14, 15, 85], "aequatorial_angl": [14, 15], "aequatori": [14, 15], "stringent": 16, "show": [16, 46, 57, 95, 111, 114, 115, 116, 118, 120, 121, 122, 123, 125, 126, 128, 133, 143, 148, 151, 152, 154, 155], "rule": [16, 20, 72, 107, 115, 133, 134, 145, 147, 152], "throughout": [16, 48], "respect": [16, 39, 48, 49, 55, 57, 95, 114, 116, 148], "256x256": 16, "256": 16, "equival": [16, 49, 80, 115, 116, 141, 143, 148], "familiar": [16, 116, 121], "classic": 16, "tabular": [16, 151], "hdf": [16, 60, 81, 114, 115, 116, 119, 125, 126, 127, 130, 131, 132, 134, 137, 143, 151], "unlimit": [16, 151], "append": [16, 48, 89, 107, 114, 116, 151], "built": [16, 114, 118, 131, 133, 140, 141, 154], "static": [16, 119], "new": [16, 29, 48, 49, 53, 88, 107, 109, 112, 114, 115, 116, 118, 119, 121, 123, 125, 127, 130, 132, 133, 134, 135, 137, 143, 147, 154], "xdim": [16, 65], "ydim": [16, 65], "inelast": [17, 36, 154], "program_nam": [17, 53, 88, 115, 151], "nxspe_info": 17, "fixed_energi": 17, "ki_over_kf_sc": 17, "whether": [17, 38, 46, 57, 67, 82, 83, 95, 138, 154], "ki": 17, "kf": 17, "dc": 17, "mslice": 17, "azimuthal_width": 17, "polar_width": 17, "seblock": [17, 54], "info": 17, "om": [18, 36], "grid": [18, 147, 151], "visualis": [18, 133, 154], "regrid": 18, "qe": 18, "nx_wavenumb": [18, 46, 146], "qz": 18, "transfer": [18, 39, 48, 133, 143], "stxm": [19, 36], "interferomet": 19, "chronolog": 19, "3d": [19, 26, 36, 114, 116], "nume": 19, "numi": [19, 103, 104], "numx": [19, 103, 104], "stack": [19, 48, 66, 114], "former": [19, 138], "loss": 19, "precis": [19, 114, 116, 133], "latter": [19, 138], "simplifi": [19, 120, 122, 130, 134, 137, 138, 143, 145, 147, 151], "constraint": 19, "line": [19, 36, 44, 61, 70, 93, 94, 107, 114, 116, 120, 121, 122, 128, 133, 134, 138, 141, 146, 147, 148, 154], "spectra": 19, "sample_imag": 19, "compar": [19, 118, 119, 120, 121, 122, 123, 134, 141, 143], "ny": [19, 26, 48], "detectorrank": 19, "sample_x": 19, "sample_i": 19, "sample_z": 19, "stxm_scan_typ": 19, "label": [19, 48, 60, 114, 116, 121, 127, 133, 134, 147, 154], "human": [19, 114, 127], "photon_energi": 19, "focu": [19, 42, 59, 93, 94, 154], "zoneplate_z": 19, "osa": 19, "osa_i": 19, "osa_x": 19, "detector_i": 19, "detector_x": 19, "summaris": 19, "spatial": [19, 61, 80, 90, 94, 147], "parallel": [19, 46, 62, 76, 137], "therefor": [19, 49, 89, 95, 114, 138, 151], "proxi": 19, "tripl": [20, 36], "trademark": 20, "ta": [20, 87, 115], "align": [20, 24, 49, 52, 90, 121], "nxscan": [20, 36], "ei": [20, 147], "ef": [20, 147], "qh": 20, "qk": 20, "ql": 20, "sgu": [20, 151], "sgl": 20, "denot": [20, 114, 148], "ntimechan": [21, 22, 23], "pre_sample_flightpath": [21, 22, 23, 53, 88], "moder": [21, 22, 23, 53, 64, 67, 88, 94, 103, 104, 136], "t0": [21, 22, 23, 52, 53, 88, 134], "detector_numb": [21, 22, 47, 49, 55], "pre": [21, 22, 23, 53, 88, 114, 116], "flightpath": [21, 22, 23, 53, 88], "run_numb": [22, 103, 104, 134], "natur": [22, 23, 49, 95, 103, 104, 147], "liquid": [22, 23, 67], "integral_count": 22, "tomographi": [24, 25, 26, 36, 49, 145], "dark": [24, 25, 125], "bright": [24, 25], "distinguish": [24, 65, 116, 127, 147], "carri": [24, 75], "image_kei": 24, "nframe": 24, "project": [24, 100, 114, 132, 137, 143, 154, 155], "magic": 24, "x_rotation_axis_pixel_posit": 24, "y_rotation_axis_pixel_posit": 24, "horizont": [24, 41, 46, 87, 116, 121], "somehow": 24, "best": [24, 29, 48, 49, 62, 78, 110, 114, 116, 130, 137, 143], "x_translat": [24, 25, 29, 82, 116], "y_translat": [24, 25, 29], "z_translat": [24, 25], "fluctuat": [24, 25], "phase": [25, 36, 52, 63, 151], "contrast": [25, 36, 116], "properli": [25, 49, 111, 116, 121, 125, 143, 155], "sequenc": [25, 49, 70, 75, 79, 89, 114, 116, 148, 151], "nbrightfram": [25, 49], "ndarkfram": 25, "nsamplefram": 25, "nphase": 25, "bright_field": 25, "sequence_numb": [25, 49], "dark_field": 25, "construct": [26, 36, 49, 89, 94, 96, 106, 109, 110, 114, 116, 131, 145, 151, 153, 154, 155], "voxel": 26, "nz": [26, 48], "reconstruct": [26, 28, 79, 94], "raw_fil": [26, 28], "realli": [26, 48, 68, 127, 132], "absorpt": [27, 28, 36, 38, 95, 151], "absorb": [27, 28, 36, 37, 45, 56, 95], "incoming_beam": 27, "absorbed_beam": 27, "xa": [28, 36], "xas_data_reduct": 28, "detector1": 29, "detector2": [29, 151], "detectorn": 29, "maxoccur": [29, 115], "frame_start_numb": [29, 49], "px": [29, 49, 80], "coupl": [29, 49, 67, 103, 104, 143, 154], "return": [29, 49, 118, 134, 138, 143, 147], "concaten": [29, 49], "whatev": [29, 69, 114, 116, 152], "data1": [29, 118], "data2": 29, "data3": 29, "nxxbase": [30, 31, 34, 35, 36], "circl": [30, 36, 116, 151], "eulerian": [30, 36, 116], "cradl": [30, 36, 116], "log": [30, 34, 45, 46, 54, 57, 65, 67, 68, 70, 82, 84, 103, 104, 116, 133, 146], "reciproc": [30, 34, 100, 151], "space": [30, 34, 45, 46, 49, 52, 57, 61, 76, 82, 83, 86, 95, 100, 111, 114, 116, 127, 147, 151, 154], "chi": [30, 116, 151], "phi": [30, 31, 80, 116, 118, 151], "kappa": [31, 36], "cad4": [31, 36], "inclin": [31, 152], "arm": [31, 133], "nxxrot": [32, 36], "nxxlaue": [33, 36], "cylindr": [33, 46, 47, 49, 93, 94], "tilt_angl": 34, "tilt": [34, 116], "rotation_angle_step": 35, "made": [35, 85, 95, 106, 107, 114, 123, 127, 130, 137, 143, 147, 154], "reserv": [36, 53, 114, 116], "spell": [36, 81, 87, 107, 110, 114, 116, 137, 147], "contract": [36, 116], "liber": [36, 48, 110, 114], "involv": [36, 110, 112, 122, 133, 136, 151, 152], "tree": [36, 88, 97, 110, 116, 120, 121, 122, 123, 125, 127, 130, 132, 133, 134, 139, 140, 141, 142, 147, 151, 154, 155], "nxarp": [36, 127], "nxcansa": [36, 110, 127, 154], "nxdirecttof": 36, "nxfluo": [36, 110, 151], "nxindirecttof": 36, "nxiqproc": [36, 127], "nxlauetof": 36, "nxmx": [36, 80, 154], "nxrefscan": 36, "nxreftof": 36, "nxsa": [36, 110, 127, 130, 151], "nxsastof": 36, "nxspe": 36, "nxsqom": 36, "nxstxm": [36, 154], "nxta": 36, "nxtofnpd": 36, "nxtofsingl": 36, "nxtomo": 36, "nxtomophas": 36, "nxtomoproc": 36, "nxxa": 36, "nxxasproc": 36, "nxxeuler": 36, "nxxkappa": 36, "nxxlaueplat": 36, "nxxnb": 36, "lead": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114, 115, 130, 147, 151], "niac2014": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114], "2014_how_to_find_default_data": [37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 114, 130], "surfac": [37, 38, 40, 45, 46, 52, 61, 62, 66, 67, 68, 72, 84, 86, 96, 100, 109, 116, 147], "complex": [37, 38, 49, 62, 76, 84, 86, 95, 116, 121, 122, 130, 133], "asymmet": [37, 38], "nxoff_geometri": [37, 38, 47, 49, 94, 96, 106, 115], "unambigu": [37, 38, 49, 144], "blade_geometri": 37, "base_class": [37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 110, 145], "devic": [38, 40, 52, 63, 64, 69, 78, 89, 93, 94, 116], "uncertain": [38, 57], "nxfilter": [38, 64, 94], "band": [38, 57, 94], "filter": [38, 57, 64, 94], "composit": [38, 57, 77, 82, 95, 133], "polythen": 38, "scattering_cross_sect": 38, "nx_cross_sect": [38, 146], "coher": 38, "incoher": 38, "absorption_cross_sect": 38, "nomin": [38, 46, 49, 57, 67, 68, 77, 84, 116], "transmit": [38, 45, 52, 56, 76], "move": [38, 78, 89, 95, 114, 116, 123, 137, 146, 147, 154], "stamp": [38, 65, 114, 116, 121, 133, 146, 147, 151], "particulari": 38, "referenc": [39, 43, 121, 133], "valuabl": [39, 133], "incident_energi": 39, "enter": [39, 80, 88, 112, 120], "final_energi": 39, "leav": [39, 120], "energy_transf": 39, "caus": [39, 89, 114], "incident_beam_diverg": [39, 97], "extent": [39, 85, 97], "final_wavelength": 39, "incident_polar": 39, "final_polar": 39, "final_wavelength_spread": 39, "final_beam_diverg": 39, "plottabl": [39, 48, 53, 88, 94, 107, 116, 118, 119, 122, 127, 130, 133, 134, 137, 147, 151], "block": [40, 52, 75, 94, 107, 120, 121], "protect": [40, 94], "circular": [40, 47, 76], "distance_to_detector": 40, "bend": [41, 62, 64, 66, 94], "critical_energi": 41, "bending_radiu": 41, "strength": 41, "dipol": 41, "accepted_photon_beam_diverg": 41, "half": [41, 46, 85], "source_distance_x": 41, "particl": [41, 87], "waist": 41, "source_distance_i": 41, "divergence_x_plu": 41, "outboard": 41, "divergence_x_minu": 41, "inboard": 41, "divergence_y_plu": 41, "upward": [41, 116], "divergence_y_minu": 41, "downward": 41, "nxbend": 41, "radiu": [41, 52, 56, 85, 92, 93], "critic": [41, 62, 66], "minu": [41, 76], "capillari": [42, 64, 94, 95], "gerd": [42, 93], "wellenreuth": [42, 93], "desi": [42, 93], "single_bounc": 42, "polycapillari": 42, "conical_capillari": 42, "impact": [42, 80], "maximum_incident_angl": 42, "accepting_apertur": 42, "working_dist": 42, "focal_s": 42, "focal": [42, 59], "maximum": [42, 46, 48, 49, 65, 78, 103, 104, 141, 143, 147], "literatur": [43, 94, 137], "idea": [43, 112, 132, 133, 137], "url": [43, 53, 88, 114, 115, 116, 121, 145, 147], "doi": [43, 133], "endnot": 43, "bibliograph": 43, "bibtex": 43, "unvalid": [44, 94, 116], "gather": [44, 116, 130], "nxlog": [45, 46, 57, 67, 68, 82, 84, 94, 98, 99, 101, 102, 103, 104, 105, 108, 116, 151, 152], "radial": 45, "oscil": 45, "honeycomb": 45, "soller_angl": 45, "divergence_x": 45, "divergence_i": 45, "frequenc": [45, 49, 87, 103, 104, 133, 146], "blade_thick": 45, "blade_spac": 45, "absorbing_materi": [45, 56], "transmitting_materi": [45, 56], "orthogon": [45, 52, 62, 66, 68, 86], "face": [45, 47, 52, 61, 66, 68, 72, 116, 137], "frequency_log": 45, "doubl": [46, 59, 125, 133], "bent": 46, "compris": [46, 53, 64, 116, 122, 133, 138], "segment": 46, "anisotrop": 46, "mosaic": 46, "curvatur": [46, 56, 93], "absent": [46, 73, 90], "li": [46, 47, 62], "n_comp": [46, 57, 82, 95], "bragg": [46, 80], "abbrevi": [46, 57, 82, 83, 95, 116], "parenthesi": [46, 57, 82, 83, 95], "enclos": [46, 57, 82, 83, 89, 95, 116, 147], "parenthes": [46, 57, 82, 83, 95, 115], "close": [46, 57, 72, 81, 82, 83, 95, 114, 116, 118, 119, 120, 121, 122, 123, 126, 133, 134, 136, 138, 143], "That": [46, 57, 82, 83, 95, 114, 120, 121, 127, 133, 134], "print": [46, 57, 82, 83, 95, 121, 122, 126, 134, 147, 154, 155], "subscript": [46, 57, 82, 83, 95, 136, 147], "manner": [46, 57, 82, 83, 95], "moieti": [46, 57, 82, 83, 95], "carbon": [46, 57, 82, 83, 95], "h": [46, 57, 80, 82, 83, 95, 107, 114, 118, 119, 125, 134, 143, 151, 154], "alphabet": [46, 57, 82, 83, 95, 114, 123, 147], "pure": [46, 57, 82, 83, 95, 143], "hill": [46, 57, 82, 83, 95], "abstract": [46, 57, 82, 83, 95, 116, 130], "iucr": [46, 116], "__data": 46, "cifstd15": 46, "ca": [46, 154], "train": 46, "stneasytip": 46, "subinforformula1": 46, "substanc": 46, "hkl": [46, 77, 107, 114, 146], "lattic": [46, 57, 82, 107], "2010": [46, 57, 121, 126, 130, 154], "11": [46, 57, 80, 114, 118, 120, 121, 134, 147, 148, 154], "17": [46, 57, 80, 114, 118, 121, 122, 123, 126, 128, 134, 154], "wider": [46, 57, 95], "varieti": [46, 57, 116, 133, 137, 147, 151], "pg": 46, "pyrolyt": [46, 57], "graphit": [46, 57], "ge": 46, "si": [46, 97, 114], "cu": 46, "fe3si": 46, "cofe": 46, "cu2mnal": 46, "heusler": 46, "multilay": 46, "diamond": [46, 95, 116, 154], "order_no": 46, "th": [46, 107, 119], "cut_angl": 46, "cut": [46, 107], "space_group": [46, 82, 83], "unit_cell_a": [46, 57], "unit_cell_b": [46, 57], "unit_cell_c": [46, 57], "unit_cell_alpha": [46, 57], "unit_cell_beta": [46, 57], "unit_cell_gamma": [46, 57], "unit_cell_volum": [46, 57, 82, 83, 114], "nx_volum": [46, 57, 82, 83, 146], "w": [46, 57, 82, 87, 89, 115, 120, 121, 122, 123, 133, 146], "1967": [46, 57, 82, 83], "acta": [46, 57, 82, 83], "22": [46, 57, 80, 82, 114, 118, 120, 121, 154], "457": [46, 57, 82], "464": [46, 57, 82], "scattering_vector": 46, "miller": [46, 80], "nx_mass_dens": [46, 57, 61, 66, 82, 83, 95, 146], "mass": [46, 57, 82, 83, 85, 95, 133, 146], "segment_width": 46, "individu": [46, 56, 62, 116, 130, 133, 137, 147, 151, 154], "segment_height": 46, "height": [46, 52, 55, 56, 59, 85, 92, 116], "segment_thick": 46, "segment_gap": 46, "adjac": [46, 80], "segment_column": 46, "column": [46, 72, 75, 107, 114, 115, 121, 126, 133], "segment_row": 46, "row": [46, 89, 114, 133], "mosaic_horizont": 46, "mosaic_vert": 46, "curvature_horizont": 46, "focus": 46, "curvature_vert": 46, "is_cylindr": 46, "cylindrical_orientation_angl": 46, "cylind": [46, 47, 49, 85, 93, 100, 115, 116], "assembli": [46, 49], "bragg_angl": 46, "averag": [46, 57, 65, 67, 84, 89, 103, 104, 114], "temperature_coeffici": 46, "temperature_log": [46, 57, 67, 82], "arrang": [46, 145], "coeffici": [46, 59, 61, 85, 107], "helium": [47, 61, 62, 66, 116], "uniform": [47, 72, 114, 115], "z_pixel_offset": [47, 49, 72, 116], "vertex": [47, 116, 147], "nxcylindr": 47, "mandatori": [48, 53], "motiv": [48, 114, 116, 127, 133], "hard": [48, 116, 123, 126, 127, 128], "nx_maxrank": [48, 141], "mr": [48, 114, 121, 126], "mr_indic": [48, 114, 121], "float": [48, 114, 116, 118, 119, 120, 121, 122, 123, 133, 146, 148], "100": [48, 54, 114, 126, 152], "data_2d": [48, 114], "time_indic": [48, 114], "1000": [48, 114, 118, 119, 133], "20": [48, 80, 82, 114, 116, 118, 121, 134, 143, 152, 154], "old": [48, 116, 126, 143, 154], "older": [48, 114, 126], "oldest": 48, "whose": [48, 95, 114], "long_nam": [48, 49, 116, 121, 126, 133, 134, 148], "fallback": [48, 107], "displai": [48, 54, 84, 116, 120, 121, 125, 147, 148], "annot": [48, 116, 137], "niac2018minut": [48, 137], "plottyp": [48, 137], "auxiliary_sign": [48, 114, 146], "auxiliari": [48, 116], "slice": [48, 114], "axisname_indic": [48, 107, 114], "axisnam": [48, 89, 107, 114], "2014_axes_and_uncertainti": [48, 114], "illustr": [48, 114, 116, 124, 133, 151], "effort": [48, 114, 127, 130, 133, 134], "strict": [48, 114, 116], "writer": [48, 114, 116, 120], "potenti": [48, 114, 144], "_indic": [48, 114], "circumst": [48, 114], "tool": [48, 116, 118, 121, 122, 123, 124, 125, 127, 131, 133, 134, 138, 145, 147, 155], "first_good": 48, "last_good": 48, "variable_error": [48, 115, 116], "_error": [48, 114], "variable_resolut": 48, "connect": [48, 114, 121], "colon": [48, 114, 133], "delimit": [48, 114, 133, 147], "bank": [49, 50, 94, 114, 151], "multidetector": [49, 94], "faster": [49, 55, 65, 127], "histogram": [49, 104, 109, 125, 138], "nxcylindrical_geometri": [49, 94, 115], "raw_time_of_flight": 49, "nx_puls": [49, 146], "hz": [49, 146], "check_sum": 49, "data_error": [49, 114], "x_pixel_offset": [49, 103, 104, 116], "y_pixel_offset": [49, 103, 104, 116], "irregular": [49, 87, 114], "serial_numb": 49, "serial": 49, "local_nam": 49, "solid_angl": 49, "nx_solid_angl": [49, 146], "subtend": 49, "gas_pressur": [49, 93], "ga": [49, 93], "detection_gas_path": 49, "drift": 49, "crate": 49, "slot": 49, "he3": 49, "psd": 49, "fission": [49, 68], "chamber": [49, 68], "proport": [49, 68], "real_tim": 49, "stop_tim": 49, "calibration_d": 49, "layout": [49, 97, 114], "linear": [49, 58, 89, 114], "gate": 49, "trigger": 49, "sum": [49, 80], "event": [49, 53, 55, 64, 79, 87, 94, 103, 109, 152], "decim": 49, "12": [49, 80, 114, 116, 118, 120, 121, 128, 130, 134, 148, 154], "14": [49, 80, 114, 118, 120, 121, 134, 148, 154], "16": [49, 53, 80, 114, 116, 118, 120, 121, 134, 154], "trigger_delay_tim": 49, "reaction": 49, "firmwar": 49, "delai": [49, 52], "trigger_delay_time_set": 49, "trigger_internal_delay_tim": 49, "hardwar": [49, 65, 78, 84, 114], "boundari": [49, 72, 114, 138], "request": [49, 112, 123, 127, 129, 133, 137, 138], "trigger_dead_tim": 49, "dure": [49, 65, 87, 89, 95, 114, 116, 121, 147, 151], "readout_tim": 49, "auto": [49, 120], "number_of_cycl": 49, "sometim": [49, 51, 114, 116, 148], "spectral": [49, 154], "wavelength_indic": [49, 62], "calibration_method": 49, "convers": [49, 114, 116, 125, 143, 145], "polynomi": [49, 59, 61], "data_fil": 49, "interest": [49, 107, 120, 123, 133, 144, 147, 152], "subdivis": 49, "detect": [49, 55, 72], "children": [50, 88, 147], "ref": [50, 68, 84, 145], "group_typ": 50, "offset_unit": [51, 89], "tempor": [52, 87, 94], "pair": [52, 55, 63, 65, 72, 73, 90, 107, 129, 148], "commonli": [52, 116, 127, 133, 137], "stationari": 52, "hous": 52, "featur": [52, 53, 115, 126, 128, 130, 135, 137, 151, 152], "anticlockwis": 52, "awai": [52, 130], "exactli": [52, 87], "contra_rotating_pair": 52, "synchro_pair": 52, "slit_angl": 52, "pair_separ": 52, "slit_edg": 52, "2n": 52, "360": 52, "degre": [52, 85, 118, 119, 121, 122, 123, 126, 128, 133, 134, 138], "top_dead_cent": 52, "unix": [52, 65, 107, 116, 134, 147], "1970": [52, 65], "01": [52, 65, 130], "01t00": [52, 65], "00": [52, 65, 134], "0z": [52, 65], "beam_posit": 52, "slit_height": 52, "drive": [52, 137], "effect": [52, 55, 67, 87, 114, 116], "wavelength_rang": 52, "spin": [52, 58, 77, 94, 108, 109], "axl": 52, "almost": [52, 55, 151], "though": [52, 116, 127, 137], "nxdisk": 52, "nxsubentri": [53, 94, 110, 127], "v3": [53, 88, 130, 132], "idf_vers": [53, 88], "isi": [53, 88, 114, 130, 137, 154], "propos": [53, 88, 91, 97, 110, 112, 127, 130, 137, 144], "entry_identifier_uuid": 53, "uuid": 53, "futur": [53, 114, 127, 130, 143, 154], "niac": [53, 60, 109, 112, 113, 114, 116, 124, 127, 130, 133, 147, 152, 154], "382": 53, "overlai": [53, 88], "definition_loc": [53, 88], "transpir": [53, 88], "suspend": [53, 88], "due": [53, 68, 88, 97, 120, 147], "2007": [53, 88, 130], "configur": [53, 88, 115, 127, 142, 154], "re": [53, 88], "niac2016": 53, "decid": [53, 60, 122, 130, 138, 143, 154], "extens": [53, 127, 137, 144, 147, 154], "overrid": [53, 115], "minoccur": [53, 115, 127], "experiment_document": [53, 88], "pdf": [53, 88, 95, 116, 130, 131, 138, 147], "latex": [53, 88], "thumbnail": [53, 88, 115], "640x480": [53, 88], "jpeg": [53, 70, 88], "mime": [53, 70, 88, 114, 116], "idf": [53, 88], "nxsensor": [54, 57, 94], "apparatu": 54, "oc100": 54, "011": 54, "dashboard": 54, "schedul": 54, "oc": 54, "100mm": 54, "bore": 54, "orang": 54, "cryostat": [54, 114], "pump": 54, "labview": 54, "vi": 54, "digit": [54, 114], "photograph": 54, "emit": 55, "stream": [55, 65, 114, 116, 133, 143, 152], "detectorid": 55, "event_id": 55, "event_time_offset": 55, "stroboscop": 55, "setup": [55, 82], "random": [55, 65, 119], "access": [55, 65, 115, 116, 125, 132, 133, 134, 137, 142, 151, 152, 154], "cue_timestamp_zero": [55, 65], "cue_index": [55, 65], "courser": 55, "minut": [55, 65, 112], "extra": [55, 107, 116, 133, 147], "event_time_zero": 55, "iso8601": [55, 65, 107, 114, 146], "event_index": [55, 103], "pulse_height": 55, "voltag": [55, 65, 84, 87, 98, 99, 101, 102, 105, 108, 146], "attach": [55, 84, 114, 116], "events_per_puls": 55, "cue_timestamp": 55, "nxevent": 55, "cue": [55, 65, 152], "r_slit": 56, "nxfermi": 56, "beryllium": 57, "sapphir": 57, "silicon": 57, "supermirror": [57, 62, 66, 77, 94], "m_valu": [57, 62, 66], "substrate_materi": [57, 61, 62, 66], "substrat": [57, 61, 62, 66], "substrate_thick": [57, 61, 62, 66], "coating_materi": [57, 61, 62, 66], "coat": [57, 61, 62, 66], "substrate_rough": [57, 61, 62, 66], "rough": [57, 61, 62, 66, 114], "rm": 57, "coating_rough": [57, 61, 62, 66], "nsurf": [57, 62, 147], "sensor_typ": 57, "flipper": [58, 64, 94], "coil": 58, "sheet": 58, "flip_turn": 58, "flip": 58, "comp_turn": 58, "compens": 58, "guide_turn": 58, "flip_curr": 58, "comp_curr": 58, "guide_curr": 58, "travel": 58, "comp": 58, "fresnel": [59, 94], "focus_paramet": 59, "increas": [59, 61, 88, 89, 137, 143], "power": [59, 61, 63, 87, 146, 154], "micron": 59, "volt": 59, "outer_diamet": 59, "outermost_zone_width": 59, "central_stop_diamet": 59, "fabric": 59, "etch": 59, "zone_height": 59, "zone_materi": 59, "themselv": [59, 121], "zone_support_materi": 59, "central_stop_materi": 59, "central_stop_thick": 59, "mask_thick": 59, "mask_materi": 59, "support_membrane_materi": 59, "support_membrane_thick": 59, "nxfresnel": 59, "central": [59, 80], "outer": 59, "outermost": 59, "membran": 59, "2014": [60, 130, 147], "legaci": [60, 73, 85, 90, 94, 124, 128, 137, 147], "aid": 60, "mcsta": [60, 89], "share": [60, 114, 127, 147], "nxorient": [60, 84, 85, 90, 94, 103, 104, 116], "nxtranslat": [60, 73, 85, 94, 103, 104, 116, 154], "component_index": 60, "grate": [61, 69, 94], "soft": [61, 78, 94, 121, 127, 130, 137], "blaze": 61, "trapezoid": 61, "groov": 61, "duty_cycl": 61, "diffraction_ord": 61, "deflection_angl": 61, "utilis": 61, "outgo": 61, "interior_atmospher": [61, 62, 66], "argon": [61, 62, 66], "substrate_dens": [61, 66], "layer_thick": [61, 66], "layer": [61, 66], "mirror": [61, 62, 64, 66, 94, 121], "figure_data": [61, 66], "deflect": 61, "duti": 61, "interior": [61, 62, 66], "build": [62, 111, 114, 116, 122, 123, 128, 131, 132, 133, 143, 145, 151], "simplest": [62, 118, 125], "box": [62, 80, 120], "although": [62, 95, 107, 116, 121], "ellipt": [62, 93], "popular": [62, 88, 127, 143], "characterist": 62, "wall": [62, 95], "bender": 62, "vane": 62, "nxpolar": [62, 64, 94, 103, 104], "nxmirror": [62, 64, 94], "constitut": [62, 127, 144], "redefin": 62, "welcom": [62, 112, 124, 127, 138, 152, 154], "nwl": [62, 147], "incident_angl": [62, 66], "bend_angle_x": [62, 66], "bend_angle_i": [62, 66], "external_materi": [62, 66], "regim": [62, 66], "nickel": [62, 66], "number_sect": 62, "explain": [62, 114, 115, 133], "intend": [62, 88, 89, 114, 115, 118, 134, 144, 147, 148, 152, 154], "surface_indic": 62, "veri": [62, 95, 111, 114, 116, 121, 127, 131, 133, 134, 138, 146, 154], "loos": 62, "undul": [63, 69, 152], "wiggler": 63, "oppos": 63, "pole": [63, 85], "taper": 63, "magnetic_wavelength": 63, "displac": [63, 89], "nx_power": [63, 87, 146], "deliv": 63, "bandwidth": 63, "harmon": 63, "nxinsert": 63, "nxbeam_stop": [64, 94], "nxbending_magnet": [64, 94], "nxcapillari": [64, 94], "nxevent_data": [64, 94, 103, 151, 152], "nxflipper": [64, 94], "nxguid": [64, 94], "nxinsertion_devic": [64, 94], "nxmoder": [64, 94, 103, 104], "nxposition": [64, 82, 94, 103, 104, 151], "nxvelocity_selector": [64, 69, 94], "nxxraylen": [64, 94], "beam_stop": 64, "bending_magnet": 64, "event_data": [64, 103], "insertion_devic": 64, "velocity_selector": [64, 69], "xraylen": 64, "veloc": [64, 69, 78, 92, 94, 152], "selector": [64, 69, 92, 94, 152], "accomod": 65, "coarser": 65, "tick": 65, "nentri": 65, "raw_valu": [65, 78], "thermocoupl": 65, "average_valu": [65, 103, 104], "average_value_error": [65, 103, 104], "639": 65, "minimum_valu": [65, 103, 104], "maximum_valu": [65, 103, 104], "even_layer_materi": 66, "even_layer_dens": 66, "odd_layer_materi": 66, "odd_layer_dens": 66, "odd": 66, "h20": 67, "d20": 67, "h2": 67, "ch4": 67, "d2": 67, "poison_depth": 67, "coupling_materi": [67, 103, 104], "cd": 67, "poison_materi": 67, "gd": 67, "pulse_shap": [67, 87], "poison": 67, "steadi": 68, "sampled_fract": 68, "calendar": [68, 136, 144], "paus": 68, "lost": 68, "unavail": 68, "intersect": [68, 96], "integral_log": 68, "ev": [69, 137], "nxgrate": [69, 94], "wavelength_error": 69, "820": 69, "energy_error": 69, "freeform": [70, 94], "pictur": 70, "movi": 70, "audio": 70, "creator": [70, 81, 120, 121, 126], "creat": [70, 81, 88, 111, 115, 116, 118, 119, 120, 121, 122, 123, 126, 127, 128, 132, 133, 134, 138, 143, 152, 154], "sequence_index": [70, 79], "nx_binari": [70, 146], "binari": [70, 114, 116, 118, 127, 128, 131, 133, 143, 146], "termin": [70, 114, 146, 147], "cr": [70, 114, 146], "lf": [70, 114, 146], "off": [72, 106, 116, 128], "cad": [72, 116], "l": [72, 75, 80, 107, 151], "winding_ord": [72, 116], "detector_fac": 72, "ascend": 72, "consecut": 72, "nxoff": 72, "wind": [72, 116], "numobj": [73, 85, 90], "cosin": 73, "six": [73, 103, 104], "dot": [73, 116], "product": [73, 98, 99, 101, 102, 105, 108, 119, 120, 125, 154], "orthonorm": [73, 90], "transliter": [75, 94], "pdb": [75, 94], "incorpor": [75, 110], "lowercas": [75, 114, 121], "loop": [75, 114], "unloop": 75, "beus": 75, "unambig": 75, "quot": [75, 115], "except": [75, 114, 116, 120, 121, 130, 143], "null": [75, 119, 147], "clariti": [75, 148], "ieee": 75, "nan": 75, "inf": 75, "ddl2": 75, "save": [75, 107, 120, 127, 143, 152, 154], "nxpdb_class": 75, "cbf_cbfsf": 75, "nest": [75, 89, 115, 133], "savefram": 75, "attribu": 75, "datablock1": 75, "cbf_cbfdb": 75, "category1": 75, "cbf_cbfcat": 75, "column_name1": 75, "column_name2": 75, "column_name3": 75, "category2": 75, "column_name4": 75, "column_name5": 75, "column_name6": 75, "saveframe1": 75, "category3": 75, "column_name7": 75, "column_name8": 75, "column_name9": 75, "begin": [75, 89, 114, 116, 128, 133, 147], "data_1yva": 75, "_entri": 75, "1yva": 75, "_audit_conform": 75, "dict_nam": 75, "mmcif_pdbx": 75, "dict_vers": 75, "279": 75, "dict_loc": 75, "ascii": [75, 114, 121, 130, 133, 154], "loop_": 75, "_database_2": 75, "database_id": 75, "database_cod": 75, "rcsb": [75, 114], "rcsb031959": 75, "d_1000031959": 75, "audit_conform": 75, "database_2": 75, "excerpt": [75, 133], "9in": 75, "_entity_poli": 75, "entity_id": 75, "nstd_linkag": 75, "nstd_monom": 75, "pdbx_seq_one_letter_cod": 75, "pdbx_seq_one_letter_code_can": 75, "giveqcctsicslyqlenycn": 75, "polypeptid": 75, "fvnqhlcgshlvealylvcgergffytpka": 75, "entity_poli": 75, "overlap": [76, 80, 136], "pin": 76, "hole": 76, "3he": 77, "motor": [78, 82, 89, 94, 97, 103, 104, 116, 151, 152], "piezo": [78, 94], "transduc": [78, 94], "mnemon": [78, 147], "target_valu": 78, "toler": 78, "soft_limit_min": 78, "soft_limit_max": 78, "acceleration_tim": 78, "ramp": 78, "controller_record": 78, "epic": [78, 114, 124], "taco": 78, "tango": 78, "acceler": [78, 87], "understand": [79, 89, 116, 127, 133, 134, 143], "reflection_id": 80, "partial": [80, 152], "exit": [80, 82, 118], "ewald": 80, "sphere": [80, 100, 116], "det_modul": 80, "flag": [80, 114, 147], "predict": 80, "used_in_refin": 80, "reference_spot": 80, "dont_integr": 80, "integrated_sum": 80, "integrated_prf": 80, "10": [80, 100, 114, 118, 119, 120, 121, 126, 130, 133, 134, 143, 148, 152, 154], "overload": 80, "overlapped_fg": 80, "13": [80, 114, 118, 121, 148, 154], "in_powder_r": 80, "foreground_includes_bad_pixel": 80, "15": [80, 114, 118, 121, 133, 134, 148, 154], "background_includes_bad_pixel": 80, "includes_bad_pixel": 80, "bad_shoebox": 80, "18": [80, 114, 118, 120, 121, 128, 133, 154], "bad_spot": 80, "19": [80, 114, 118, 121, 147, 154], "used_in_model": 80, "centroid_outli": 80, "21": [80, 114, 118, 121, 128, 154], "failed_during_background_model": 80, "failed_during_summ": 80, "23": [80, 114, 118, 121, 134, 147, 154], "failed_during_profile_fit": 80, "24": [80, 114, 118, 121, 128, 134, 154], "bad_refer": 80, "divid": [80, 114, 133], "inflat": 80, "predicted_fram": 80, "predicted_x": 80, "predicted_i": 80, "predicted_phi": 80, "predicted_px_x": 80, "predicted_px_i": 80, "observed_fram": 80, "observed_frame_var": 80, "varianc": 80, "observed_frame_error": 80, "observed_px_x": 80, "observed_px_x_var": 80, "observed_px_x_error": 80, "observed_px_i": 80, "observed_px_y_var": 80, "observed_px_y_error": 80, "observed_phi": 80, "observed_phi_var": 80, "observed_phi_error": 80, "observed_x": 80, "observed_x_var": 80, "observed_x_error": 80, "observed_i": 80, "observed_y_var": 80, "observed_y_error": 80, "bounding_box": 80, "bound": [80, 84], "background_mean": 80, "int_prf": 80, "int_prf_var": 80, "int_prf_error": 80, "int_sum": 80, "summat": 80, "int_sum_var": 80, "int_sum_error": 80, "lp": 80, "prf_cc": 80, "centroid": 80, "spheric": [80, 93], "int": [80, 118, 119, 120, 121, 122, 123, 134, 141, 143], "prf": 80, "var": 80, "cc": 80, "cement": 81, "file_update_tim": 81, "nexus_vers": [81, 118, 121, 126, 134], "hdf_version": 81, "hdf5_version": [81, 107, 118, 121, 126], "uppercas": [81, 107, 114, 147], "v": [81, 82, 107, 114, 120, 121, 126, 146, 147, 152], "xml_version": 81, "h5py_vers": [81, 107, 120, 121], "creator_vers": 81, "updat": 81, "n_temp": [82, 83], "n_efield": [82, 83], "n_mfield": [82, 83], "n_pfield": [82, 83], "n_sfield": [82, 83], "nxenviron": [82, 84, 94], "nxsample_compon": [82, 94], "changer_posit": [82, 103, 104], "changer": [82, 103, 104], "unit_cell_abc": [82, 83, 114], "unit_cell_alphabetagamma": [82, 83, 114], "sample_orient": [82, 83], "ub_matrix": 82, "nx_mass": [82, 83, 95, 146], "relative_molecular_mass": [82, 83, 95], "molecular": [82, 83, 95, 146], "buffer": [82, 121, 122, 123, 143], "sample_compon": 82, "member": [82, 107, 116, 136, 137, 144], "inert": 82, "oxidis": 82, "seal": 82, "kit": [82, 118, 138, 143, 154], "concentr": [82, 138], "volume_fract": [82, 83], "scattering_length_dens": [82, 83], "nx_scattering_length_dens": [82, 83, 146], "unit_cell_class": [82, 83], "triclin": [82, 83], "monoclin": [82, 83], "orthorhomb": [82, 83], "tetragon": [82, 83], "rhombohedr": [82, 83], "hexagon": [82, 83], "cubic": [82, 83], "crystallograph": [82, 83], "point_group": [82, 83], "path_length": 82, "path_length_window": 82, "window": [82, 95, 125], "external_dac": 82, "sent": [82, 136], "short_titl": 82, "legend": 82, "interact": [82, 114, 142, 154], "perfer": 82, "temperature_env": 82, "sensor1": 82, "816": 82, "value_log": [82, 84], "magnetic_field_env": 82, "magnetic_field_log": 82, "external_adc": 82, "pzt": 82, "adc": 82, "dac": 82, "env": [82, 121, 122, 123, 133], "abc": [82, 83, 114], "alphabetagamma": [82, 83, 114], "crysta": 83, "v22": 83, "p457": 83, "attached_to": 84, "ph": 84, "conduct": 84, "resist": 84, "flow": 84, "strain": 84, "shear": 84, "surface_pressur": 84, "pt100": 84, "rh": 84, "fe": 84, "hg": [84, 87, 115], "hg2cl2": 84, "ag": 84, "agcl": 84, "isfet": 84, "electrod": 84, "speci": 84, "ca2": 84, "hall": 84, "wilhelmi": 84, "run_control": 84, "synchronis": 84, "value_deriv1": 84, "high_trip_valu": 84, "low_trip_valu": 84, "setpoint": 84, "value_deriv2": 84, "external_field_brief": 84, "transvers": 84, "solenoid": [84, 105, 109], "gradient": 84, "vortic": 84, "global": [84, 114, 116, 118, 138, 143], "histori": [84, 114, 117, 131, 133], "value_deriv1_log": 84, "value_deriv2_log": 84, "external_field_ful": 84, "satisfi": [84, 115, 116, 133, 151, 152], "trip": 84, "deriv1": 84, "deriv2": 84, "nxflat": 85, "nxsphere": 85, "nxcone": 85, "nxellipt": 85, "nxtoroid": 85, "nxparabol": 85, "nxpolynomi": 85, "nshapepar": 85, "cone": [85, 100], "semi": 85, "major": [85, 114, 130, 136, 137], "minor": [85, 121], "parabol": 85, "polynom": 85, "concav": 85, "convex": 85, "signifi": 87, "pick": [87, 107, 114], "metal": 87, "emittance_x": 87, "nx_emitt": [87, 146], "emitt": [87, 146], "rad": [87, 146], "emittance_i": 87, "sigma_x": 87, "sigma_i": 87, "excit": 87, "nx_period": [87, 146], "target_materi": [87, 115], "depleted_u": [87, 115], "enriched_u": [87, 115], "pb": [87, 115], "number_of_bunch": 87, "bunch": 87, "bunch_length": 87, "bunch_dist": 87, "pulse_width": 87, "top_up": 87, "last_fil": 87, "recent": [87, 114, 127, 132, 135, 137, 143, 150, 152], "inject": 87, "infinit": 87, "thin": 87, "messag": [87, 147], "bunch_pattern": 87, "modal": [88, 94, 110], "wax": [88, 94, 127], "nxmyappdef": 88, "previous": [88, 127, 138, 154], "combin": [88, 95, 114, 130, 137, 138, 145, 147, 148, 151], "mime_typ": [88, 115], "graviti": 89, "movabl": [89, 116], "cap": 89, "nx_transform": [89, 146], "t_1": 89, "t_2": 89, "t_3": 89, "t_f": 89, "explicit": [89, 114, 146], "subset": [89, 116, 151], "affin": 89, "4x4": 89, "matric": [89, 116], "act": [89, 134], "homogen": 89, "t_r": 89, "pmatrix": 89, "o": [89, 107, 138], "0_3": 89, "t_t": 89, "i_3": 89, "3x3": 89, "xyz": [89, 116], "forc": [89, 119, 138], "axisname_end": 89, "motion": [89, 114, 116], "basi": [89, 130, 137, 147], "substitut": [89, 114, 127], "mechan": [89, 112, 114, 116, 128, 143], "mount": [89, 116], "placehold": 89, "_end": [89, 114], "axisname_increment_set": 89, "_increment_set": [89, 114], "ideal": [89, 116], "agre": [89, 114, 127, 130, 133], "signific": [89, 116, 152], "increment": [89, 114, 151], "movement": [90, 151], "perfectli": [90, 116], "gravitation": 90, "affili": 91, "local_contact": 91, "principal_investig": 91, "address": [91, 116, 121, 136, 147], "telephone_numb": 91, "telephon": 91, "fax_numb": 91, "fax": 91, "email": [91, 132, 144], "person": [91, 130, 154], "orcid": 91, "research": [91, 127, 137, 142, 154], "contributor": 91, "uri": 91, "spwidth": 92, "spoke": 92, "rotor": 92, "num": [92, 107], "lamella": 92, "twist": 92, "nxveloc": 92, "lens_geometri": 93, "paraboloid": [93, 100], "hyperbol": 93, "symmetr": 93, "focus_typ": 93, "lens_thick": 93, "lens_length": 93, "middl": 93, "number_of_lens": [93, 114], "lens": 93, "compound": 93, "lens_materi": 93, "cylinder_orient": 93, "nxcite": 94, "nxfresnel_zone_pl": 94, "nxpdb": 94, "nxreflect": 94, "investig": [95, 109, 122, 125, 137], "overal": [95, 114], "glass": 95, "vanadium": 95, "furnac": [95, 114], "anvil": 95, "left": [95, 116, 119, 120, 125], "blue": 95, "dash": 95, "subtract": 95, "portion": [95, 154], "furthermor": [95, 115, 154], "inconceiv": 95, "beampath": 95, "noth": [95, 119, 127], "insid": [95, 127, 148], "verbos": [95, 122, 143], "packing_fract": 95, "occupi": [95, 116], "adsorpt": 95, "reference_measur": 95, "inner": 95, "pack": 95, "contributed_definit": [95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 110], "nxquadric": [96, 106, 109], "csg": [96, 106], "pointer": [96, 116, 118, 127], "union": 96, "complement": 96, "is_quadr": 96, "is_mesh": 96, "compulsori": [96, 127], "operand": 96, "ptychographi": [97, 109], "cxi": [97, 109], "cxi_vers": 97, "pai": [97, 147], "attent": [97, 147], "merger": 97, "restructur": [97, 111, 147], "remap": 97, "fulli": [97, 116, 127], "npts_x": 97, "npts_y": 97, "frame_size_x": 97, "frame_size_i": 97, "raster": 97, "entry_1": 97, "instrument_1": 97, "source_1": 97, "machin": [97, 114, 132, 145], "beam_1": 97, "incident_beam_energi": 97, "incident_energy_spread": 97, "detector_1": 97, "slowaxisnam": 97, "fastaxisnam": 97, "data_1": 97, "regardless": [97, 137, 138], "x_indic": 97, "y_indic": 97, "sample_1": 97, "life": 97, "geometry_1": 97, "nxcxi": 97, "ptycho": 97, "electrostat": [98, 102, 109], "kicker": [98, 99, 109], "beamline_dist": [98, 99, 101, 102, 105, 108], "set_curr": [98, 99, 101, 105], "suppli": [98, 99, 101, 102, 105, 108, 131, 145], "set_voltag": [98, 99], "volag": 98, "read_curr": [98, 99, 101, 105], "read_voltag": [98, 99, 101, 105], "nxelectrostat": 98, "nxmagnet": 99, "quadric": [100, 106, 109], "ten": 100, "q11": 100, "q12": 100, "q13": 100, "q22": 100, "q23": 100, "q33": 100, "p1": 100, "p2": 100, "p3": 100, "surface_typ": 100, "ellipsoid": 100, "elliptic_paraboloid": 100, "hyperbolic_paraboloid": 100, "elliptic_hyperboloid_of_1_sheet": 100, "elliptic_hyperboloid_of_2_sheet": 100, "elliptic_con": 100, "elliptic_cylind": 100, "hyperbolic_cylind": 100, "parabolic_cylind": 100, "spheroid": 100, "hyperboloid_1_sheet": 100, "hyperboloid_2_sheet": 100, "imaginari": 100, "quadrupol": [101, 109], "nxquadrupol": 101, "set_bfield_curr": [102, 108], "set_efield_voltag": [102, 108], "ht": [102, 108], "read_bfield_curr": [102, 108], "read_bfield_voltag": [102, 108], "read_efield_curr": [102, 108], "read_efield_voltag": [102, 108], "bfield": [102, 108], "efield": [102, 108], "sn": [103, 104, 109, 154], "collection_titl": [103, 104], "proton_charg": [103, 104], "nx_charg": [103, 104, 146], "raw_fram": [103, 104], "total_count": [103, 104], "nx_uint": [103, 104, 146], "total_uncounted_count": [103, 104], "daslog": [103, 104], "cvinfo": [103, 104], "histotool": [103, 104], "821": [103, 104], "nvalu": [103, 104], "numvalu": [103, 104], "snshistotool": [103, 104], "snsbanking_file_nam": [103, 104], "snsmapping_file_nam": [103, 104], "command1": [103, 104], "event2nxl": 103, "data_x_i": [103, 104], "event_pixel_id": 103, "event_time_of_flight": 103, "pulse_tim": 103, "snsdetector_calibration_id": [103, 104], "da": [103, 104], "snsgeometry_file_nam": [103, 104], "snstranslation_servic": [103, 104], "numpuls": 103, "numev": 103, "pixel_id": [103, 104], "nine": [103, 104], "numtimechannel": [103, 104], "holder": [103, 104, 116, 130], "snsdetector": [103, 104], "snsgeometri": [103, 104], "snstranslat": [103, 104], "servic": [103, 104], "charg": [103, 104, 109, 146], "snsbank": [103, 104], "snsmap": [103, 104], "uncount": [103, 104], "event2histo_nxl": 104, "data_x_time_of_flight": 104, "data_y_time_of_flight": 104, "numtof": 104, "nxchopper": 104, "nxsolenoid": 105, "node": [106, 109, 147, 154], "nxcsg": [106, 109], "off_geometri": 106, "nxsolid": 106, "remov": [107, 109, 115, 132, 147], "spec": [107, 121, 154], "certif": [107, 121, 154], "spec_fil": 107, "header": [107, 125], "spec_dat": 107, "spec_epoch": 107, "epoch": [107, 152], "spec_com": 107, "newlin": 107, "spec_num_head": 107, "scan_numb": 107, "cscan": 107, "690": 107, "750": [107, 125, 134], "60": 107, "temp_sp": 107, "degc_sp": 107, "mca": 107, "whitespac": [107, 115, 147], "energy_indic": [107, 151], "th_indic": 107, "seconda_1": 107, "spec_nam": 107, "intensity_factor": 107, "_mca_": 107, "_mca_channel_": 107, "_mca1_": 107, "_mca1_channel_": 107, "counter_cross_refer": 107, "positioner_cross_refer": 107, "clase": 107, "g3": 107, "g0": 107, "geo": 107, "sector": 107, "g1": 107, "g2": 107, "g4": 107, "assign": [107, 114, 116, 122, 146, 151], "neccesari": 107, "compli": [107, 127], "calib": 107, "comput": [107, 116, 121, 128, 133, 137, 147, 152, 154], "preset_tim": 107, "elapsed_live_tim": 107, "elapsed_real_tim": 107, "number_sav": 107, "first_sav": 107, "last_sav": 107, "reduction_coef": 107, "calib_a": 107, "calib_b": 107, "calib_c": 107, "roi": 107, "roin": 107, "first_channel": 107, "last_channel": 107, "unicat": 107, "ap": [107, 121, 126, 130], "spec_us": 107, "_unrecogn": 107, "unrecogn": 107, "mca1": 107, "degc": 107, "sp": 107, "coef": 107, "temp": 107, "nxspin": 108, "proposit": [109, 110, 114], "incub": [109, 110, 133], "feedback": 109, "ratif": 109, "nxcontain": 109, "nxcxi_ptycho": 109, "nxelectrostatic_kick": 109, "nxmagnetic_kick": 109, "nxquadrupole_magnet": 109, "nxsepar": 109, "nxsnsevent": 109, "nxsnshisto": 109, "nxsolenoid_magnet": 109, "nxsolid_geometri": 109, "nxspecdata": 109, "nxspin_rot": 109, "split": [110, 121, 126], "codifi": 110, "progress": [110, 125, 132, 151], "understood": [110, 116, 128], "predefin": [110, 147], "procedur": [110, 112, 114, 120, 127, 129, 130, 132, 144, 147], "fluo": [110, 151], "anticip": 110, "sphinx": 111, "indent": [111, 115, 116, 134, 148], "care": [111, 119, 132, 143], "mix": 111, "tab": [111, 147], "began": [112, 133], "goal": [112, 133, 154], "exchang": [112, 133, 144, 145], "advic": [112, 120, 133], "forum": [112, 133], "supervis": [112, 133, 144], "mainten": [112, 133, 137, 138, 144], "overse": [112, 130, 133, 136], "technic": [112, 114, 116, 133, 136, 154], "infrastructur": [112, 130, 133], "membership": [112, 116, 136], "camp": [112, 154], "tele": 112, "confer": [112, 130, 144, 154], "kept": 112, "repositori": [112, 115, 125, 127, 132, 134, 135, 145, 150, 152, 154], "organis": [112, 127], "forth": 112, "video": [112, 116, 152], "announc": [112, 132], "retir": 112, "1996": [113, 114, 130, 137], "download": [113, 132, 134, 154], "fdl": 113, "txt": [113, 121, 122, 123], "lgpl": 113, "trail": [114, 147], "letter": [114, 115, 127, 147], "validitemnam": [114, 145], "recognis": 114, "world": [114, 116, 126, 129, 133, 136], "latin": 114, "revisit": 114, "relax": 114, "za": [114, 115, 147], "z0": [114, 115, 147], "9_": [114, 147], "adequ": 114, "comprehens": 114, "persist": 114, "readback": 114, "occas": 114, "_set": 114, "temperature_set": 114, "_": [114, 115], "conflict": 114, "evolv": [114, 132, 137], "scheme": [114, 115, 116, 130, 151], "wide": [114, 116, 120, 127, 130, 145], "bluesky_": 114, "blueski": 114, "blueskyproject": 114, "idf_": 114, "ndattr": 114, "areadetector": [114, 120], "nx_": 114, "pdbx_": 114, "protein": 114, "sas_": 114, "silx_": 114, "silx": 114, "_mask": 114, "_weight": 114, "dataset_weight": 114, "lose": 114, "histor": [114, 127, 147], "obsolet": 114, "preceed": 114, "beam_center_x_refin": 114, "beam_center_x_initial_guess": 114, "borrow": [114, 152], "rare": 114, "beam_center_x_error": 114, "languag": [114, 115, 116, 118, 119, 121, 127, 130, 131, 133, 134, 137, 138, 142, 143, 147, 149], "iter": [114, 138], "qualifi": 114, "unnecessari": 114, "latenc": 114, "revers": [114, 141], "fortran": [114, 134, 138], "crazi": [114, 127], "25": [114, 121, 131, 154], "26": [114, 118, 121, 154], "27": [114, 118, 121], "29": [114, 121, 147], "33": 114, "34": 114, "35": [114, 134], "36": 114, "37": 114, "38": 114, "39": 114, "40": [114, 120, 152], "41": [114, 134], "42": 114, "43": [114, 134], "44": [114, 125, 134], "45": [114, 151], "46": 114, "47": 114, "48": [114, 120, 133], "49": 114, "50": [114, 118], "51": 114, "52": 114, "53": 114, "54": 114, "55": 114, "56": 114, "57": 114, "58": 114, "64": [114, 141, 143, 147], "nx_int8": 114, "nx_int16": 114, "nx_int32": [114, 118, 121, 123, 134, 143, 151], "nx_int64": [114, 120], "nx_float32": [114, 118, 128, 134], "nx_float64": [114, 123], "uint8": 114, "07": [114, 120, 130], "31t21": 114, "0600": [114, 134], "interv": 114, "norm": [114, 146], "countri": [114, 146], "gone": [114, 146], "strftime": 114, "dt": 114, "appear": [114, 115, 116, 121, 123, 145, 147, 151, 152], "liter": 114, "readabl": [114, 127, 129, 145, 147], "assur": 114, "plethora": 114, "difficult": [114, 133, 151], "wherev": [114, 115, 143], "challeng": [114, 133], "till": 114, "crucial": 114, "emphas": 114, "visual": [114, 127, 130, 133, 142, 147, 154], "evolut": [114, 132], "underli": [114, 138], "undergo": 114, "distinct": [114, 116], "routin": [114, 116, 118, 127, 134, 141, 151, 154], "browser": [114, 125, 133, 134, 154], "encount": [114, 127, 138], "algorithm": [114, 116, 138, 154], "trivial": 114, "try": [114, 120, 126, 127, 143], "abscissa": [114, 147], "intent": [114, 116, 134, 151, 155], "possibilti": 114, "hdf5_file_nam": 114, "default_nxentry_group_nam": 114, "attr": [114, 120, 121, 122, 123, 126, 133], "default_nxdata_group_nam": 114, "signal_dataset_nam": 114, "fail": 114, "until": [114, 130], "succe": 114, "comma": [114, 147], "search": [114, 116, 120, 137, 138, 143], "among": [114, 147], "repeat": [114, 151], "unfortun": 114, "namespac": 114, "had": [114, 116, 120, 128, 130, 137, 147], "devis": [114, 137], "discourag": [114, 147], "prerequisit": 114, "webpag": [114, 131, 136], "datafil": 114, "1500": 114, "1502": 114, "1504": 114, "some_other_angl": 114, "1st": 114, "2nd": 114, "semant": [115, 119], "gihub": 115, "keyword": 115, "guarante": [115, 127, 143], "prepend": 115, "bold": 115, "namestartchar": 115, "namechar": 115, "Or": [115, 151], "_a": 115, "w_": [115, 147], "capit": 115, "surround": 115, "markup": 115, "unbound": [115, 147], "fragment": [115, 143], "pixel_shap": [115, 116], "enforc": [115, 119, 147], "explan": [116, 123], "extrem": [116, 133], "necess": 116, "wild": 116, "musr": 116, "navig": [116, 133, 134, 138], "self": [116, 133, 137], "notat": [116, 147, 148], "condens": 116, "convei": 116, "arrow": [116, 148], "meta": [116, 130, 138], "dataset_nam": 116, "calibration_statu": 116, "data_offset": 116, "rgba": [116, 147], "hsla": [116, 147], "cmyk": [116, 147], "colour": 116, "simpli": [116, 133], "scaler": [116, 147], "rgb": [116, 147], "hsl": [116, 147], "hdf5_object": 116, "_id": [116, 123], "externallink": [116, 121], "somewher": 116, "concept": [116, 152, 154], "filesystem": 116, "replic": 116, "notion": [116, 137], "truth": 116, "h5dump": [116, 121, 122, 123, 127, 128, 154, 155], "frequent": [116, 131, 152, 153], "portal": [116, 121, 125, 147], "hdfgroup": [116, 120, 121, 125, 128, 147, 154], "h5l_create_hard": 116, "strategi": [116, 127, 131, 153], "154": 116, "pm": 116, "obviou": [116, 133], "adapt": [116, 143], "satisif": 116, "easili": [116, 133, 145, 148, 151], "commerci": [116, 125], "vendor": 116, "external_link": 116, "targetfil": 116, "dl": 116, "i22": 116, "2012": [116, 130, 136], "sm7594": 116, "69201": 116, "pilatus2m": 116, "h5": [116, 119, 120, 126, 127], "targetpath": 116, "nx5nativeexternallink": 116, "fe8ddd287ee33961982931e2016cc25f76f95edd": 116, "src": [116, 132, 154], "napi5": 116, "l2248": 116, "maintain": [116, 128, 137, 144, 154], "napimount": 116, "_static": [116, 131, 147], "nexusintern": [116, 138, 147], "master": [116, 120, 121, 125, 134, 138, 139, 140, 141, 142, 154], "interfil": 116, "wherea": [116, 132, 151], "adopt": [116, 127, 133, 147, 154], "fact": [116, 133, 134, 145], "mislead": 116, "establish": [116, 144, 145], "sound": 116, "complic": [116, 127, 133, 147], "superced": 116, "397": 116, "notabl": [116, 137], "answer": 116, "scenario": 116, "exclud": 116, "my": [116, 127, 152], "java": [116, 120, 134, 138], "modern": [116, 133], "inherit": [116, 146], "bare": 116, "beauti": 116, "break": 116, "complianc": [116, 138], "prior": [116, 133], "knowledg": 116, "opposit": 116, "deal": 116, "seri": [116, 121, 130, 132, 144], "rise": 116, "mathemat": 116, "aspect": [116, 136, 137, 154], "matter": [116, 123, 130], "behind": 116, "industri": [116, 145], "robot": 116, "dynam": 116, "game": 116, "piec": [116, 127, 145], "Its": [116, 136, 147, 154, 155], "happen": [116, 151], "dir": [116, 134], "action": 116, "clear": [116, 126, 144], "arbitrarili": 116, "meridional_angl": 116, "implicit": 116, "polygon": 116, "straightforward": 116, "benefici": 116, "manipul": [116, 142, 154, 155], "freecad": 116, "render": [116, 147], "geomview": 116, "cube": 116, "mesh": 116, "initi": [116, 128, 138, 147, 154, 155], "proceed": 116, "compos": 116, "flatten": 116, "rag": 116, "concis": [116, 154, 155], "detector_shap": 116, "tile": 116, "forward": [116, 147], "occasion": 116, "undergon": 116, "soon": 116, "prove": 116, "approach": 116, "team": [116, 130], "learn": [116, 145], "becam": 116, "expand": 116, "demand": [116, 151], "came": [116, 133], "convinc": 116, "nevertheless": 116, "sign": [116, 138, 148], "post": [116, 123, 132, 136], "colophon": [117, 131], "n_t": 118, "n_p": 118, "nxhandl": [118, 134, 141, 143], "file_id": 118, "popul": 118, "getdata": [118, 143], "nxopen": [118, 134, 138], "nxfile": [118, 119, 134], "nxacc_create5": 118, "nxputattr": [118, 128, 134], "user_nam": 118, "joe": 118, "blogg": 118, "nxmakegroup": [118, 128, 134], "nxopengroup": [118, 134], "nxmakedata": [118, 128, 134], "nxopendata": [118, 128, 133, 134], "nxputdata": [118, 128, 134], "microsecond": [118, 134], "nxclosedata": [118, 133, 134], "nxclosegroup": [118, 134], "nxclose": [118, 134, 143], "longer": [118, 130, 137, 143, 154], "writedata": 118, "napif": 118, "nxhandles": 118, "nxacc_creat": [118, 134, 138], "nxputcharattr": 118, "nxumodul": [118, 138], "alloc": [118, 138], "getlocaldata": 118, "nx_ok": 118, "nxuwriteglob": [118, 138], "nxusetcompress": [118, 138], "nx_comp_lzw": 118, "nxuwritegroup": [118, 138], "nxuwritedata": [118, 138], "usr": [118, 121, 122, 123, 132, 133, 138, 143], "sy": 118, "numpi": [118, 120, 121, 122, 123, 130], "dtype": 118, "val": [118, 120], "nf": [118, 143], "w5": 118, "makegroup": 118, "opengroup": [118, 143], "putattr": 118, "makedata": [118, 143], "int32": [118, 121, 122, 123, 126, 133], "opendata": [118, 143], "putdata": [118, 143], "closedata": 118, "closegroup": 118, "datatyp": [118, 119, 120, 125, 126, 128, 134, 143], "h5t_string": [118, 125, 128], "strsize": [118, 125, 128], "strpad": [118, 125, 128], "h5t_str_nullterm": [118, 125], "cset": [118, 125, 128], "h5t_cset_ascii": [118, 125, 128], "ctype": [118, 125, 128], "h5t_c_s1": [118, 119, 125, 128], "dataspac": [118, 119, 125, 128, 147], "2011": [118, 119], "0100": 118, "h5t_std_i32l": [118, 125], "lot": [118, 137, 152], "distract": 118, "custom": 118, "readthedoc": [118, 122, 154, 155], "latest": [118, 122, 124, 137], "source_cod": [118, 122], "h5tree": [118, 122], "__arrai": [118, 120], "compliant": [119, 121, 124], "alon": 119, "two_theta": [119, 121, 122, 123, 126, 128, 133, 134], "two_theta_indic": [119, 121, 122, 123, 126, 133], "wrap": 119, "hdfid": 119, "h5function": 119, "gracefulli": 119, "clearer": 119, "instal": [119, 120, 125, 127, 131, 138, 142], "hugo": [119, 151], "octob": [119, 136, 137], "stdlib": 119, "void": [119, 134, 141, 143], "write_string_attr": 119, "hid_t": 119, "hid": 119, "const": 119, "char": [119, 141], "att": 119, "atttyp": 119, "attid": 119, "h5screat": 119, "h5s_scalar": 119, "h5tcopi": 119, "h5tset_siz": 119, "strlen": 119, "h5acreat": 119, "h5p_default": [119, 126], "h5awrit": 119, "h5sclose": 119, "h5tclose": 119, "h5aclos": 119, "write_int_attr": 119, "h5t_native_int": 119, "400": 119, "argc": 119, "argv": 119, "fid": [119, 126], "fapl": 119, "gid": 119, "dataprop": 119, "dataid": 119, "hsize_t": 119, "maxdim": 119, "rand_max": 119, "behaviour": [119, 151], "down": 119, "throat": 119, "h5pcreat": 119, "h5p_file_access": 119, "h5pset_fclose_degre": 119, "h5f_close_strong": 119, "h5fcreat": 119, "h5f_acc_trunc": 119, "h5pclose": 119, "h5gcreat": 119, "h5screate_simpl": 119, "h5p_dataset_cr": 119, "h5dcreat": 119, "h5dwrite": 119, "h5s_all": 119, "h5dclose": 119, "h5t_native_float": 119, "therebi": [119, 137], "h5glink": 119, "h5g_link_hard": 119, "h5fclose": 119, "nxh5write": 119, "memdataspac": 119, "h5fopen": 119, "h5f_acc_rdonli": 119, "h5dopen": 119, "h5dget_spac": 119, "h5sget_simple_extent_ndim": 119, "malloc": 119, "sizeof": 119, "h5sget_simple_extent_dim": 119, "h5t_native_int32": 119, "h5dread": 119, "printf": 119, "2f": 119, "10d": 119, "simdetector": 120, "pv": 120, "13sim1": 120, "rememb": [120, 121], "ioc": 120, "ll": [120, 121, 127], "directori": [120, 121, 127, 132, 138, 143, 145, 147], "screen": 120, "ndattribut": 120, "reformat": 120, "nonamespaceschemaloc": 120, "adcor": 120, "iocboot": 120, "acquiretim": 120, "epics_pv": 120, "cam1": 120, "dbrtype": 120, "dbr_nativ": 120, "imagecount": 120, "param": 120, "array_count": 120, "calc1_val": 120, "prj": 120, "usercalc1": 120, "calc2_val": 120, "usercalc2": 120, "maxsizex": 120, "max_size_x": 120, "maxsizei": 120, "max_size_i": 120, "cameramodel": 120, "cameramanufactur": 120, "fine": 120, "hdf5_layout": 120, "det_default": 120, "sd": [120, 128, 143, 147], "colormod": 120, "ndattr_default": 120, "hardlink": [120, 128], "util": [120, 124, 127, 128, 131, 133, 137, 155], "placement": 120, "onfileopen": 120, "onfileclos": 120, "exposure_": 120, "caqtdm": 120, "adbas": 120, "ndfilehdf5": 120, "bottom": 120, "ye": [120, 127], "zlib": 120, "enabl": [120, 133, 137, 143, 145, 148, 151], "won": [120, 145], "callback": 120, "wait": 120, "finish": 120, "tmp": 120, "mrinal_001": 120, "memori": [120, 138, 143], "tiff": 120, "pyepic": 120, "write_nexus_fil": 120, "py": [120, 122, 123, 154], "sim": 120, "def": 120, "fname": 120, "str": [120, 121], "__version__": 120, "create_group": [120, 121, 122, 123, 133], "create_dataset": [120, 121, 122, 123, 133], "gzip": 120, "__name__": 120, "__main__": 120, "img": 120, "caget": 120, "image1": 120, "arraydata": 120, "size_x": 120, "arraysizex_rbv": 120, "size_i": 120, "arraysizey_rbv": 120, "reshap": 120, "extra_inform": 120, "dict": 120, "unique_id": 120, "uniqueid_rbv": 120, "detector_st": 120, "detectorstate_rbv": 120, "bitcoin_valu": 120, "15000": 120, "2017": [120, 130], "582105": 120, "nx_uint8": 120, "80": 120, "112": 120, "208": 120, "240": 120, "176": 120, "144": 120, "simpler": [120, 127], "rewrit": 120, "nxfield": 120, "makelink": 120, "nxsignal": 120, "hdfview": [120, 127, 154], "nexpi": [120, 121, 127, 133, 154], "pymca": [120, 127, 154], "matlab": [120, 124, 154], "igorpro": 120, "idl": [120, 130, 134, 138], "write_nexus_file2": 120, "rewritten": 120, "adsimdetector": 120, "sourceforg": [120, 145, 154], "net": [120, 145, 154], "usax": [121, 126, 127], "station": 121, "32id": [121, 126], "extract": [121, 154], "mild": 121, "unfamiliar": 121, "mr_scan": [121, 126], "float64": [121, 122, 133], "i00": [121, 126, 151, 152], "92608": [121, 123, 126], "1037": [121, 122, 123, 126], "92591": [121, 123, 126], "1318": [121, 122, 123, 126], "92575": [121, 123, 126], "1704": [121, 122, 123, 126], "92558": [121, 126], "2857": [121, 126], "92541": [121, 126], "4516": [121, 126], "92525": [121, 126], "9998": [121, 126], "92508": [121, 126], "23819": [121, 126], "92491": [121, 126], "31662": [121, 126], "92475": [121, 126], "40458": [121, 126], "92458": [121, 126], "49087": [121, 126], "92441": [121, 126], "56514": [121, 126], "92425": [121, 126], "63499": [121, 126], "92408": [121, 126], "66802": [121, 126], "92391": [121, 126], "66863": [121, 126], "92375": [121, 126], "66599": [121, 126], "92358": [121, 126], "66206": [121, 126], "92341": [121, 126], "65747": [121, 126], "92325": [121, 126], "65250": [121, 126], "92308": [121, 126], "64129": [121, 126], "92291": [121, 126], "63044": [121, 126], "92275": [121, 126], "60796": [121, 126], "92258": [121, 126], "56795": [121, 126], "92241": [121, 126], "51550": [121, 126], "92225": [121, 126], "43710": [121, 126], "92208": [121, 126], "29315": [121, 126], "92191": [121, 126], "19782": [121, 126], "92175": [121, 126], "12992": [121, 126], "92158": [121, 126], "6622": [121, 126], "92141": [121, 126], "4198": [121, 126], "92125": [121, 126], "2248": [121, 126], "92108": [121, 122, 123, 126], "1321": [121, 122, 123, 126], "basicwrit": 121, "join": [121, 130, 136], "collat": 121, "corrupt": 121, "prj_test": [121, 126], "18t17": [121, 126], "04": [121, 126, 130], "0500": [121, 126], "loadtxt": [121, 122, 123], "dat": [121, 122, 123], "mr_arr": 121, "i00_arr": 121, "asarrai": [121, 122, 123], "wrote": [121, 152], "basicread": 121, "bulk": 121, "remind": 121, "9261": [121, 128], "9259": [121, 128], "9258": [121, 128], "9256": [121, 128], "9254": [121, 128], "9252": [121, 128], "9251": [121, 128], "9249": [121, 128], "9247": [121, 128], "9246": [121, 128], "9244": [121, 128], "9243": [121, 128], "9241": [121, 128], "9239": [121, 128], "9237": [121, 128], "9236": [121, 128], "9234": [121, 128], "9232": [121, 128], "9231": [121, 128], "9229": [121, 128], "9228": [121, 128], "9226": [121, 128], "9224": [121, 128], "9222": [121, 128], "9221": [121, 128], "9219": [121, 128], "9217": [121, 128], "9216": [121, 128], "9214": [121, 128], "9213": [121, 128], "9211": [121, 128], "demo": 121, "subsect": 121, "reader_attributes_trail": 121, "nx_entri": 121, "nx_data": 121, "attr_ax": 121, "isinst": 121, "tupl": 121, "rais": 121, "valueerror": 121, "zip": [121, 143, 154], "becaus": [121, 127, 143, 151], "descend": 121, "advantag": [121, 127], "local_addr": 121, "external_file_nam": 121, "external_addr": 121, "926079999999999": [121, 122], "h5l_create_extern": 121, "stabl": 121, "writer_2_1": [121, 123, 126], "file_hdf5_mast": 121, "file_hdf5_angl": 121, "file_hdf5_count": 121, "tthdata": [121, 122, 123], "countsdata": [121, 122, 123], "incomplet": 121, "external_angles_h5dump": 121, "external_angles_structur": 121, "punx": [121, 122, 123, 127, 154], "external_counts_h5dump": 121, "external_counts_structur": 121, "external_master_h5dump": 121, "external_master_structur": 121, "nexus_h5dump": 121, "nexus_structur": 121, "writer_1_3_h5pi": 122, "particularli": 122, "2014niac": 122, "writer_1_3": 122, "tth": [122, 128, 133, 134], "925909999999998": 122, "925750000000001": 122, "appreci": 122, "writer_1_3_h5dump": 122, "writer_1_3_structur": 122, "ds_tth": 123, "ds_count": 123, "source_addr": 123, "target_addr": 123, "h5g": [123, 126], "link_hard": 123, "behavior": 123, "writer_2_1_h5dump": 123, "writer_2_1_structur": 123, "hdf4": [124, 125, 127, 128, 130, 132, 134, 137, 138, 143, 147, 154], "awar": 124, "exmpl": 124, "lrmec": [124, 134], "grow": [124, 137, 152], "brows": [124, 129, 133, 137, 150, 154], "mostli": 124, "ipn": [125, 130, 134, 154], "nx5": [125, 133], "148x750": 125, "148x32": 125, "exampledata": [125, 127, 154], "histogram1": [125, 134], "eclips": [125, 154], "148": [125, 134], "h5t_ieee_f32l": 125, "751": [125, 134], "drag": 125, "click": [125, 133], "menu": 125, "platform": [125, 128, 137, 154], "radio": 125, "button": 125, "press": 125, "ok": 125, "white": 125, "dialog": 125, "wavemetr": [125, 154], "dataaccess": 125, "htm": [125, 154], "submenu": 125, "wave": 125, "hdfbrowser": 125, "panel": 125, "kienzl": 126, "docbook": 126, "basic_writ": 126, "disp": 126, "delet": [126, 143], "interven": [126, 144], "h5creat": 126, "h5write": 126, "h5writeatt": 126, "mr_scan_indic": 126, "h5disp": 126, "basic_read": 126, "h5info": 126, "fprintf": 126, "h5read": 126, "h5link": 126, "intermedi": [126, 133], "hello": 126, "goodby": 126, "myfil": 126, "200": 126, "hgdisp": 126, "idx": 126, "strfind": 126, "from_path": 126, "from_data": 126, "to_path": 126, "to_data": 126, "h5f": 126, "h5f_acc_rdwr": 126, "doesn": [126, 138], "create_intermedi": 126, "h5p": 126, "h5p_link_creat": 126, "set_create_intermediate_group": 126, "catch": [126, 143], "from_id": 126, "to_id": 126, "h5l": 126, "create_hard": 126, "henc": 127, "capitalis": 127, "mu": 127, "particip": 127, "never": 127, "am": [127, 143], "easiest": [127, 128], "graphic": [127, 147, 154], "rendit": 127, "nxbrows": [127, 134, 154], "backend": [127, 134, 137, 138, 143], "superior": 127, "happili": 127, "supers": 127, "why": 127, "glossari": [127, 145], "don": [127, 146], "mainstream": 127, "fair": 127, "back": [127, 145, 151, 154], "big": [127, 132], "forese": 127, "anywai": [127, 143], "lai": 127, "standardis": 127, "spent": 127, "past": [127, 133, 136], "chanc": 127, "perceiv": 127, "necessarili": 127, "serious": 127, "defint": 127, "willing": 127, "onc": [127, 144, 147, 152], "submit": [127, 133], "aren": [127, 146], "remain": [127, 134], "subroutin": [127, 134], "subclass": [127, 147], "vice": 127, "versa": 127, "super": 127, "giwax": 127, "think": [127, 132, 143], "founder": 128, "substanti": 128, "supercomput": 128, "ncsa": [128, 143], "univers": 128, "illinoi": 128, "urbana": 128, "champaign": 128, "uiuc": 128, "spun": 128, "thg": 128, "vgroup": [128, 143], "vsetclass": 128, "vgetclass": 128, "f77": [128, 134, 140], "f90": [128, 134, 141], "fileid": [128, 133, 134], "nxmakelink": 128, "itemid": 128, "nxmakenamedlink": 128, "linked_nam": 128, "h5t_str_nullpad": 128, "h5t_ieee_f64l": 128, "held": [129, 130, 136], "git": [129, 132, 154, 155], "thank": 129, "fork": 129, "voluntari": 130, "worker": 130, "2018": [130, 154], "05": 130, "v2018": 130, "releasenotes__v2018": 130, "597": 130, "releasenotes__v3": 130, "2016": [130, 147], "approv": 130, "esrf": 130, "workshop": [130, 137], "hyperspectr": 130, "2009": [130, 154], "09": 130, "draft": [130, 137], "sas2009": 130, "dtd": 130, "biggest": 130, "circumv": 130, "port": 130, "broader": 130, "script": [130, 138, 143, 154], "2005": 130, "emac": 130, "2003": 130, "enough": [130, 132, 143], "stake": 130, "caltech": 130, "06": 130, "richard": 130, "riedel": 130, "grant": 130, "explicitli": 130, "sima": 130, "technologi": [130, 137], "fund": [130, 137], "2002": 130, "brought": 130, "summer": 130, "mlnsc": 130, "lanl": 130, "1997": [130, 137], "sinq": [130, 154], "jonathan": 130, "tischler": [130, 137], "coauthor": 130, "08": [130, 147], "1994": [130, 137], "conven": 130, "jon": [130, 137], "invit": [130, 136], "94": [130, 137], "netcdf": [130, 137, 154], "nexus_propos": 130, "proposed_data_standard_for_the_ap": 130, "verif": [131, 153], "overview": [131, 134, 151], "core": [131, 154], "precompil": 131, "oct": [131, 137], "2023": 131, "onlin": [131, 138, 139, 143], "nexusmanu": 131, "impati": 131, "nximpati": 131, "rst": [132, 145], "ship": [132, 154], "mailman": [132, 136], "listinfo": [132, 136], "i386": 132, "readi": [132, 151, 154], "compil": [132, 142, 143], "uvh": 132, "architectur": [132, 154], "x86_64": 132, "rebuild": 132, "rpmbuild": 132, "buildroot": 132, "fedora": 132, "yum": 132, "devel": 132, "mxml": 132, "msi": 132, "dmg": 132, "checkout": 132, "clone": 132, "tarbal": 132, "outdat": 132, "websit": 132, "readm": [132, 142], "snapshot": 132, "mileston": 132, "articl": 132, "track": 132, "underw": 133, "conclus": 133, "fulfil": [133, 151], "promot": [133, 144], "cooper": 133, "stimul": 133, "sophist": 133, "interchang": [133, 137], "2015": 133, "301": 133, "305": 133, "1107": 133, "s1600576714027575": 133, "portabl": [133, 137], "media": 133, "briefli": 133, "addition": 133, "folder": [133, 154], "pertain": 133, "hide": [133, 138], "verysimpl": 133, "1193": 133, "4474": 133, "53220": 133, "photodiod": [133, 152], "9094": 133, "9096": 133, "9122": 133, "9098": 133, "91": 133, "9102": 133, "9104": 133, "9106": 133, "9108": 133, "911": 133, "9112": 133, "9114": 133, "9116": 133, "9118": 133, "912": 133, "diod": 133, "274310": 133, "515430": 133, "827880": 133, "1227100": 133, "1434640": 133, "1330280": 133, "1037070": 133, "598720": 133, "316460": 133, "56677": 133, "anyon": [133, 136, 155], "agreement": 133, "formal": 133, "tune": 133, "job": [133, 154], "nxgetdata": [133, 134], "unifi": [133, 138], "bind": [134, 138, 139, 140, 141, 142, 154], "77": [134, 138, 141], "90": [134, 138], "walk": 134, "attempt": 134, "fashion": [134, 151], "whenev": 134, "transpar": [134, 138], "travers": 134, "nxacc_read": [134, 143], "nxgetinfo": [134, 143], "nxmalloc": 134, "helper": 134, "session": 134, "lrcs3701": 134, "2000": 134, "02": 134, "eag": 134, "ro": 134, "histogram2": 134, "monitor1": 134, "monitor2": 134, "mgb2": 134, "pdo": 134, "37g": 134, "8k": 134, "120mev": 134, "e0": 134, "240hz": 134, "120hz": 134, "1900": 134, "000000": 134, "1902": 134, "1904": 134, "timelin": 135, "ticket": 135, "subscrib": 136, "pipermail": 136, "roughli": 136, "twice": 136, "month": 136, "agenda": 136, "teleconfer": 136, "tech": 136, "traffic": 136, "earli": 137, "1990": 137, "troublesom": 137, "wast": 137, "throughput": 137, "lack": 137, "led": 137, "june": 137, "scherer": 137, "august": 137, "mitch": 137, "nelson": 137, "broad": [137, 146], "disciplin": [137, 145], "Their": 137, "95": 137, "sept": 137, "96": 137, "attend": [137, 144], "late": 137, "creation": 137, "priori": [137, 147], "facilit": [137, 145, 151], "inde": 137, "raison": 137, "etr": 137, "benefit": [137, 144], "relianc": 137, "longev": 137, "lifetim": 137, "evid": 137, "faithfulli": 137, "cost": [137, 138], "insurmount": 137, "beyond": 137, "minim": 137, "upgrad": 137, "lexicographi": 137, "kev": [137, 146], "nrg": 137, "specialti": 137, "categor": 137, "meantim": 138, "freez": 138, "wrapper": [138, 141, 143], "implicitli": 138, "shutdown": 138, "acknowledg": 138, "inquiri": 138, "statement": [138, 141], "nxmodul": [138, 141], "nxureaddata": 138, "nxuwritehistogram": 138, "nxureadhistogram": 138, "subsequ": [138, 147], "nxufindclass": 138, "nxufinddata": 138, "nxufindattr": 138, "nxufindsign": 138, "nxufindaxi": 138, "nxufindlink": 138, "nxuresumelink": 138, "reopen": 138, "unsign": [138, 146, 147], "nxbuild": 138, "makefil": 138, "execut": [138, 144], "argument": [138, 143], "napi_test": 138, "pkg": 138, "config": 138, "gcc": 138, "cflag": 138, "lib": [138, 143], "issuereport": 138, "doxygen": 139, "cpp": 139, "nxstatu": [141, 143], "nxlink": 141, "nx_maxnamelen": [141, 147], "nxi1": 141, "selected_int_kind": 141, "nxi2": 141, "nxi4": 141, "nxr4": 141, "nxr8": 141, "0d0": 141, "evalu": 142, "idlroot": 142, "idldlm": 142, "dlm": 142, "htmlpreview": 142, "jni": 143, "disadvantag": 143, "runtim": 143, "jre": 143, "system32": 143, "asset": 143, "libjnexu": 143, "jvm": 143, "successfulli": 143, "windows32": 143, "administr": 143, "ld_library_path": 143, "pathnam": 143, "dorg": 143, "jnexuslib": 143, "classpath": 143, "sbin": 143, "sh": 143, "testjapi": 143, "batch": 143, "jl": 143, "win32": 143, "jdk1": 143, "idiom": 143, "nexusfileinterfac": 143, "unclutt": 143, "nexusfil": 143, "constructor": 143, "interspers": 143, "nexusexcept": 143, "anymor": 143, "tricki": 143, "garbag": 143, "collector": 143, "safer": 143, "safe": 143, "harm": 143, "idata": 143, "idim": 143, "trick": 143, "introspect": 143, "eleg": 143, "drawback": 143, "dumb": 143, "mein": 143, "entchen": 143, "string_data": 143, "getbyt": 143, "And": 143, "aforement": 143, "treatment": [143, 154], "signatur": 143, "getinfo": 143, "arg": 143, "debugg": 143, "hashtabl": 143, "groupdir": 143, "classnam": 143, "nxclass": [143, 148], "println": 143, "hasmoreel": 143, "vname": 143, "nextel": 143, "vclass": 143, "attrdir": 143, "attnam": 143, "atten": 143, "attributeentri": 143, "exercis": 143, "200mb": 143, "400mb": 143, "getslab": 143, "putslab": 143, "chunk": 143, "lang": 143, "outofmemoryexcept": 143, "ceil": 143, "mxxxm": 143, "mx512m": 143, "512mb": 143, "8192": 143, "ever": 143, "maxhandl": 143, "recompil": 143, "browsabl": 143, "driver": 143, "examin": 144, "amend": 144, "ratifi": 144, "internet": 144, "reach": 144, "plan": 144, "coincid": 144, "nobug": [144, 154], "satellit": 144, "offic": 144, "govern": 145, "xsltproc": 145, "xmllint": 145, "nomenclatur": [145, 148], "nxdltype": 145, "formedness_and_error": 145, "autom": 145, "caption": 145, "intention": 145, "jargon": 145, "assist": 145, "attributetyp": 145, "definitiontyp": 145, "definitiontypeattr": 145, "dimensionstyp": 145, "doctyp": 145, "enumerationtyp": 145, "fieldtyp": 145, "choicetyp": 145, "grouptyp": 145, "linktyp": 145, "symbolstyp": 145, "basiccompon": 145, "validnxclassnam": 145, "validtargetnam": 145, "nonnegativeunbound": 145, "alia": 146, "picki": 146, "nx_area": 146, "barn": 146, "cancel": 146, "nx_molecular_weight": 146, "mol": 146, "nx_per_area": 146, "pa": 146, "nx_count": 146, "steradian": 146, "wavenumb": 146, "immedi": 147, "controversi": 147, "metr": 147, "meter": 147, "sparingli": 147, "amongst": 147, "switch": 147, "subvers": 147, "prescrib": 147, "rank_": 147, "28computer_program": 147, "telco": 147, "qvec": 147, "tooltip": 147, "bullet": 147, "enumitem": 147, "synonym": 147, "ordin": 147, "xy": 147, "tutor": 147, "phypereg": 147, "512": [147, 151], "confin": 147, "prioriti": 147, "secondari": 147, "backward": 147, "beam_defining_slit": 147, "scatter_slit": 147, "needless": 147, "repetit": 147, "z_": 147, "constrain": 147, "token": 147, "bank1": 147, "nx_other": 147, "emploi": 147, "groupa": 147, "groupb": 147, "dataset1": 147, "feed": 147, "carriag": 147, "w3school": 147, "schema_dtypes_str": 147, "asp": 147, "processor": 147, "prototyp": 148, "strip": 148, "1023": 148, "zeolit": 148, "bins_indic": 148, "unspecifi": 148, "presum": 148, "1024": 148, "offer": [148, 154], "unimport": 148, "monthli": 150, "workflow": 151, "entry3": 151, "512x512": 151, "pydataproc2010": 151, "0a": 151, "sn2013287": 151, "ought": 151, "reproduc": 151, "clash": 151, "fluores": 151, "nxinstument": 151, "sasdet": 151, "fluordet": 151, "large_area": 151, "difficulti": 151, "mimic": 151, "rotation_angle_indic": 151, "mutipl": 151, "h_indic": 151, "k_indic": 151, "l_indic": 151, "chi_indic": 151, "phi_indic": 151, "polar_angle_indic": 151, "i0": [151, 152], "transit": 151, "customari": 151, "nt": 151, "i_data": 151, "i0_data": 151, "rasteris": 151, "spiral": 151, "xraster": 151, "yraster": 151, "orgin": 151, "prematur": 151, "underneath": 151, "foreseen": 151, "lazi": 151, "mxx": 151, "mzz": 151, "ttv": 151, "lieselott": 151, "pilatu": 151, "daunt": 152, "classifi": 152, "lll": 152, "ai": 152, "dy": 152, "helic": 152, "fictiti": 152, "marker": 152, "coars": 152, "trim": 152, "datapoint": 152, "pictori": 152, "grab": 152, "obvious": 152, "favourit": 152, "scene": 152, "correspondingli": 152, "morsel": 152, "ecb064453edb096d": 152, "cursori": 154, "critiqu": 154, "gui": 154, "nxconvert": 154, "nxdir": 154, "queri": 154, "nxingest": 154, "man": 154, "nxsummari": 154, "heavili": 154, "accomplish": 154, "plugin": 154, "nxplot": 154, "cnxvalid": [154, 155], "libxml2": [154, 155], "dave": 154, "itt": 154, "dawn": 154, "dawnsci": 154, "workbench": 154, "anaylsi": 154, "gda": 154, "opengda": 154, "framework": 154, "customis": 154, "gumtre": 154, "ansto": 154, "au": 154, "researchhub": 154, "ourinfrastructur": 154, "acn": 154, "harrisgeospati": 154, "using_idl_hom": 154, "igor": 154, "pro": 154, "extraordinarili": 154, "graph": 154, "isaw": 154, "ftp": 154, "merg": 154, "lamp": 154, "ill": 154, "eu": 154, "data_treat": 154, "langevin": 154, "mantid": 154, "mantidproject": 154, "collabor": 154, "mathwork": 154, "opengeni": 154, "primarili": 154, "art": 154, "toolkit": 154, "dispers": 154, "spec2nexu": 154, "h5totext": 154, "eznx": 154, "programmat": 154, "hdf5_tool": 154, "h5dist": 154, "hdfexplor": 154, "eo": 154, "630": 154, "poldi": 154, "4107360": 154, "axis2000": 154, "read_nexu": 154, "unicorn": 154, "chemistri": 154, "mcmaster": 154, "hdf5gatewai": 154, "prjemian": 154, "ti": 154, "dawnscienc": 154, "scisoft": 154, "nexushdf5load": 154, "nexusfilehdf5": 154, "nxreader": 154, "imagej": 154, "tri": 154, "4107439": 154, "cctbx": 154, "dxtbx": 154, "jf16m": 154, "swissfel": 154, "cctbx_project": 154, "jf16m_cxigeom2nexu": 154, "manti": 154, "spectromicroscopi": 154, "bitbucket": 154, "mlerot": 154, "sasview": 154, "sascalc": 154, "dataload": 154, "cansas_reader_hdf5": 154, "file_convert": 154, "nxcansas_writ": 154, "focusreport": 154, "skip": 154, "statist": 154, "tcl": 154, "swig": 154, "i80": 154, "ida": 154, "rrt_in_foc": 154, "4107386": 154, "zebra": 154, "dump": 154, "tricsread": 154, "4107416": 154, "unbias": 155, "staff": 155, "mine": 155, "reliabl": 155, "confid": 155, "bodi": 155, "catalog": 155}, "objects": {}, "objtypes": {}, "objnames": {}, "titleterms": {"construct": 0, "nexu": [0, 110, 112, 114, 115, 116, 118, 119, 120, 121, 122, 123, 124, 128, 129, 130, 132, 133, 134, 135, 136, 137, 138, 143, 144, 145, 149, 151, 152, 153, 154], "file": [0, 114, 116, 118, 119, 120, 121, 122, 123, 124, 126, 128, 133, 134, 151, 152, 155], "applic": [0, 36, 116, 134, 135, 138], "definit": [0, 36, 94, 109, 110, 112, 115, 116, 132, 135, 145, 147], "The": [0, 116, 134, 144, 145, 152], "wonder": 0, "new": 0, "instrument": 0, "woni": 0, "decid": 0, "which": 0, "paramet": [0, 151], "need": 0, "store": [0, 114, 116, 120, 152], "map": [0, 128], "nxdata": [0, 48, 114, 116], "fill": 0, "auxiliari": 0, "inform": [0, 151, 152], "creat": 0, "nxdl": [0, 135, 145, 146, 147], "specif": [0, 146, 148], "step": [0, 152], "1": [0, 114], "think": 0, "hard": 0, "about": [0, 117], "data": [0, 114, 115, 121, 122, 123, 124, 125, 126, 133, 143, 148, 151, 152, 154], "2": [0, 114, 118, 125], "hierarchi": 0, "3": [0, 114, 118], "describ": 0, "thi": 0, "4": 0, "standard": [0, 137], "niac": [0, 136, 144], "full": 0, "list": [0, 136, 138], "us": [0, 114, 118, 119, 120, 121, 124, 125], "an": [0, 120], "process": [0, 132, 151], "author": 1, "nxarchiv": 2, "hypertext": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108], "anchor": [2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 145], "nxarp": 3, "nxcansa": 4, "nxdirecttof": 5, "nxfluo": 6, "nxindirecttof": 7, "nxiqproc": 8, "nxlauetof": 9, "nxmonopd": 10, "nxmx": 11, "nxrefscan": 12, "nxreftof": 13, "nxsa": 14, "nxsastof": 15, "nxscan": 16, "nxspe": 17, "nxsqom": 18, "nxstxm": 19, "nxta": 20, "nxtofnpd": 21, "nxtofraw": 22, "nxtofsingl": 23, "nxtomo": 24, "nxtomophas": 25, "nxtomoproc": 26, "nxxa": 27, "nxxasproc": 28, "nxxbase": 29, "nxxeuler": 30, "nxxkappa": 31, "nxxlaue": 32, "nxxlaueplat": 33, "nxxnb": 34, "nxxrot": 35, "nxapertur": 37, "nxattenu": 38, "nxbeam": 39, "nxbeam_stop": 40, "nxbending_magnet": 41, "nxcapillari": 42, "nxcite": 43, "nxcollect": [44, 151], "nxcollim": 45, "nxcrystal": 46, "nxcylindrical_geometri": [47, 116], "nxdetector": 49, "nxdetector_group": 50, "nxdetector_modul": 51, "nxdisk_chopp": 52, "nxentri": [53, 151], "nxenviron": 54, "nxevent_data": 55, "nxfermi_chopp": 56, "nxfilter": 57, "nxflipper": 58, "nxfresnel_zone_pl": 59, "nxgeometri": [60, 116], "nxgrate": 61, "nxguid": 62, "nxinsertion_devic": 63, "nxinstrument": 64, "nxlog": 65, "nxmirror": 66, "nxmoder": 67, "nxmonitor": 68, "nxmonochrom": 69, "nxnote": 70, "nxobject": 71, "nxoff_geometri": [72, 116], "nxorient": 73, "nxparamet": 74, "nxpdb": 75, "nxpinhol": 76, "nxpolar": 77, "nxposition": 78, "nxprocess": 79, "nxreflect": 80, "nxroot": 81, "nxsampl": 82, "nxsample_compon": 83, "nxsensor": 84, "nxshape": 85, "nxslit": 86, "nxsourc": 87, "nxsubentri": [88, 151], "nxtransform": 89, "nxtranslat": 90, "nxuser": 91, "nxvelocity_selector": 92, "nxxraylen": 93, "base": [94, 116, 135], "class": [94, 110, 116, 133, 135, 148], "nxcontain": 95, "nxcsg": 96, "nxcxi_ptycho": 97, "nxelectrostatic_kick": 98, "nxmagnetic_kick": 99, "nxquadric": 100, "nxquadrupole_magnet": 101, "nxsepar": 102, "nxsnsevent": 103, "nxsnshisto": 104, "nxsolenoid_magnet": 105, "nxsolid_geometri": 106, "nxspecdata": 107, "nxspin_rot": 108, "contribut": [109, 112], "colophon": 111, "commun": [112, 133, 137], "webpag": 112, "other": 112, "wai": 112, "coordin": [112, 116], "scientif": [112, 133, 137], "copyright": 113, "licens": 113, "rule": [114, 116, 151], "item": [114, 147], "name": [114, 115, 147], "convent": 114, "variant": 114, "uncertainti": 114, "error": 114, "arrai": 114, "storag": [114, 133], "order": 114, "non": 114, "c": [114, 118, 119, 139], "type": [114, 115, 146, 147], "date": 114, "time": [114, 152], "unit": [114, 115, 146, 147], "detector": [114, 116, 120, 151], "monitor": 114, "ar": 114, "special": [114, 151], "find": [114, 121], "plottabl": [114, 121], "version": [114, 132], "associ": 114, "multi": [114, 151], "dimension": 114, "axi": [114, 147], "attribut": [114, 115, 116, 120, 147], "appli": 114, "group": [114, 115, 116, 147, 151], "exampl": [114, 118, 119, 120, 121, 122, 123, 124, 126, 133, 148], "ax": [114, 147], "dimens": [114, 147], "number": 114, "introduct": [115, 133, 145], "overview": [115, 138], "descript": [115, 116], "symbol": [115, 147], "tabl": 115, "annot": 115, "structur": [115, 151], "field": [115, 116, 146, 147], "link": [115, 116, 121, 123, 126, 147], "choic": [115, 128, 147], "design": [116, 133], "object": [116, 133], "term": [116, 137], "python": [116, 118, 120, 121, 154], "h5py": [116, 120, 121, 122, 123], "code": [116, 120, 121, 124, 132, 135], "make": 116, "extern": [116, 121], "combin": 116, "facilit": 116, "automat": 116, "plot": [116, 121, 137], "where": 116, "metadata": 116, "geometri": 116, "system": 116, "transform": 116, "And": [116, 151], "shape": 116, "legaci": 116, "mcsta": 116, "simpl": [116, 118, 119, 123, 133, 137, 151], "spheric": 116, "polar": 116, "underli": [116, 128], "format": [116, 128, 137], "doc": [117, 147], "program": [118, 119, 134, 138, 143], "napi": [118, 124, 134, 135, 138, 139, 140, 141, 142, 143], "d": [118, 125], "write": [118, 119, 120, 121, 122, 123, 124, 126, 134, 143, 145], "f77": [118, 154], "f90": [118, 138], "view": [118, 120, 125], "hdf5": [118, 119, 120, 121, 154], "h5dump": [118, 125], "output": [118, 125], "punx": [118, 155], "tree": 118, "simple3d": 118, "h5": 118, "nativ": 119, "command": 119, "read": [119, 121, 124, 126, 134, 143], "epic": 120, "area": [120, 151], "plugin": 120, "configur": 120, "xml": 120, "layout": 120, "addit": 120, "imag": [120, 125], "packag": 120, "nexusformat": 120, "visual": [120, 125], "download": [120, 121, 122, 123, 126], "footnot": 120, "simplest": [121, 122, 152], "complet": 121, "default": 121, "external_angl": 121, "external_count": 121, "external_mast": 121, "sourc": [121, 132], "externalexampl": 121, "py": 121, "variou": 124, "languag": [124, 145, 154], "api": [124, 138, 143, 154], "from": 125, "lrmec": 125, "lrcs3701": 125, "hdfview": 125, "igorpro": [125, 154], "matlab": 126, "input": 126, "dat": 126, "frequent": 127, "ask": 127, "question": 127, "physic": 128, "hdf": [128, 154], "repositori": 129, "brief": 130, "histori": [130, 150], "user": [131, 153], "manual": [131, 153], "refer": [131, 145, 149], "document": [131, 143, 145, 149], "instal": [132, 143], "precompil": 132, "binari": 132, "linux": 132, "rpm": 132, "distribut": 132, "kit": 132, "microsoft": 132, "window": [132, 143], "mac": 132, "o": 132, "x": 132, "releas": 132, "note": 132, "tag": 132, "what": 133, "i": [133, 134], "A": 133, "set": 133, "principl": 133, "import": 133, "subroutin": 133, "interfac": [134, 138, 139, 140, 141, 142, 143], "how": 134, "do": 134, "brows": 134, "issu": 135, "report": [135, 138], "librari": [135, 143], "mail": 136, "intern": [136, 144, 147], "advisori": [136, 144], "committe": [136, 144], "video": 136, "confer": 136, "announc": 136, "develop": 136, "retir": 136, "motiv": 137, "unifi": 137, "reduct": 137, "analysi": [137, 154], "defin": 137, "dictionari": 137, "programm": 138, "frozen": 138, "statu": 138, "core": 138, "util": [138, 154], "routin": [138, 143], "build": 138, "bug": 138, "fortran": [140, 141], "77": 140, "90": 141, "idl": [142, 154], "java": [143, 154], "acknowledg": 143, "requir": [143, 147], "under": [143, 147], "unix": 143, "run": 143, "locat": 143, "share": 143, "jnexu": 143, "jar": 143, "inquiri": 143, "known": 143, "problem": 143, "On": 143, "line": 143, "allow": 146, "categori": [146, 147], "element": 147, "enumer": 147, "attributetyp": 147, "option": 147, "definitiontyp": 147, "extend": 147, "ignoreextraattribut": 147, "ignoreextrafield": 147, "ignoreextragroup": 147, "restrict": 147, "svnid": 147, "definitiontypeattr": 147, "dimensionstyp": 147, "rank": 147, "dim": 147, "incr": 147, "index": 147, "ref": 147, "refindex": 147, "valu": 147, "doctyp": 147, "enumerationtyp": 147, "fieldtyp": 147, "data_offset": 147, "interpret": 147, "long_nam": 147, "maxoccur": 147, "minoccur": 147, "nametyp": 147, "primari": 147, "recommend": 147, "signal": 147, "stride": 147, "choicetyp": 147, "grouptyp": 147, "linktyp": 147, "napimount": 147, "target": 147, "symbolstyp": 147, "basiccompon": 147, "validitemnam": 147, "validnxclassnam": 147, "validtargetnam": 147, "nonnegativeunbound": 147, "represent": 148, "path": 148, "revis": 150, "content": 151, "raw": 151, "method": 151, "case": [151, 152], "scan": [151, 152], "complex": 151, "hkl": 151, "xa": 151, "raster": 151, "stream": 151, "acquisit": 151, "log": 151, "strategi": 152, "": 152, "two": 152, "more": 152, "column": 152, "wavelength": 152, "stamp": 152, "next": 152, "suppli": 154, "valid": [154, 155], "tool": 154, "mix": 154, "verif": 155, "nxvalid": 155}, "envversion": {"sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.viewcode": 1, "sphinx": 58}, "alltitles": {"Constructing NeXus Files and Application Definitions": [[0, "constructing-nexus-files-and-application-definitions"]], "The WOnderful New Instrument (WONI)": [[0, "the-wonderful-new-instrument-woni"]], "Constructing a NeXus file for WONI": [[0, "constructing-a-nexus-file-for-woni"]], "Decide which parameters need to be stored": [[0, "decide-which-parameters-need-to-be-stored"]], "Mapping parameters to NeXus": [[0, "mapping-parameters-to-nexus"]], "Decide on NXdata": [[0, "decide-on-nxdata"]], "Fill in auxiliary Information": [[0, "fill-in-auxiliary-information"]], "Creating a NXDL Specification": [[0, "creating-a-nxdl-specification"]], "Application Definition Steps": [[0, "application-definition-steps"]], "Step 1: Think! hard about data": [[0, "step-1-think-hard-about-data"]], "Step 2: Map Data into the NeXus Hierarchy": [[0, "step-2-map-data-into-the-nexus-hierarchy"]], "Step 3: Describe this map in a NXDL file": [[0, "step-3-describe-this-map-in-a-nxdl-file"]], "Step 4: Standardize with the NIAC": [[0, "step-4-standardize-with-the-niac"]], "Full listing of the WONI Application Definition": [[0, "full-listing-of-the-woni-application-definition"]], "Using an Application Definition": [[0, "using-an-application-definition"]], "Processed Data": [[0, "processed-data"]], "Authors": [[1, "authors"]], "NXarchive": [[2, "nxarchive"]], "Hypertext Anchors": [[2, "hypertext-anchors"], [3, "hypertext-anchors"], [4, "hypertext-anchors"], [5, "hypertext-anchors"], [6, "hypertext-anchors"], [7, "hypertext-anchors"], [8, "hypertext-anchors"], [9, "hypertext-anchors"], [10, "hypertext-anchors"], [11, "hypertext-anchors"], [12, "hypertext-anchors"], [13, "hypertext-anchors"], [14, "hypertext-anchors"], [15, "hypertext-anchors"], [16, "hypertext-anchors"], [17, "hypertext-anchors"], [18, "hypertext-anchors"], [19, "hypertext-anchors"], [20, "hypertext-anchors"], [21, "hypertext-anchors"], [22, "hypertext-anchors"], [23, "hypertext-anchors"], [24, "hypertext-anchors"], [25, "hypertext-anchors"], [26, "hypertext-anchors"], [27, "hypertext-anchors"], [28, "hypertext-anchors"], [29, "hypertext-anchors"], [30, "hypertext-anchors"], [31, "hypertext-anchors"], [32, "hypertext-anchors"], [33, "hypertext-anchors"], [34, "hypertext-anchors"], [35, "hypertext-anchors"], [37, "hypertext-anchors"], [38, "hypertext-anchors"], [39, "hypertext-anchors"], [40, "hypertext-anchors"], [41, "hypertext-anchors"], [42, "hypertext-anchors"], [43, "hypertext-anchors"], [45, "hypertext-anchors"], [46, "hypertext-anchors"], [47, "hypertext-anchors"], [48, "hypertext-anchors"], [49, "hypertext-anchors"], [50, "hypertext-anchors"], [51, "hypertext-anchors"], [52, "hypertext-anchors"], [53, "hypertext-anchors"], [54, "hypertext-anchors"], [55, "hypertext-anchors"], [56, "hypertext-anchors"], [57, "hypertext-anchors"], [58, "hypertext-anchors"], [59, "hypertext-anchors"], [60, "hypertext-anchors"], [61, "hypertext-anchors"], [62, "hypertext-anchors"], [63, "hypertext-anchors"], [64, "hypertext-anchors"], [65, "hypertext-anchors"], [66, "hypertext-anchors"], [67, "hypertext-anchors"], [68, "hypertext-anchors"], [69, "hypertext-anchors"], [70, "hypertext-anchors"], [72, "hypertext-anchors"], [73, "hypertext-anchors"], [74, "hypertext-anchors"], [76, "hypertext-anchors"], [77, "hypertext-anchors"], [78, "hypertext-anchors"], [79, "hypertext-anchors"], [80, "hypertext-anchors"], [81, "hypertext-anchors"], [82, "hypertext-anchors"], [83, "hypertext-anchors"], [84, "hypertext-anchors"], [85, "hypertext-anchors"], [86, "hypertext-anchors"], [87, "hypertext-anchors"], [88, "hypertext-anchors"], [89, "hypertext-anchors"], [90, "hypertext-anchors"], [91, "hypertext-anchors"], [92, "hypertext-anchors"], [93, "hypertext-anchors"], [95, "hypertext-anchors"], [96, "hypertext-anchors"], [97, "hypertext-anchors"], [98, "hypertext-anchors"], [99, "hypertext-anchors"], [100, "hypertext-anchors"], [101, "hypertext-anchors"], [102, "hypertext-anchors"], [103, "hypertext-anchors"], [104, "hypertext-anchors"], [105, "hypertext-anchors"], [106, "hypertext-anchors"], [107, "hypertext-anchors"], [108, "hypertext-anchors"]], "NXarpes": [[3, "nxarpes"]], "NXcanSAS": [[4, "nxcansas"]], "NXdirecttof": [[5, "nxdirecttof"]], "NXfluo": [[6, "nxfluo"]], "NXindirecttof": [[7, "nxindirecttof"]], "NXiqproc": [[8, "nxiqproc"]], "NXlauetof": [[9, "nxlauetof"]], "NXmonopd": [[10, "nxmonopd"]], "NXmx": [[11, "nxmx"]], "NXrefscan": [[12, "nxrefscan"]], "NXreftof": [[13, "nxreftof"]], "NXsas": [[14, "nxsas"]], "NXsastof": [[15, "nxsastof"]], "NXscan": [[16, "nxscan"]], "NXspe": [[17, "nxspe"]], "NXsqom": [[18, "nxsqom"]], "NXstxm": [[19, "nxstxm"]], "NXtas": [[20, "nxtas"]], "NXtofnpd": [[21, "nxtofnpd"]], "NXtofraw": [[22, "nxtofraw"]], "NXtofsingle": [[23, "nxtofsingle"]], "NXtomo": [[24, "nxtomo"]], "NXtomophase": [[25, "nxtomophase"]], "NXtomoproc": [[26, "nxtomoproc"]], "NXxas": [[27, "nxxas"]], "NXxasproc": [[28, "nxxasproc"]], "NXxbase": [[29, "nxxbase"]], "NXxeuler": [[30, "nxxeuler"]], "NXxkappa": [[31, "nxxkappa"]], "NXxlaue": [[32, "nxxlaue"]], "NXxlaueplate": [[33, "nxxlaueplate"]], "NXxnb": [[34, "nxxnb"]], "NXxrot": [[35, "nxxrot"]], "Application Definitions": [[36, "application-definitions"]], "NXaperture": [[37, "nxaperture"]], "NXattenuator": [[38, "nxattenuator"]], "NXbeam": [[39, "nxbeam"]], "NXbeam_stop": [[40, "nxbeam-stop"]], "NXbending_magnet": [[41, "nxbending-magnet"]], "NXcapillary": [[42, "nxcapillary"]], "NXcite": [[43, "nxcite"]], "NXcollection": [[44, "nxcollection"], [151, "nxcollection"]], "NXcollimator": [[45, "nxcollimator"]], "NXcrystal": [[46, "nxcrystal"]], "NXcylindrical_geometry": [[47, "nxcylindrical-geometry"], [116, "nxcylindrical-geometry"]], "NXdata": [[48, "nxdata"]], "NXdetector": [[49, "nxdetector"]], "NXdetector_group": [[50, "nxdetector-group"]], "NXdetector_module": [[51, "nxdetector-module"]], "NXdisk_chopper": [[52, "nxdisk-chopper"]], "NXentry": [[53, "nxentry"]], "NXenvironment": [[54, "nxenvironment"]], "NXevent_data": [[55, "nxevent-data"]], "NXfermi_chopper": [[56, "nxfermi-chopper"]], "NXfilter": [[57, "nxfilter"]], "NXflipper": [[58, "nxflipper"]], "NXfresnel_zone_plate": [[59, "nxfresnel-zone-plate"]], "NXgeometry": [[60, "nxgeometry"]], "NXgrating": [[61, "nxgrating"]], "NXguide": [[62, "nxguide"]], "NXinsertion_device": [[63, "nxinsertion-device"]], "NXinstrument": [[64, "nxinstrument"]], "NXlog": [[65, "nxlog"]], "NXmirror": [[66, "nxmirror"]], "NXmoderator": [[67, "nxmoderator"]], "NXmonitor": [[68, "nxmonitor"]], "NXmonochromator": [[69, "nxmonochromator"]], "NXnote": [[70, "nxnote"]], "NXobject": [[71, "nxobject"]], "NXoff_geometry": [[72, "nxoff-geometry"], [116, "nxoff-geometry"]], "NXorientation": [[73, "nxorientation"]], "NXparameters": [[74, "nxparameters"]], "NXpdb": [[75, "nxpdb"]], "NXpinhole": [[76, "nxpinhole"]], "NXpolarizer": [[77, "nxpolarizer"]], "NXpositioner": [[78, "nxpositioner"]], "NXprocess": [[79, "nxprocess"]], "NXreflections": [[80, "nxreflections"]], "NXroot": [[81, "nxroot"]], "NXsample": [[82, "nxsample"]], "NXsample_component": [[83, "nxsample-component"]], "NXsensor": [[84, "nxsensor"]], "NXshape": [[85, "nxshape"]], "NXslit": [[86, "nxslit"]], "NXsource": [[87, "nxsource"]], "NXsubentry": [[88, "nxsubentry"]], "NXtransformations": [[89, "nxtransformations"]], "NXtranslation": [[90, "nxtranslation"]], "NXuser": [[91, "nxuser"]], "NXvelocity_selector": [[92, "nxvelocity-selector"]], "NXxraylens": [[93, "nxxraylens"]], "Base Class Definitions": [[94, "base-class-definitions"]], "NXcontainer": [[95, "nxcontainer"]], "NXcsg": [[96, "nxcsg"]], "NXcxi_ptycho": [[97, "nxcxi-ptycho"]], "NXelectrostatic_kicker": [[98, "nxelectrostatic-kicker"]], "NXmagnetic_kicker": [[99, "nxmagnetic-kicker"]], "NXquadric": [[100, "nxquadric"]], "NXquadrupole_magnet": [[101, "nxquadrupole-magnet"]], "NXseparator": [[102, "nxseparator"]], "NXsnsevent": [[103, "nxsnsevent"]], "NXsnshisto": [[104, "nxsnshisto"]], "NXsolenoid_magnet": [[105, "nxsolenoid-magnet"]], "NXsolid_geometry": [[106, "nxsolid-geometry"]], "NXspecdata": [[107, "nxspecdata"]], "NXspin_rotator": [[108, "nxspin-rotator"]], "Contributed Definitions": [[109, "contributed-definitions"], [112, "contributed-definitions"]], "NeXus Class Definitions": [[110, "nexus-class-definitions"]], "Colophon": [[111, "colophon"]], "NeXus Community": [[112, "nexus-community"]], "NeXus Webpage": [[112, "nexus-webpage"]], "Other Ways NeXus Coordinates with the Scientific Community": [[112, "other-ways-nexus-coordinates-with-the-scientific-community"]], "Copyright and Licenses": [[113, "copyright-and-licenses"]], "Rules for Storing Data Items in NeXus Files": [[114, "rules-for-storing-data-items-in-nexus-files"]], "Naming Conventions": [[114, "naming-conventions"]], "Variants": [[114, "variants"]], "Uncertainties or Errors": [[114, "uncertainties-or-errors"]], "NeXus Array Storage Order": [[114, "nexus-array-storage-order"]], "Non C Storage Order": [[114, "non-c-storage-order"]], "NeXus Data Types": [[114, "nexus-data-types"]], "NeXus dates and times": [[114, "nexus-dates-and-times"]], "NeXus Data Units": [[114, "nexus-data-units"]], "Storing Detectors": [[114, "storing-detectors"]], "Monitors are Special": [[114, "monitors-are-special"]], "Find the plottable data": [[114, "find-the-plottable-data"]], "Version 3": [[114, "version-3"]], "Version 2": [[114, "version-2"]], "Version 1": [[114, "version-1"]], "Associating Multi Dimensional Data with Axis Data": [[114, "associating-multi-dimensional-data-with-axis-data"]], "Associating plottable data using attributes applied to the NXdata group": [[114, "associating-plottable-data-using-attributes-applied-to-the-nxdata-group"]], "Examples": [[114, "examples"]], "Associating plottable data by name using the axes attribute": [[114, "associating-plottable-data-by-name-using-the-axes-attribute"]], "Associating plottable data by dimension number using the axis attribute": [[114, "associating-plottable-data-by-dimension-number-using-the-axis-attribute"]], "Introduction to NeXus definitions": [[115, "introduction-to-nexus-definitions"]], "Overview of NeXus definitions": [[115, "overview-of-nexus-definitions"]], "Description": [[115, "description"], [115, "id1"]], "Symbols table": [[115, "symbols-table"]], "Annotated Structure": [[115, "annotated-structure"]], "Names (groups, fields, links, and attributes)": [[115, "names-groups-fields-links-and-attributes"]], "NeXus data type": [[115, "nexus-data-type"]], "Units": [[115, "units"]], "Choice": [[115, "choice"]], "NeXus Design": [[116, "nexus-design"]], "NeXus Objects and Terms": [[116, "nexus-objects-and-terms"]], "Groups": [[116, "groups"]], "Fields": [[116, "fields"]], "Attributes": [[116, "attributes"]], "File attributes": [[116, "file-attributes"]], "Links": [[116, "links"]], "Python h5py code to make NeXus links": [[116, "index-13"]], "External File Links": [[116, "external-file-links"]], "Combining NeXus links and External File Links": [[116, "combining-nexus-links-and-external-file-links"]], "NeXus Base Classes": [[116, "nexus-base-classes"]], "NXdata Facilitates Automatic Plotting": [[116, "nxdata-facilitates-automatic-plotting"]], "Where to Store Metadata": [[116, "where-to-store-metadata"]], "NeXus Application Definitions": [[116, "nexus-application-definitions"]], "NeXus Geometry": [[116, "nexus-geometry"]], "The NeXus Coordinate System": [[116, "the-nexus-coordinate-system"]], "Coordinate Transformations": [[116, "coordinate-transformations"]], "Coordinate Transformation Field And Attributes": [[116, "coordinate-transformation-field-and-attributes"]], "Shape Descriptions": [[116, "shape-descriptions"]], "Detector Shape Descriptions": [[116, "detector-shape-descriptions"]], "Legacy Geometry Descriptions": [[116, "legacy-geometry-descriptions"]], "McStas and NXgeometry System": [[116, "mcstas-and-nxgeometry-system"]], "Simple (Spherical Polar) Coordinate System": [[116, "simple-spherical-polar-coordinate-system"]], "Rules and Underlying File Formats": [[116, "rules-and-underlying-file-formats"]], "About these docs": [[117, "about-these-docs"]], "Example NeXus programs using NAPI": [[118, "example-nexus-programs-using-napi"]], "NAPI Simple 2-D Write Example (C, F77, F90)": [[118, "napi-simple-2-d-write-example-c-f77-f90"]], "NAPI C Example: write simple NeXus file": [[118, "napi-c-example-write-simple-nexus-file"]], "NAPI F77 Example: write simple NeXus file": [[118, "napi-f77-example-write-simple-nexus-file"]], "NAPI F90 Example: write simple NeXus file": [[118, "napi-f90-example-write-simple-nexus-file"]], "NAPI Python Simple 3-D Write Example": [[118, "napi-python-simple-3-d-write-example"]], "NAPI Python Example: write simple NeXus file": [[118, "napi-python-example-write-simple-nexus-file"]], "View a NeXus HDF5 file using h5dump": [[118, "view-a-nexus-hdf5-file-using-h5dump"]], "NAPI Python Example: h5dump output of NeXus HDF5 file": [[118, "napi-python-example-h5dump-output-of-nexus-hdf5-file"]], "View a NeXus HDF5 file using punx tree": [[118, "view-a-nexus-hdf5-file-using-punx-tree"]], "NAPI Python Example: punx tree simple3D.h5 output of NeXus HDF5 file": [[118, "napi-python-example-punx-tree-simple3d-h5-output-of-nexus-hdf5-file"]], "Example NeXus C programs using native HDF5 commands": [[119, "example-nexus-c-programs-using-native-hdf5-commands"]], "Writing a simple NeXus file using native HDF5 commands in C": [[119, "writing-a-simple-nexus-file-using-native-hdf5-commands-in-c"]], "Reading a simple NeXus file using native HDF5 commands in C": [[119, "reading-a-simple-nexus-file-using-native-hdf5-commands-in-c"]], "EPICS Area Detector Examples": [[120, "epics-area-detector-examples"]], "HDF5 File Writing Plugin": [[120, "hdf5-file-writing-plugin"]], "configuration files": [[120, "configuration-files"]], "attributes.xml": [[120, "attributes-xml"]], "layout.xml": [[120, "layout-xml"]], "additional configuration": [[120, "additional-configuration"]], "Example view": [[120, "example-view"]], "Python code to store an image in a NeXus file": [[120, "python-code-to-store-an-image-in-a-nexus-file"]], "using the h5py package": [[120, "using-the-h5py-package"]], "using the nexusformat package": [[120, "using-the-nexusformat-package"]], "Visualization": [[120, "visualization"]], "Downloads": [[120, "downloads"], [126, "downloads"]], "Footnotes": [[120, "footnotes"]], "Python Examples using h5py": [[121, "python-examples-using-h5py"]], "Writing the simplest data using h5py": [[121, "writing-the-simplest-data-using-h5py"]], "Complete h5py example writing and reading a NeXus data file": [[121, "complete-h5py-example-writing-and-reading-a-nexus-data-file"]], "Writing the HDF5 file using h5py": [[121, "writing-the-hdf5-file-using-h5py"]], "Reading the HDF5 file using h5py": [[121, "reading-the-hdf5-file-using-h5py"]], "Finding the default plottable data": [[121, "finding-the-default-plottable-data"]], "Plotting the HDF5 file": [[121, "plotting-the-hdf5-file"]], "Links to Data in External HDF5 Files": [[121, "links-to-data-in-external-hdf5-files"]], "file: external_angles.hdf5": [[121, "file-external-angles-hdf5"]], "file: external_counts.hdf5": [[121, "file-external-counts-hdf5"]], "file: external_master.hdf5": [[121, "file-external-master-hdf5"]], "source code: externalExample.py": [[121, "source-code-externalexample-py"]], "downloads": [[121, "downloads"], [122, "downloads"], [123, "downloads"]], "h5py example writing the simplest NeXus data file": [[122, "h5py-example-writing-the-simplest-nexus-data-file"]], "h5py example writing a simple NeXus data file with links": [[123, "h5py-example-writing-a-simple-nexus-data-file-with-links"]], "Examples of writing and reading NeXus data files": [[124, "examples-of-writing-and-reading-nexus-data-files"]], "Code Examples in Various Languages": [[124, "code-examples-in-various-languages"]], "Code Examples that use the NeXus API (NAPI)": [[124, "code-examples-that-use-the-nexus-api-napi"]], "Code that reads NeXus data files": [[124, "code-that-reads-nexus-data-files"]], "Viewing 2-D Data from LRMECS": [[125, "viewing-2-d-data-from-lrmecs"]], "Visualize Using h5dump": [[125, "visualize-using-h5dump"]], "LRMECS lrcs3701 data: h5dump output": [[125, "lrmecs-lrcs3701-data-h5dump-output"]], "Visualize Using HDFview": [[125, "visualize-using-hdfview"]], "LRMECS lrcs3701 data: image": [[125, "lrmecs-lrcs3701-data-image"], [125, "id3"]], "Visualize Using IgorPro": [[125, "visualize-using-igorpro"]], "MATLAB Examples": [[126, "matlab-examples"]], "input.dat": [[126, "input-dat"]], "writing data": [[126, "writing-data"]], "reading data": [[126, "reading-data"]], "writing data file with links": [[126, "writing-data-file-with-links"]], "Frequently Asked Questions": [[127, "frequently-asked-questions"]], "Physical File format": [[128, "physical-file-format"]], "Choice of HDF as Underlying File Format": [[128, "choice-of-hdf-as-underlying-file-format"]], "Mapping NeXus into HDF": [[128, "mapping-nexus-into-hdf"]], "NeXus Repositories": [[129, "nexus-repositories"]], "Brief history of NeXus": [[130, "brief-history-of-nexus"]], "User Manual and Reference Documentation": [[131, "user-manual-and-reference-documentation"]], "Installation": [[132, "installation"], [143, "installation"]], "Precompiled Binary Installation": [[132, "precompiled-binary-installation"]], "Linux RPM Distribution Kits": [[132, "linux-rpm-distribution-kits"]], "Microsoft Windows Installation Kit": [[132, "microsoft-windows-installation-kit"]], "Mac OS X Installation Kit": [[132, "mac-os-x-installation-kit"]], "Source Installation": [[132, "source-installation"]], "NeXus Source Code Distribution": [[132, "nexus-source-code-distribution"]], "Releases": [[132, "releases"]], "NeXus definitions": [[132, "nexus-definitions"]], "Release Notes": [[132, "release-notes"]], "Release Process": [[132, "release-process"]], "Versioning (Tags)": [[132, "versioning-tags"]], "NeXus Introduction": [[133, "nexus-introduction"]], "What is NeXus?": [[133, "what-is-nexus"]], "A Set of Design Principles": [[133, "a-set-of-design-principles"]], "Example of a NeXus File": [[133, "example-of-a-nexus-file"]], "Important Classes": [[133, "important-classes"]], "Simple Example": [[133, "simple-example"]], "A Set of Data Storage Objects": [[133, "a-set-of-data-storage-objects"]], "A Set of Subroutines": [[133, "a-set-of-subroutines"]], "Scientific Community": [[133, "scientific-community"]], "NAPI: The NeXus Application Programming Interface": [[134, "napi-the-nexus-application-programming-interface"]], "How do I write a NeXus file?": [[134, "how-do-i-write-a-nexus-file"]], "How do I read a NeXus file?": [[134, "how-do-i-read-a-nexus-file"]], "How do I browse a NeXus file?": [[134, "how-do-i-browse-a-nexus-file"]], "NeXus Issue Reporting": [[135, "nexus-issue-reporting"]], "NeXus Code (NAPI, Library, and Applications)": [[135, "nexus-code-napi-library-and-applications"]], "NeXus Definitions (NXDL base classes and application definitions)": [[135, "nexus-definitions-nxdl-base-classes-and-application-definitions"]], "NeXus Mailing List": [[136, "nexus-mailing-list"]], "NeXus International Advisory Committee (NIAC) Mailing List": [[136, "nexus-international-advisory-committee-niac-mailing-list"]], "NeXus Video Conference Announcements": [[136, "nexus-video-conference-announcements"]], "NeXus Developers Mailing List (retired)": [[136, "nexus-developers-mailing-list-retired"]], "Motivations for the NeXus standard in the Scientific Community": [[137, "motivations-for-the-nexus-standard-in-the-scientific-community"]], "Simple plotting": [[137, "simple-plotting"]], "Unified format for reduction and analysis": [[137, "unified-format-for-reduction-and-analysis"]], "Defined dictionary of terms": [[137, "defined-dictionary-of-terms"]], "NAPI: NeXus Application Programmer Interface (frozen)": [[138, "napi-nexus-application-programmer-interface-frozen"]], "Status": [[138, "status"]], "Overview": [[138, "overview"]], "Core API": [[138, "core-api"]], "Utility API": [[138, "utility-api"]], "List of F90 Utility Routines": [[138, "list-of-f90-utility-routines"]], "Building Programs": [[138, "building-programs"]], "Reporting Bugs in the NeXus API": [[138, "reporting-bugs-in-the-nexus-api"]], "NAPI C and C++ Interface": [[139, "napi-c-and-c-interface"]], "NAPI Fortran 77 Interface": [[140, "napi-fortran-77-interface"]], "NAPI Fortran 90 Interface": [[141, "napi-fortran-90-interface"]], "NAPI IDL Interface": [[142, "napi-idl-interface"]], "NAPI Java Interface": [[143, "napi-java-interface"]], "Acknowledgement": [[143, "acknowledgement"]], "Requirements": [[143, "requirements"]], "Installation under Windows": [[143, "installation-under-windows"]], "Installation under Unix": [[143, "installation-under-unix"]], "Running Programs with the NeXus API for Java": [[143, "running-programs-with-the-nexus-api-for-java"]], "Locating the shared libraries": [[143, "locating-the-shared-libraries"]], "Locating jnexus.jar": [[143, "locating-jnexus-jar"]], "Programming with the NeXus API for Java": [[143, "programming-with-the-nexus-api-for-java"]], "Data Writing and Reading": [[143, "data-writing-and-reading"]], "Inquiry Routines": [[143, "inquiry-routines"]], "Known Problems": [[143, "known-problems"]], "On-line Documentation": [[143, "on-line-documentation"]], "NIAC: The NeXus International Advisory Committee": [[144, "niac-the-nexus-international-advisory-committee"]], "NXDL: The NeXus Definition Language": [[145, "nxdl-the-nexus-definition-language"]], "Introduction": [[145, "introduction"]], "Writing references and anchors in the documentation.": [[145, null]], "NXDL Field Types and Units": [[146, "nxdl-field-types-and-units"]], "Field Types allowed in NXDL specifications": [[146, "field-types-allowed-in-nxdl-specifications"]], "Unit Categories allowed in NXDL specifications": [[146, "unit-categories-allowed-in-nxdl-specifications"]], "NXDL Elements and Field Types": [[147, "nxdl-elements-and-field-types"]], "NXDL Elements": [[147, "nxdl-elements"]], "attribute": [[147, "attribute"], [147, "id24"]], "choice": [[147, "choice"]], "definition": [[147, "definition"], [147, "nxdl-data-type-definition"]], "dimensions": [[147, "dimensions"], [147, "id12"], [147, "id25"]], "doc": [[147, "doc"], [147, "id13"], [147, "id19"], [147, "id21"], [147, "id35"], [147, "id37"], [147, "id39"]], "enumeration": [[147, "enumeration"], [147, "id14"], [147, "id26"]], "field": [[147, "field"]], "group": [[147, "group"], [147, "id28"]], "link": [[147, "link"]], "symbols": [[147, "symbols"], [147, "id18"]], "NXDL Field Types (internal)": [[147, "nxdl-field-types-internal"]], "attributeType": [[147, "attributetype"]], "Attributes of attributeType": [[147, "attributes-of-attributetype"]], "@name": [[147, "name"], [147, "id16"], [147, "id27"], [147, "id31"], [147, "id36"], [147, "id38"]], "@optional": [[147, "optional"], [147, "id22"], [147, "id32"]], "@type": [[147, "type"], [147, "id17"], [147, "id23"], [147, "id34"]], "Elements of attributeType": [[147, "elements-of-attributetype"]], "definitionType": [[147, "definitiontype"]], "Attributes of definitionType": [[147, "attributes-of-definitiontype"]], "@category": [[147, "category"]], "@extends": [[147, "extends"]], "@ignoreExtraAttributes": [[147, "ignoreextraattributes"]], "@ignoreExtraFields": [[147, "ignoreextrafields"]], "@ignoreExtraGroups": [[147, "ignoreextragroups"]], "@restricts": [[147, "restricts"]], "@svnid": [[147, "svnid"]], "Elements of definitionType": [[147, "elements-of-definitiontype"]], "Groups under definitionType": [[147, "groups-under-definitiontype"]], "definitionTypeAttr": [[147, "definitiontypeattr"]], "dimensionsType": [[147, "dimensionstype"]], "Attributes of dimensionsType": [[147, "attributes-of-dimensionstype"]], "@rank": [[147, "rank"]], "Elements of dimensionsType": [[147, "elements-of-dimensionstype"]], "dim": [[147, "dim"]], "@incr": [[147, "incr"]], "@index": [[147, "index"]], "@ref": [[147, "ref"]], "@refindex": [[147, "refindex"]], "@required": [[147, "required"]], "@value": [[147, "value"], [147, "id20"]], "docType": [[147, "doctype"]], "enumerationType": [[147, "enumerationtype"]], "Elements of enumerationType": [[147, "elements-of-enumerationtype"]], "item": [[147, "item"]], "fieldType": [[147, "fieldtype"]], "@axes": [[147, "axes"]], "@axis": [[147, "axis"]], "@data_offset": [[147, "data-offset"]], "@interpretation": [[147, "interpretation"]], "@long_name": [[147, "long-name"]], "@maxOccurs": [[147, "maxoccurs"], [147, "id29"]], "@minOccurs": [[147, "minoccurs"], [147, "id30"]], "@nameType": [[147, "nametype"]], "@primary": [[147, "primary"]], "@recommended": [[147, "recommended"], [147, "id33"]], "@signal": [[147, "signal"]], "@stride": [[147, "stride"]], "@units": [[147, "units"]], "choiceType": [[147, "choicetype"]], "Attributes of choiceType": [[147, "attributes-of-choicetype"]], "Elements of choiceType": [[147, "elements-of-choicetype"]], "groupType": [[147, "grouptype"]], "Attributes of groupType": [[147, "attributes-of-grouptype"]], "linkType": [[147, "linktype"]], "@napimount": [[147, "napimount"]], "@target": [[147, "target"]], "symbolsType": [[147, "symbolstype"]], "Elements of symbolsType": [[147, "elements-of-symbolstype"]], "symbol": [[147, "symbol"]], "basicComponent": [[147, "basiccomponent"]], "Attributes of basicComponent": [[147, "attributes-of-basiccomponent"]], "Elements of basicComponent": [[147, "elements-of-basiccomponent"]], "validItemName": [[147, "validitemname"]], "validNXClassName": [[147, "validnxclassname"]], "validTargetName": [[147, "validtargetname"]], "nonNegativeUnbounded": [[147, "nonnegativeunbounded"]], "Representation of data examples": [[148, "representation-of-data-examples"]], "Class path specification": [[148, "class-path-specification"]], "NeXus: Reference Documentation": [[149, "nexus-reference-documentation"]], "Revision History": [[150, "revision-history"]], "Rules for Structuring Information in NeXus Files": [[151, "rules-for-structuring-information-in-nexus-files"]], "Content of a Raw Data NXentry Group": [[151, "content-of-a-raw-data-nxentry-group"]], "Content of a processed data NXentry group": [[151, "content-of-a-processed-data-nxentry-group"]], "NXsubentry or Multi-Method Data": [[151, "nxsubentry-or-multi-method-data"]], "Rules for Special Cases": [[151, "rules-for-special-cases"]], "Scans": [[151, "scans"]], "Simple scan": [[151, "simple-scan"]], "Simple scan with area detector": [[151, "simple-scan-with-area-detector"]], "Complex hkl scan": [[151, "complex-hkl-scan"]], "Multi-parameter scan: XAS": [[151, "multi-parameter-scan-xas"]], "Rastering": [[151, "rastering"]], "Streaming Data Acquisition And Logging": [[151, "streaming-data-acquisition-and-logging"]], "Strategies for storing information in NeXus data files": [[152, "strategies-for-storing-information-in-nexus-data-files"]], "Strategies: The simplest case(s)": [[152, "strategies-the-simplest-case-s"]], "Step scan with two or more data columns": [[152, "step-scan-with-two-or-more-data-columns"]], "Strategies: The wavelength": [[152, "strategies-the-wavelength"]], "Strategies: Time-stamped data": [[152, "strategies-time-stamped-data"]], "Strategies: The next case": [[152, "strategies-the-next-case"]], "NeXus: User Manual": [[153, "nexus-user-manual"]], "NeXus Utilities": [[154, "nexus-utilities"]], "Utilities supplied with NeXus": [[154, "utilities-supplied-with-nexus"]], "Validation": [[154, "validation"]], "Data Analysis": [[154, "data-analysis"]], "HDF Tools": [[154, "hdf-tools"]], "Language APIs for NeXus and HDF5": [[154, "language-apis-for-nexus-and-hdf5"]], "Language API: F77": [[154, "language-api-f77"]], "Language API: IDL": [[154, "language-api-idl"]], "Language API: IgorPro": [[154, "language-api-igorpro"]], "Language API: Java": [[154, "language-api-java"]], "Language API: Python": [[154, "language-api-python"]], "Language API: mixed": [[154, "language-api-mixed"]], "Verification and validation of files": [[155, "verification-and-validation-of-files"]], "nxvalidate": [[155, "nxvalidate"]], "punx": [[155, "punx"]]}, "indexentries": {"nxdl template file": [[0, "index-6"], [0, "index-6"]], "nxprocess": [[0, "index-11"], [79, "index-0"]], "processed data": [[0, "index-11"]], "woni": [[0, "index-0"], [0, "index-1"]], "category (nxdl attribute)": [[0, "index-6"]], "definition (nxdl element)": [[0, "index-6"], [147, "index-3"]], "dim (nxdl element)": [[0, "index-8"]], "dimensions (nxdl element)": [[0, "index-8"], [147, "index-4"]], "doc (nxdl element)": [[0, "index-8"], [147, "index-5"]], "extends (nxdl attribute)": [[0, "index-6"]], "field (nxdl element)": [[0, "index-8"], [147, "index-7"]], "group (nxdl element)": [[0, "index-7"], [147, "index-8"]], "hierarchy": [[0, "index-12"], [0, "index-3"], [0, "index-5"], [116, "index-0"], [116, "index-2"], [133, "index-8"], [133, "index-9"], [151, "index-2"], [151, "index-3"], [154, "index-7"]], "index (nxdl attribute)": [[0, "index-8"]], "metadata": [[0, "index-10"], [0, "index-2"], [0, "index-4"], [116, "index-25"], [145, "index-2"], [155, "index-1"]], "name (nxdl attribute)": [[0, "index-6"], [0, "index-8"]], "rank": [[0, "index-9"], [114, "index-33"], [114, "index-46"], [134, "index-5"]], "rank (nxdl attribute)": [[0, "index-8"]], "template": [[0, "index-6"]], "tutorial": [[0, "index-1"]], "type (nxdl attribute)": [[0, "index-6"], [0, "index-7"], [0, "index-8"]], "units (nxdl attribute)": [[0, "index-8"]], "value (nxdl attribute)": [[0, "index-8"]], "xmlns (nxdl attribute)": [[0, "index-6"]], "xsi:schemalocation (nxdl attribute)": [[0, "index-6"]], "authors": [[1, "index-0"]], "documentation editor": [[1, "index-1"]], "nxarchive": [[2, "index-0"]], "nxarchive (application definition)": [[2, "index-0"]], "nxentry (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-0"], [81, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-10"]], "nxinstrument (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-1"], [64, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-14"]], "nxsample (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [34, "index-1"], [35, "index-1"], [53, "index-1"], [82, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [133, "index-13"]], "nxsource (base class)": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [14, "index-1"], [15, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [29, "index-1"], [32, "index-1"], [64, "index-1"], [87, "index-0"], [97, "index-1"], [103, "index-1"], [104, "index-1"]], "nxuser (base class)": [[2, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [53, "index-1"], [88, "index-1"], [91, "index-0"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "archive (application definition)": [[2, "index-0"], [2, "index-0"]], "chemical_formula (field)": [[2, "index-31"], [46, "index-6"], [57, "index-9"], [82, "index-5"], [83, "index-5"], [95, "index-4"]], "collection_description (field)": [[2, "index-7"], [53, "index-9"], [88, "index-9"]], "collection_identifier (field)": [[2, "index-6"], [53, "index-8"], [88, "index-8"], [103, "index-2"], [104, "index-2"]], "collection_time (field)": [[2, "index-12"], [53, "index-24"], [88, "index-20"]], "definition (field)": [[2, "index-15"], [3, "index-5"], [4, "index-8"], [5, "index-4"], [6, "index-4"], [7, "index-4"], [8, "index-4"], [9, "index-2"], [10, "index-4"], [11, "index-7"], [12, "index-5"], [13, "index-5"], [14, "index-6"], [15, "index-5"], [16, "index-5"], [17, "index-3"], [18, "index-4"], [19, "index-5"], [20, "index-4"], [21, "index-4"], [22, "index-4"], [23, "index-4"], [24, "index-5"], [25, "index-5"], [26, "index-3"], [27, "index-5"], [28, "index-4"], [29, "index-4"], [30, "index-4"], [31, "index-2"], [32, "index-2"], [33, "index-2"], [34, "index-2"], [35, "index-2"], [53, "index-14"], [88, "index-11"], [97, "index-5"], [103, "index-4"], [104, "index-4"], [107, "index-14"]], "description (field)": [[2, "index-23"], [2, "index-29"], [4, "index-99"], [11, "index-21"], [37, "index-6"], [40, "index-4"], [43, "index-3"], [49, "index-30"], [54, "index-5"], [57, "index-4"], [60, "index-5"], [62, "index-4"], [65, "index-8"], [66, "index-5"], [70, "index-7"], [78, "index-5"], [82, "index-27"], [83, "index-14"], [95, "index-3"], [98, "index-2"], [99, "index-2"], [101, "index-2"], [102, "index-2"], [103, "index-21"], [103, "index-31"], [103, "index-42"], [103, "index-66"], [103, "index-77"], [103, "index-84"], [103, "index-86"], [104, "index-21"], [104, "index-31"], [104, "index-42"], [104, "index-66"], [104, "index-78"], [104, "index-85"], [104, "index-87"], [105, "index-2"], [108, "index-2"]], "duration (field)": [[2, "index-11"], [22, "index-5"], [23, "index-5"], [53, "index-23"], [65, "index-15"], [88, "index-19"], [103, "index-22"], [103, "index-32"], [103, "index-5"], [104, "index-22"], [104, "index-32"], [104, "index-5"]], "electric_field (field)": [[2, "index-36"], [82, "index-7"]], "end_time (field)": [[2, "index-10"], [11, "index-5"], [12, "index-4"], [13, "index-4"], [14, "index-5"], [16, "index-4"], [19, "index-4"], [24, "index-4"], [25, "index-4"], [53, "index-22"], [68, "index-6"], [88, "index-18"], [97, "index-4"], [103, "index-6"], [104, "index-6"]], "entry_identifier (field)": [[2, "index-8"], [53, "index-10"], [88, "index-10"], [103, "index-7"], [104, "index-7"]], "experiment_description (field)": [[2, "index-5"], [53, "index-7"], [88, "index-7"]], "experiment_identifier (field)": [[2, "index-4"], [53, "index-6"], [88, "index-6"], [103, "index-8"], [104, "index-8"]], "facility_user_id (field)": [[2, "index-21"], [91, "index-10"], [103, "index-99"], [104, "index-100"]], "index (group attribute)": [[2, "index-2"]], "magnetic_field (field)": [[2, "index-35"], [41, "index-6"], [82, "index-9"]], "name (field)": [[2, "index-19"], [2, "index-22"], [2, "index-25"], [2, "index-27"], [3, "index-23"], [3, "index-7"], [4, "index-60"], [4, "index-85"], [4, "index-97"], [6, "index-11"], [6, "index-6"], [8, "index-5"], [8, "index-7"], [8, "index-9"], [9, "index-11"], [10, "index-11"], [10, "index-6"], [11, "index-12"], [11, "index-77"], [11, "index-9"], [12, "index-12"], [12, "index-7"], [13, "index-14"], [13, "index-6"], [14, "index-25"], [14, "index-7"], [14, "index-9"], [15, "index-23"], [15, "index-6"], [15, "index-8"], [17, "index-16"], [18, "index-5"], [18, "index-7"], [18, "index-9"], [19, "index-7"], [20, "index-14"], [20, "index-5"], [21, "index-13"], [21, "index-6"], [22, "index-15"], [22, "index-8"], [23, "index-13"], [23, "index-7"], [24, "index-16"], [24, "index-7"], [25, "index-18"], [25, "index-7"], [26, "index-5"], [26, "index-7"], [27, "index-12"], [27, "index-7"], [28, "index-5"], [29, "index-15"], [29, "index-6"], [54, "index-2"], [64, "index-4"], [78, "index-4"], [82, "index-4"], [83, "index-4"], [84, "index-5"], [87, "index-5"], [91, "index-3"], [95, "index-2"], [97, "index-43"], [97, "index-6"], [103, "index-100"], [103, "index-48"], [103, "index-50"], [103, "index-97"], [104, "index-101"], [104, "index-48"], [104, "index-50"], [104, "index-98"]], "preparation_date (field)": [[2, "index-32"], [82, "index-28"]], "pressure (field)": [[2, "index-38"], [82, "index-13"]], "probe (field)": [[2, "index-26"], [3, "index-8"], [6, "index-7"], [8, "index-8"], [10, "index-7"], [12, "index-8"], [14, "index-10"], [15, "index-9"], [18, "index-8"], [19, "index-8"], [20, "index-6"], [24, "index-8"], [25, "index-8"], [26, "index-6"], [27, "index-8"], [29, "index-7"], [87, "index-8"], [97, "index-8"], [103, "index-51"], [104, "index-51"]], "program (field)": [[2, "index-16"], [8, "index-10"], [18, "index-10"], [26, "index-8"], [28, "index-6"], [54, "index-6"], [79, "index-4"]], "release_date (field)": [[2, "index-18"]], "revision (field)": [[2, "index-14"], [53, "index-29"], [88, "index-25"]], "role (field)": [[2, "index-20"], [91, "index-4"], [103, "index-101"], [104, "index-102"]], "run_cycle (field)": [[2, "index-13"], [53, "index-25"], [88, "index-21"]], "sample_id (field)": [[2, "index-28"]], "situation (field)": [[2, "index-33"], [82, "index-26"]], "start_time (field)": [[2, "index-9"], [3, "index-4"], [5, "index-3"], [6, "index-3"], [7, "index-3"], [10, "index-3"], [11, "index-4"], [12, "index-3"], [13, "index-3"], [14, "index-4"], [15, "index-4"], [16, "index-3"], [19, "index-3"], [20, "index-3"], [21, "index-3"], [22, "index-3"], [23, "index-3"], [24, "index-3"], [25, "index-3"], [27, "index-4"], [29, "index-3"], [49, "index-47"], [53, "index-21"], [68, "index-5"], [88, "index-17"], [97, "index-3"], [103, "index-13"], [104, "index-13"]], "stress_field (field)": [[2, "index-37"], [82, "index-11"]], "temperature (field)": [[2, "index-34"], [3, "index-24"], [4, "index-88"], [11, "index-11"], [17, "index-20"], [29, "index-18"], [46, "index-40"], [57, "index-6"], [67, "index-10"], [82, "index-6"], [103, "index-73"], [104, "index-74"]], "title (field)": [[2, "index-3"], [3, "index-3"], [4, "index-9"], [5, "index-2"], [6, "index-2"], [7, "index-2"], [8, "index-3"], [10, "index-2"], [11, "index-3"], [12, "index-2"], [13, "index-2"], [14, "index-3"], [15, "index-3"], [16, "index-2"], [18, "index-3"], [19, "index-2"], [20, "index-2"], [21, "index-2"], [22, "index-2"], [23, "index-2"], [24, "index-2"], [25, "index-2"], [26, "index-2"], [27, "index-3"], [28, "index-3"], [29, "index-2"], [48, "index-27"], [53, "index-5"], [87, "index-30"], [88, "index-5"], [97, "index-2"], [103, "index-14"], [104, "index-14"], [107, "index-16"]], "type (field)": [[2, "index-24"], [2, "index-30"], [3, "index-6"], [6, "index-5"], [8, "index-6"], [10, "index-5"], [11, "index-48"], [12, "index-6"], [14, "index-8"], [15, "index-7"], [18, "index-6"], [19, "index-6"], [24, "index-6"], [25, "index-6"], [26, "index-4"], [27, "index-6"], [29, "index-5"], [38, "index-5"], [42, "index-4"], [45, "index-4"], [46, "index-5"], [49, "index-45"], [52, "index-4"], [54, "index-4"], [56, "index-4"], [58, "index-4"], [63, "index-4"], [66, "index-4"], [67, "index-5"], [68, "index-12"], [70, "index-5"], [77, "index-4"], [82, "index-25"], [84, "index-9"], [87, "index-7"], [92, "index-4"], [97, "index-9"], [103, "index-52"], [103, "index-74"], [103, "index-82"], [104, "index-52"], [104, "index-75"], [104, "index-83"]], "used in application definition": [[2, "index-1"], [3, "index-1"], [4, "index-2"], [5, "index-1"], [6, "index-1"], [7, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"]], "version (field attribute)": [[2, "index-17"], [17, "index-4"], [53, "index-12"], [53, "index-15"], [53, "index-19"], [53, "index-27"], [88, "index-12"], [88, "index-15"], [88, "index-23"]], "nxarpes": [[3, "index-0"]], "nxarpes (application definition)": [[3, "index-0"]], "nxdata (base class)": [[3, "index-1"], [4, "index-2"], [6, "index-1"], [8, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [17, "index-1"], [18, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [26, "index-1"], [27, "index-1"], [28, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [32, "index-1"], [34, "index-1"], [35, "index-1"], [39, "index-1"], [41, "index-1"], [42, "index-1"], [46, "index-1"], [48, "index-0"], [49, "index-1"], [53, "index-1"], [57, "index-1"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [66, "index-1"], [67, "index-1"], [69, "index-1"], [82, "index-1"], [83, "index-1"], [87, "index-1"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [114, "index-42"], [133, "index-11"], [133, "index-7"]], "nxdetector (base class)": [[3, "index-1"], [4, "index-2"], [6, "index-1"], [9, "index-1"], [10, "index-1"], [11, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [27, "index-1"], [29, "index-1"], [30, "index-3"], [31, "index-1"], [33, "index-1"], [34, "index-1"], [35, "index-1"], [49, "index-0"], [64, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [133, "index-7"]], "nxmonochromator (base class)": [[3, "index-1"], [6, "index-1"], [7, "index-1"], [12, "index-1"], [14, "index-1"], [19, "index-1"], [27, "index-1"], [29, "index-1"], [64, "index-1"], [69, "index-0"]], "acquisition_mode (field)": [[3, "index-12"], [49, "index-59"]], "angles (field)": [[3, "index-18"], [61, "index-4"]], "arpes (application definition)": [[3, "index-0"], [3, "index-0"]], "data (field)": [[3, "index-10"], [6, "index-14"], [6, "index-9"], [8, "index-13"], [9, "index-16"], [9, "index-5"], [10, "index-10"], [11, "index-20"], [11, "index-8"], [12, "index-10"], [12, "index-16"], [13, "index-20"], [13, "index-8"], [14, "index-15"], [15, "index-12"], [15, "index-27"], [16, "index-6"], [16, "index-8"], [17, "index-13"], [18, "index-13"], [19, "index-10"], [19, "index-11"], [19, "index-12"], [19, "index-13"], [19, "index-16"], [19, "index-20"], [20, "index-12"], [20, "index-27"], [21, "index-17"], [21, "index-7"], [22, "index-20"], [22, "index-9"], [23, "index-18"], [23, "index-8"], [24, "index-21"], [24, "index-9"], [25, "index-11"], [25, "index-13"], [25, "index-9"], [26, "index-12"], [27, "index-10"], [27, "index-11"], [27, "index-15"], [28, "index-11"], [29, "index-9"], [32, "index-3"], [48, "index-18"], [49, "index-11"], [62, "index-23"], [68, "index-15"], [70, "index-9"], [97, "index-26"], [97, "index-38"], [103, "index-90"], [104, "index-54"], [104, "index-91"], [107, "index-27"], [107, "index-33"]], "energies (field)": [[3, "index-19"]], "energy (field)": [[3, "index-9"], [5, "index-6"], [5, "index-8"], [6, "index-10"], [7, "index-5"], [17, "index-15"], [17, "index-17"], [19, "index-17"], [19, "index-9"], [27, "index-9"], [28, "index-10"], [56, "index-14"], [63, "index-13"], [69, "index-8"], [87, "index-15"], [97, "index-10"], [97, "index-7"]], "entrance_slit_setting (field)": [[3, "index-14"]], "entrance_slit_shape (field)": [[3, "index-13"]], "entrance_slit_size (field)": [[3, "index-15"]], "entry (group attribute)": [[3, "index-2"], [8, "index-2"], [14, "index-2"], [15, "index-2"], [18, "index-2"], [27, "index-2"], [28, "index-2"]], "lens_mode (field)": [[3, "index-11"]], "pass_energy (field)": [[3, "index-16"]], "region_origin (field)": [[3, "index-21"]], "region_size (field)": [[3, "index-22"]], "sensor_size (field)": [[3, "index-20"]], "time_per_channel (field)": [[3, "index-17"], [11, "index-22"]], "i": [[4, "index-28"]], "i (field)": [[4, "index-27"]], "i_axes (group attribute)": [[4, "index-15"]], "idev": [[4, "index-33"]], "idev (field)": [[4, "index-32"]], "mask_indices (group attribute)": [[4, "index-18"]], "nxaperture (base class)": [[4, "index-2"], [37, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxcansas": [[4, "index-0"]], "nxcansas (application definition)": [[4, "index-0"]], "nxcansas (applications)": [[4, "index-102"], [4, "index-104"], [4, "index-106"], [4, "index-115"], [4, "index-13"], [4, "index-21"], [4, "index-25"], [4, "index-28"], [4, "index-3"], [4, "index-33"], [4, "index-36"], [4, "index-39"], [4, "index-42"], [4, "index-48"], [4, "index-50"], [4, "index-55"], [4, "index-59"], [4, "index-73"], [4, "index-84"], [4, "index-96"]], "nxcollection (base class)": [[4, "index-2"], [11, "index-1"], [17, "index-1"], [44, "index-0"], [49, "index-1"], [53, "index-1"], [64, "index-1"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"]], "nxcollimator (base class)": [[4, "index-2"], [14, "index-1"], [15, "index-1"], [45, "index-0"], [64, "index-1"]], "nxnote (base class)": [[4, "index-2"], [37, "index-1"], [49, "index-1"], [53, "index-1"], [54, "index-1"], [70, "index-0"], [79, "index-1"], [87, "index-1"], [88, "index-1"], [93, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "nxprocess (base class)": [[4, "index-2"], [8, "index-1"], [18, "index-1"], [26, "index-1"], [28, "index-1"], [53, "index-1"], [79, "index-0"], [88, "index-1"]], "q": [[4, "index-21"]], "q (field)": [[4, "index-20"], [107, "index-20"]], "q_indices (group attribute)": [[4, "index-16"]], "qdev": [[4, "index-36"]], "qdev (field)": [[4, "index-35"]], "qmean (field)": [[4, "index-44"]], "sasaperture": [[4, "index-50"]], "sascollimation": [[4, "index-55"]], "sasdata": [[4, "index-13"]], "sasdetector": [[4, "index-59"]], "sasentry": [[4, "index-3"]], "sasinstrument": [[4, "index-48"]], "sasnote": [[4, "index-104"]], "sasprocess": [[4, "index-96"]], "sasprocessnote": [[4, "index-102"]], "sassample": [[4, "index-84"]], "sassource": [[4, "index-73"]], "sastransmission_spectrum": [[4, "index-106"]], "sdd (field)": [[4, "index-61"]], "shadowfactor (field)": [[4, "index-46"]], "t (field)": [[4, "index-112"]], "t_axes (group attribute)": [[4, "index-108"]], "tdev": [[4, "index-115"]], "tdev (field)": [[4, "index-114"]], "beam_center_x (field)": [[4, "index-68"], [11, "index-28"], [14, "index-23"], [15, "index-21"], [35, "index-4"], [49, "index-55"], [97, "index-33"]], "beam_center_y (field)": [[4, "index-69"], [11, "index-29"], [14, "index-24"], [15, "index-22"], [35, "index-5"], [49, "index-56"], [97, "index-35"]], "beam_shape (field)": [[4, "index-76"]], "beam_size_x (field)": [[4, "index-81"]], "beam_size_y (field)": [[4, "index-82"]], "cansas": [[4, "index-1"]], "cansas (application definition)": [[4, "index-0"], [4, "index-0"]], "cansas_class (group attribute)": [[4, "index-101"], [4, "index-103"], [4, "index-105"], [4, "index-12"], [4, "index-47"], [4, "index-49"], [4, "index-54"], [4, "index-58"], [4, "index-6"], [4, "index-72"], [4, "index-83"], [4, "index-95"]], "dql": [[4, "index-42"]], "dql (field)": [[4, "index-41"]], "dqw": [[4, "index-39"]], "dqw (field)": [[4, "index-38"]], "date (field)": [[4, "index-98"], [26, "index-10"], [28, "index-8"], [70, "index-4"], [79, "index-7"], [103, "index-41"], [104, "index-41"], [107, "index-18"]], "default (group attribute)": [[4, "index-4"], [107, "index-12"]], "deprecated": [[4, "index-75"], [11, "index-69"], [37, "index-7"], [40, "index-11"], [41, "index-15"], [45, "index-14"], [46, "index-43"], [49, "index-83"], [52, "index-21"], [53, "index-18"], [56, "index-18"], [57, "index-25"], [60, "index-1"], [62, "index-18"], [63, "index-17"], [65, "index-11"], [66, "index-24"], [67, "index-12"], [68, "index-19"], [69, "index-10"], [69, "index-13"], [69, "index-6"], [82, "index-46"], [82, "index-47"], [82, "index-48"], [84, "index-18"], [87, "index-31"], [92, "index-17"], [103, "index-19"], [103, "index-29"], [104, "index-19"], [104, "index-29"], [107, "index-11"]], "details (field)": [[4, "index-89"]], "distance (field)": [[4, "index-57"], [7, "index-7"], [9, "index-9"], [11, "index-23"], [13, "index-10"], [13, "index-7"], [14, "index-16"], [15, "index-14"], [17, "index-12"], [21, "index-16"], [21, "index-9"], [22, "index-11"], [22, "index-19"], [23, "index-17"], [23, "index-9"], [24, "index-13"], [25, "index-17"], [29, "index-13"], [29, "index-21"], [38, "index-4"], [39, "index-4"], [49, "index-27"], [52, "index-18"], [56, "index-12"], [67, "index-4"], [68, "index-8"], [82, "index-44"], [87, "index-4"], [97, "index-31"], [103, "index-55"], [103, "index-69"], [103, "index-70"], [103, "index-72"], [103, "index-80"], [103, "index-81"], [103, "index-89"], [103, "index-91"], [104, "index-58"], [104, "index-69"], [104, "index-70"], [104, "index-71"], [104, "index-73"], [104, "index-81"], [104, "index-82"], [104, "index-90"], [104, "index-92"]], "incident_wavelength (field)": [[4, "index-77"], [11, "index-67"], [39, "index-8"]], "incident_wavelength_spread (field)": [[4, "index-80"], [11, "index-71"], [39, "index-9"]], "lambda (field)": [[4, "index-111"]], "length (field)": [[4, "index-56"], [63, "index-11"], [92, "index-8"]], "mask (group attribute)": [[4, "index-17"]], "name (field attribute)": [[4, "index-11"]], "name (group attribute)": [[4, "index-109"]], "pitch (field)": [[4, "index-66"], [4, "index-93"]], "plotting": [[4, "index-5"], [37, "index-3"], [38, "index-3"], [39, "index-3"], [40, "index-3"], [41, "index-3"], [42, "index-3"], [43, "index-2"], [45, "index-3"], [46, "index-3"], [47, "index-2"], [48, "index-1"], [48, "index-19"], [48, "index-21"], [48, "index-5"], [48, "index-7"], [48, "index-9"], [49, "index-3"], [50, "index-2"], [51, "index-2"], [52, "index-3"], [53, "index-3"], [55, "index-2"], [56, "index-3"], [57, "index-3"], [58, "index-3"], [59, "index-3"], [60, "index-4"], [61, "index-3"], [62, "index-3"], [63, "index-3"], [64, "index-3"], [65, "index-2"], [66, "index-3"], [67, "index-3"], [68, "index-3"], [69, "index-3"], [70, "index-2"], [72, "index-2"], [73, "index-3"], [74, "index-2"], [76, "index-3"], [77, "index-3"], [78, "index-3"], [79, "index-3"], [80, "index-3"], [81, "index-14"], [82, "index-3"], [83, "index-3"], [84, "index-3"], [85, "index-2"], [86, "index-3"], [87, "index-3"], [88, "index-3"], [89, "index-2"], [90, "index-3"], [91, "index-2"], [92, "index-3"], [93, "index-3"], [107, "index-13"], [107, "index-3"], [114, "index-28"], [114, "index-44"], [116, "index-22"], [116, "index-23"], [116, "index-24"], [116, "index-24"], [116, "index-7"], [116, "index-9"], [127, "index-4"], [133, "index-12"], [133, "index-7"], [134, "index-4"], [137, "index-0"], [137, "index-5"], [151, "index-4"], [154, "index-11"]], "radiation (field)": [[4, "index-74"]], "resolutions": [[4, "index-25"]], "resolutions (field attribute)": [[4, "index-24"]], "resolutions_description (field attribute)": [[4, "index-26"]], "roll (field)": [[4, "index-65"], [4, "index-92"]], "run (field)": [[4, "index-10"]], "scaling_factor (field attribute)": [[4, "index-31"], [65, "index-18"], [65, "index-5"]], "shape (field)": [[4, "index-51"], [14, "index-13"], [15, "index-10"], [85, "index-3"], [103, "index-67"], [103, "index-78"], [103, "index-87"], [104, "index-67"], [104, "index-79"], [104, "index-88"]], "signal (group attribute)": [[4, "index-107"], [4, "index-14"], [49, "index-84"], [62, "index-19"], [97, "index-21"], [97, "index-40"], [107, "index-30"]], "slit_length (field)": [[4, "index-62"]], "term (field)": [[4, "index-100"], [74, "index-3"]], "thickness (field)": [[4, "index-86"], [38, "index-6"], [46, "index-23"], [57, "index-7"], [58, "index-11"], [82, "index-39"]], "timestamp (group attribute)": [[4, "index-110"], [4, "index-19"]], "transmission (field)": [[4, "index-87"]], "uncertainties (field attribute)": [[4, "index-113"], [4, "index-23"], [4, "index-30"]], "units (field attribute)": [[4, "index-22"], [4, "index-29"], [4, "index-34"], [4, "index-37"], [4, "index-40"], [4, "index-43"], [4, "index-45"], [74, "index-4"], [97, "index-11"], [97, "index-13"], [97, "index-15"], [97, "index-17"], [97, "index-19"], [97, "index-23"], [97, "index-28"], [97, "index-30"], [97, "index-32"], [97, "index-34"], [97, "index-36"], [107, "index-26"], [107, "index-35"]], "version (group attribute)": [[4, "index-7"], [11, "index-2"]], "wavelength_max (field)": [[4, "index-79"]], "wavelength_min (field)": [[4, "index-78"]], "x_gap (field)": [[4, "index-52"], [86, "index-5"]], "x_pixel_size (field)": [[4, "index-70"], [9, "index-7"], [13, "index-12"], [14, "index-17"], [15, "index-15"], [24, "index-11"], [25, "index-15"], [29, "index-11"], [49, "index-34"], [97, "index-27"]], "x_position (field)": [[4, "index-63"], [4, "index-90"]], "y_gap (field)": [[4, "index-53"], [86, "index-6"]], "y_pixel_size (field)": [[4, "index-71"], [9, "index-8"], [13, "index-13"], [14, "index-18"], [15, "index-16"], [24, "index-12"], [25, "index-16"], [29, "index-12"], [49, "index-35"], [97, "index-29"]], "y_position (field)": [[4, "index-64"], [4, "index-91"]], "yaw (field)": [[4, "index-67"], [4, "index-94"]], "nxdirecttof": [[5, "index-0"]], "nxdirecttof (application definition)": [[5, "index-0"]], "nxdisk_chopper (base class)": [[5, "index-1"], [13, "index-1"], [52, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxfermi_chopper (base class)": [[5, "index-1"], [17, "index-1"], [56, "index-0"], [64, "index-1"], [104, "index-1"]], "directtof (application definition)": [[5, "index-0"], [5, "index-0"]], "rotation_speed (field)": [[5, "index-5"], [5, "index-7"], [52, "index-5"], [56, "index-5"], [92, "index-5"]], "nxfluo": [[6, "index-0"]], "nxfluo (application definition)": [[6, "index-0"]], "nxmonitor (base class)": [[6, "index-1"], [9, "index-1"], [10, "index-1"], [12, "index-1"], [13, "index-1"], [14, "index-1"], [15, "index-1"], [16, "index-1"], [19, "index-1"], [20, "index-1"], [21, "index-1"], [22, "index-1"], [23, "index-1"], [24, "index-1"], [25, "index-1"], [27, "index-1"], [29, "index-1"], [53, "index-1"], [68, "index-0"], [88, "index-1"], [97, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"], [133, "index-7"]], "fluo (application definition)": [[6, "index-0"], [6, "index-0"]], "mode (field)": [[6, "index-12"], [9, "index-14"], [10, "index-13"], [12, "index-14"], [13, "index-16"], [14, "index-27"], [15, "index-25"], [20, "index-25"], [21, "index-14"], [22, "index-17"], [23, "index-15"], [27, "index-13"], [29, "index-22"], [68, "index-4"], [87, "index-25"], [103, "index-92"], [104, "index-93"], [107, "index-24"]], "preset (field)": [[6, "index-13"], [9, "index-15"], [10, "index-14"], [12, "index-15"], [13, "index-17"], [14, "index-28"], [15, "index-26"], [20, "index-26"], [21, "index-15"], [22, "index-18"], [23, "index-16"], [27, "index-14"], [29, "index-23"], [68, "index-7"], [107, "index-25"]], "wavelength (field)": [[6, "index-8"], [10, "index-8"], [12, "index-9"], [14, "index-11"], [29, "index-8"], [32, "index-4"], [46, "index-19"], [49, "index-88"], [56, "index-13"], [62, "index-25"], [69, "index-4"], [92, "index-14"], [103, "index-83"], [104, "index-84"]], "nxindirecttof": [[7, "index-0"]], "nxindirecttof (application definition)": [[7, "index-0"]], "indirecttof (application definition)": [[7, "index-0"], [7, "index-0"]], "polar_angle (field)": [[7, "index-6"], [9, "index-3"], [10, "index-9"], [12, "index-11"], [13, "index-11"], [14, "index-19"], [15, "index-17"], [20, "index-11"], [20, "index-13"], [20, "index-20"], [21, "index-11"], [22, "index-13"], [23, "index-11"], [30, "index-5"], [31, "index-3"], [34, "index-3"], [35, "index-3"], [46, "index-37"], [49, "index-28"], [80, "index-95"], [103, "index-60"], [104, "index-60"]], "nxiqproc": [[8, "index-0"]], "nxiqproc (application definition)": [[8, "index-0"]], "nxparameters (base class)": [[8, "index-1"], [18, "index-1"], [26, "index-1"], [28, "index-1"], [53, "index-1"], [74, "index-0"], [88, "index-1"]], "filenames (field)": [[8, "index-12"], [18, "index-12"]], "iqproc (application definition)": [[8, "index-0"], [8, "index-0"]], "qx (field)": [[8, "index-16"], [18, "index-14"]], "qy (field)": [[8, "index-17"], [18, "index-15"]], "variable (field)": [[8, "index-14"], [48, "index-11"]], "varied_variable (field attribute)": [[8, "index-15"]], "version (field)": [[8, "index-11"], [18, "index-11"], [26, "index-9"], [28, "index-7"], [79, "index-6"], [103, "index-43"], [104, "index-43"]], "nxlauetof": [[9, "index-0"]], "nxlauetof (application definition)": [[9, "index-0"]], "azimuthal_angle (field)": [[9, "index-4"], [14, "index-20"], [15, "index-18"], [21, "index-12"], [22, "index-14"], [23, "index-12"], [46, "index-38"], [49, "index-29"], [80, "index-97"], [103, "index-53"], [104, "index-53"]], "lauetof (application definition)": [[9, "index-0"], [9, "index-0"]], "orientation_matrix (field)": [[9, "index-12"], [20, "index-24"], [29, "index-16"], [46, "index-18"], [57, "index-17"], [82, "index-20"], [83, "index-10"], [107, "index-45"]], "signal (field attribute)": [[9, "index-6"], [29, "index-10"], [48, "index-20"]], "time_of_flight (field)": [[9, "index-10"], [9, "index-17"], [13, "index-19"], [13, "index-9"], [15, "index-13"], [15, "index-28"], [21, "index-10"], [21, "index-18"], [22, "index-12"], [22, "index-21"], [23, "index-10"], [23, "index-19"], [49, "index-4"], [68, "index-13"], [103, "index-93"], [104, "index-61"], [104, "index-94"]], "unit_cell (field)": [[9, "index-13"], [20, "index-23"], [29, "index-17"], [46, "index-10"], [82, "index-17"]], "nxcrystal (base class)": [[10, "index-1"], [20, "index-1"], [46, "index-0"], [64, "index-1"], [69, "index-1"], [103, "index-1"], [104, "index-1"], [107, "index-1"]], "nxmonopd": [[10, "index-0"]], "nxmonopd (application definition)": [[10, "index-0"]], "integral (field)": [[10, "index-15"], [13, "index-18"], [14, "index-29"], [25, "index-23"], [29, "index-24"], [68, "index-11"]], "monopd (application definition)": [[10, "index-0"], [10, "index-0"]], "rotation_angle (field)": [[10, "index-12"], [12, "index-13"], [13, "index-15"], [14, "index-21"], [15, "index-19"], [16, "index-7"], [17, "index-18"], [19, "index-14"], [20, "index-10"], [20, "index-19"], [20, "index-8"], [24, "index-17"], [25, "index-19"], [30, "index-6"], [31, "index-4"], [34, "index-5"], [35, "index-7"], [82, "index-42"]], "nxattenuator (base class)": [[11, "index-1"], [35, "index-1"], [38, "index-0"], [64, "index-1"], [103, "index-1"], [104, "index-1"]], "nxbeam (base class)": [[11, "index-1"], [39, "index-0"], [64, "index-1"], [82, "index-1"], [95, "index-1"], [97, "index-1"]], "nxdetector_group (base class)": [[11, "index-1"], [50, "index-0"], [64, "index-1"]], "nxdetector_module (base class)": [[11, "index-1"], [49, "index-1"], [51, "index-0"]], "nxmx": [[11, "index-0"]], "nxmx (application definition)": [[11, "index-0"]], "nxtransformations (base class)": [[11, "index-1"], [37, "index-1"], [38, "index-1"], [40, "index-1"], [41, "index-1"], [42, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [56, "index-1"], [57, "index-1"], [58, "index-1"], [59, "index-1"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [64, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [76, "index-1"], [77, "index-1"], [78, "index-1"], [82, "index-1"], [84, "index-1"], [86, "index-1"], [87, "index-1"], [89, "index-0"], [92, "index-1"], [93, "index-1"], [95, "index-1"], [97, "index-1"]], "angular_calibration (field)": [[11, "index-31"], [49, "index-61"]], "angular_calibration_applied (field)": [[11, "index-30"], [49, "index-60"]], "attenuator_transmission (field)": [[11, "index-15"], [35, "index-6"], [38, "index-9"]], "beam_center_derived (field)": [[11, "index-27"]], "bit_depth_readout (field)": [[11, "index-39"], [49, "index-68"]], "count_time (field)": [[11, "index-26"], [49, "index-53"], [68, "index-17"], [107, "index-28"]], "countrate_correction_applied (field)": [[11, "index-38"], [49, "index-67"]], "data_origin (field)": [[11, "index-49"], [51, "index-3"]], "data_size (field)": [[11, "index-50"], [51, "index-4"]], "data_stride (field)": [[11, "index-51"]], "dead_time (field)": [[11, "index-25"], [49, "index-36"]], "depends_on (field attribute)": [[11, "index-56"], [11, "index-61"], [11, "index-66"], [51, "index-10"], [51, "index-17"], [51, "index-24"], [89, "index-8"]], "depends_on (field)": [[11, "index-10"], [11, "index-19"], [37, "index-4"], [38, "index-12"], [40, "index-10"], [41, "index-14"], [42, "index-10"], [45, "index-13"], [46, "index-42"], [49, "index-82"], [52, "index-20"], [56, "index-17"], [57, "index-24"], [58, "index-12"], [59, "index-18"], [61, "index-18"], [62, "index-17"], [63, "index-16"], [66, "index-23"], [67, "index-11"], [68, "index-18"], [69, "index-12"], [76, "index-4"], [77, "index-8"], [78, "index-15"], [82, "index-45"], [84, "index-17"], [86, "index-4"], [87, "index-29"], [92, "index-16"], [93, "index-16"], [100, "index-3"]], "detector_readout_time (field)": [[11, "index-40"], [49, "index-69"]], "distance_derived (field)": [[11, "index-24"]], "end_time_estimated (field)": [[11, "index-6"]], "fast_pixel_direction (field)": [[11, "index-57"], [51, "index-11"]], "flatfield (field)": [[11, "index-33"], [49, "index-63"]], "flatfield_applied (field)": [[11, "index-32"], [49, "index-62"]], "flatfield_error (field)": [[11, "index-34"]], "flatfield_errors (field)": [[11, "index-35"], [49, "index-64"]], "flux (field)": [[11, "index-72"], [39, "index-17"], [87, "index-14"]], "frame_time (field)": [[11, "index-41"], [49, "index-74"]], "gain_setting (field)": [[11, "index-42"], [49, "index-75"]], "group_index (field)": [[11, "index-17"], [50, "index-4"]], "group_names (field)": [[11, "index-16"], [50, "index-3"]], "group_parent (field)": [[11, "index-18"], [50, "index-5"]], "incident_beam_size (field)": [[11, "index-74"]], "incident_polarisation_stokes (field)": [[11, "index-76"]], "incident_wavelength_weight (field)": [[11, "index-68"]], "incident_wavelength_weights (field)": [[11, "index-70"]], "module_offset (field)": [[11, "index-52"], [51, "index-5"]], "mx (application definition)": [[11, "index-0"], [11, "index-0"]], "offset (field attribute)": [[11, "index-55"], [11, "index-60"], [11, "index-65"], [26, "index-14"], [51, "index-15"], [51, "index-22"], [51, "index-8"], [55, "index-6"], [89, "index-6"], [116, "index-31"], [116, "index-34"]], "pixel_mask (field)": [[11, "index-37"], [49, "index-66"]], "pixel_mask_applied (field)": [[11, "index-36"], [49, "index-65"]], "profile (field)": [[11, "index-75"]], "saturation_value (field)": [[11, "index-43"], [49, "index-76"]], "sensor_material (field)": [[11, "index-45"], [49, "index-79"]], "sensor_thickness (field)": [[11, "index-46"], [49, "index-80"]], "short_name (field attribute)": [[11, "index-13"], [11, "index-78"], [64, "index-5"], [87, "index-6"]], "slow_pixel_direction (field)": [[11, "index-62"], [51, "index-18"]], "threshold_energy (field)": [[11, "index-47"], [49, "index-81"]], "time_zone (field)": [[11, "index-14"]], "total_flux (field)": [[11, "index-73"]], "transformation_type (field attribute)": [[11, "index-53"], [11, "index-58"], [11, "index-63"], [51, "index-13"], [51, "index-20"], [51, "index-6"], [89, "index-4"]], "underload_value (field)": [[11, "index-44"], [49, "index-77"]], "vector (field attribute)": [[11, "index-54"], [11, "index-59"], [11, "index-64"], [51, "index-14"], [51, "index-21"], [51, "index-7"], [89, "index-5"], [97, "index-45"], [116, "index-33"]], "nxrefscan": [[12, "index-0"]], "nxrefscan (application definition)": [[12, "index-0"]], "refscan (application definition)": [[12, "index-0"], [12, "index-0"]], "nxreftof": [[13, "index-0"]], "nxreftof (application definition)": [[13, "index-0"]], "reftof (application definition)": [[13, "index-0"], [13, "index-0"]], "nxgeometry (base class)": [[14, "index-1"], [15, "index-1"], [37, "index-1"], [40, "index-1"], [41, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [54, "index-1"], [56, "index-1"], [57, "index-1"], [60, "index-0"], [62, "index-1"], [63, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [73, "index-1"], [82, "index-1"], [84, "index-1"], [87, "index-1"], [90, "index-1"], [92, "index-1"], [103, "index-1"], [104, "index-1"]], "nxsas": [[14, "index-0"], [130, "index-0"]], "nxsas (application definition)": [[14, "index-0"]], "nxshape (base class)": [[14, "index-1"], [15, "index-1"], [46, "index-1"], [60, "index-2"], [61, "index-1"], [66, "index-1"], [85, "index-0"], [95, "index-1"], [103, "index-1"], [104, "index-1"]], "aequatorial_angle (field)": [[14, "index-22"], [14, "index-26"], [15, "index-20"], [15, "index-24"]], "sas (application definition)": [[14, "index-0"], [14, "index-0"]], "size (field)": [[14, "index-14"], [15, "index-11"], [40, "index-5"], [85, "index-4"], [103, "index-68"], [103, "index-79"], [103, "index-88"], [104, "index-68"], [104, "index-80"], [104, "index-89"]], "wavelength_spread (field)": [[14, "index-12"], [92, "index-15"]], "nxsastof": [[15, "index-0"]], "nxsastof (application definition)": [[15, "index-0"]], "sastof (application definition)": [[15, "index-0"], [15, "index-0"]], "nxscan": [[16, "index-0"]], "nxscan (application definition)": [[16, "index-0"]], "scan (application definition)": [[16, "index-0"], [16, "index-0"]], "nxspe": [[17, "index-0"]], "nxspe (application definition)": [[17, "index-0"]], "azimuthal (field)": [[17, "index-8"]], "azimuthal_width (field)": [[17, "index-9"]], "error (field)": [[17, "index-14"]], "fixed_energy (field)": [[17, "index-5"]], "ki_over_kf_scaling (field)": [[17, "index-6"]], "polar (field)": [[17, "index-10"]], "polar_width (field)": [[17, "index-11"]], "program_name (field)": [[17, "index-2"], [53, "index-26"], [88, "index-22"]], "psi (field)": [[17, "index-7"]], "seblock (field)": [[17, "index-19"]], "spe (application definition)": [[17, "index-0"], [17, "index-0"]], "nxsqom": [[18, "index-0"]], "nxsqom (application definition)": [[18, "index-0"]], "en (field)": [[18, "index-17"], [20, "index-18"]], "qz (field)": [[18, "index-16"]], "sqom (application definition)": [[18, "index-0"], [18, "index-0"]], "nxstxm": [[19, "index-0"]], "nxstxm (application definition)": [[19, "index-0"]], "sample_x (field)": [[19, "index-19"]], "sample_y (field)": [[19, "index-18"]], "stxm (application definition)": [[19, "index-0"], [19, "index-0"]], "stxm_scan_type (field)": [[19, "index-15"]], "nxtas": [[20, "index-0"]], "nxtas (application definition)": [[20, "index-0"]], "ef (field)": [[20, "index-9"]], "ei (field)": [[20, "index-7"]], "qh (field)": [[20, "index-15"]], "qk (field)": [[20, "index-16"]], "ql (field)": [[20, "index-17"]], "sgl (field)": [[20, "index-22"]], "sgu (field)": [[20, "index-21"]], "tas (application definition)": [[20, "index-0"], [20, "index-0"]], "nxtofnpd": [[21, "index-0"]], "nxtofnpd (application definition)": [[21, "index-0"]], "detector_number (field)": [[21, "index-8"], [22, "index-10"], [47, "index-5"], [49, "index-10"]], "pre_sample_flightpath (field)": [[21, "index-5"], [22, "index-7"], [23, "index-6"], [53, "index-31"], [88, "index-27"]], "tofnpd (application definition)": [[21, "index-0"], [21, "index-0"]], "nxtofraw": [[22, "index-0"]], "nxtofraw (application definition)": [[22, "index-0"]], "integral_counts (field)": [[22, "index-22"]], "nature (field)": [[22, "index-16"], [23, "index-14"], [103, "index-98"], [104, "index-99"]], "run_number (field)": [[22, "index-6"], [103, "index-12"], [104, "index-12"]], "tofraw (application definition)": [[22, "index-0"], [22, "index-0"]], "nxtofsingle": [[23, "index-0"]], "nxtofsingle (application definition)": [[23, "index-0"]], "tofsingle (application definition)": [[23, "index-0"], [23, "index-0"]], "nxtomo": [[24, "index-0"]], "nxtomo (application definition)": [[24, "index-0"]], "image_key (field)": [[24, "index-10"]], "tomo (application definition)": [[24, "index-0"], [24, "index-0"]], "x_rotation_axis_pixel_position (field)": [[24, "index-14"]], "x_translation (field)": [[24, "index-18"], [25, "index-20"], [29, "index-19"], [82, "index-43"]], "y_rotation_axis_pixel_position (field)": [[24, "index-15"]], "y_translation (field)": [[24, "index-19"], [25, "index-21"], [29, "index-20"]], "z_translation (field)": [[24, "index-20"], [25, "index-22"]], "nxtomophase": [[25, "index-0"]], "nxtomophase (application definition)": [[25, "index-0"]], "sequence_number (field)": [[25, "index-10"], [25, "index-12"], [25, "index-14"], [49, "index-54"]], "tomophase (application definition)": [[25, "index-0"], [25, "index-0"]], "nxtomoproc": [[26, "index-0"]], "nxtomoproc (application definition)": [[26, "index-0"]], "raw_file (field)": [[26, "index-11"], [28, "index-9"]], "scaling (field attribute)": [[26, "index-15"]], "tomoproc (application definition)": [[26, "index-0"], [26, "index-0"]], "transform (field attribute)": [[26, "index-13"]], "x (field)": [[26, "index-16"], [40, "index-6"], [48, "index-28"]], "y (field)": [[26, "index-17"], [40, "index-7"], [48, "index-29"]], "z (field)": [[26, "index-18"], [48, "index-30"]], "nxxas": [[27, "index-0"]], "nxxas (application definition)": [[27, "index-0"]], "xas (application definition)": [[27, "index-0"], [27, "index-0"]], "nxxasproc": [[28, "index-0"]], "nxxasproc (application definition)": [[28, "index-0"]], "xasproc (application definition)": [[28, "index-0"], [28, "index-0"]], "nxxbase": [[29, "index-0"]], "nxxbase (application definition)": [[29, "index-0"]], "frame_start_number (field)": [[29, "index-14"], [49, "index-57"]], "xbase (application definition)": [[29, "index-0"], [29, "index-0"]], "nxxeuler": [[30, "index-0"]], "nxxeuler (application definition)": [[30, "index-0"]], "chi (field)": [[30, "index-7"]], "eulerian cradle": [[30, "index-2"], [36, "index-2"], [116, "index-36"]], "four-circle diffractometer": [[30, "index-1"], [36, "index-1"], [116, "index-37"], [151, "index-5"]], "phi (field)": [[30, "index-8"], [31, "index-6"]], "xeuler (application definition)": [[30, "index-0"], [30, "index-0"]], "nxxkappa": [[31, "index-0"]], "nxxkappa (application definition)": [[31, "index-0"]], "alpha (field)": [[31, "index-7"]], "kappa (field)": [[31, "index-5"]], "xkappa (application definition)": [[31, "index-0"], [31, "index-0"]], "nxxlaue": [[32, "index-0"]], "nxxlaue (application definition)": [[32, "index-0"]], "xlaue (application definition)": [[32, "index-0"], [32, "index-0"]], "nxxlaueplate": [[33, "index-0"]], "nxxlaueplate (application definition)": [[33, "index-0"]], "diameter (field)": [[33, "index-3"], [49, "index-58"], [76, "index-5"]], "xlaueplate (application definition)": [[33, "index-0"], [33, "index-0"]], "nxxnb": [[34, "index-0"]], "nxxnb (application definition)": [[34, "index-0"]], "tilt_angle (field)": [[34, "index-4"]], "xnb (application definition)": [[34, "index-0"], [34, "index-0"]], "nxxrot": [[35, "index-0"]], "nxxrot (application definition)": [[35, "index-0"]], "rotation_angle_step (field)": [[35, "index-8"]], "xrot (application definition)": [[35, "index-0"], [35, "index-0"]], "application definition": [[36, "index-0"]], "class definitions": [[36, "index-0"], [94, "index-0"], [109, "index-0"], [110, "index-0"]], "nxaperture": [[37, "index-0"]], "aperture (base class)": [[37, "index-0"], [37, "index-0"]], "default (file attribute)": [[37, "index-2"], [38, "index-2"], [39, "index-2"], [40, "index-2"], [41, "index-2"], [42, "index-2"], [43, "index-1"], [45, "index-2"], [46, "index-2"], [47, "index-1"], [49, "index-2"], [50, "index-1"], [51, "index-1"], [52, "index-2"], [53, "index-2"], [55, "index-1"], [56, "index-2"], [57, "index-2"], [58, "index-2"], [59, "index-2"], [60, "index-3"], [61, "index-2"], [62, "index-2"], [63, "index-2"], [64, "index-2"], [65, "index-1"], [66, "index-2"], [67, "index-2"], [68, "index-2"], [69, "index-2"], [70, "index-1"], [72, "index-1"], [73, "index-2"], [74, "index-1"], [76, "index-2"], [77, "index-2"], [78, "index-2"], [79, "index-2"], [80, "index-2"], [81, "index-13"], [82, "index-2"], [83, "index-2"], [84, "index-2"], [85, "index-1"], [86, "index-2"], [87, "index-2"], [88, "index-2"], [89, "index-1"], [90, "index-2"], [91, "index-1"], [92, "index-2"], [93, "index-2"], [107, "index-2"]], "material (field)": [[37, "index-5"]], "used in base class": [[37, "index-1"], [38, "index-1"], [39, "index-1"], [40, "index-1"], [41, "index-1"], [42, "index-1"], [45, "index-1"], [46, "index-1"], [49, "index-1"], [52, "index-1"], [53, "index-1"], [54, "index-1"], [56, "index-1"], [57, "index-1"], [58, "index-1"], [59, "index-1"], [60, "index-2"], [61, "index-1"], [62, "index-1"], [63, "index-1"], [64, "index-1"], [66, "index-1"], [67, "index-1"], [68, "index-1"], [69, "index-1"], [73, "index-1"], [76, "index-1"], [77, "index-1"], [78, "index-1"], [79, "index-1"], [81, "index-1"], [82, "index-1"], [83, "index-1"], [84, "index-1"], [86, "index-1"], [87, "index-1"], [88, "index-1"], [90, "index-1"], [92, "index-1"], [93, "index-1"]], "nxattenuator": [[38, "index-0"]], "nxoff_geometry (base class)": [[38, "index-1"], [49, "index-1"], [72, "index-0"], [106, "index-1"]], "absorption_cross_section (field)": [[38, "index-8"]], "attenuator (base class)": [[38, "index-0"], [38, "index-0"]], "scattering_cross_section (field)": [[38, "index-7"]], "status (field)": [[38, "index-10"], [40, "index-9"], [57, "index-5"]], "time (field attribute)": [[38, "index-11"], [87, "index-28"]], "nxbeam": [[39, "index-0"]], "beam (base class)": [[39, "index-0"], [39, "index-0"]], "energy_transfer (field)": [[39, "index-7"]], "extent (field)": [[39, "index-11"], [97, "index-12"]], "final_beam_divergence (field)": [[39, "index-16"]], "final_energy (field)": [[39, "index-6"]], "final_polarization (field)": [[39, "index-14"]], "final_wavelength (field)": [[39, "index-12"]], "final_wavelength_spread (field)": [[39, "index-15"]], "incident_beam_divergence (field)": [[39, "index-10"], [97, "index-14"]], "incident_energy (field)": [[39, "index-5"]], "incident_polarization (field)": [[39, "index-13"]], "nxbeam_stop": [[40, "index-0"]], "nxbeam_stop (base class)": [[40, "index-0"], [64, "index-1"]], "beam_stop (base class)": [[40, "index-0"], [40, "index-0"]], "distance_to_detector (field)": [[40, "index-8"]], "nxbending_magnet": [[41, "index-0"]], "nxbending_magnet (base class)": [[41, "index-0"], [64, "index-1"]], "accepted_photon_beam_divergence (field)": [[41, "index-7"]], "bending_magnet (base class)": [[41, "index-0"], [41, "index-0"]], "bending_radius (field)": [[41, "index-5"]], "critical_energy (field)": [[41, "index-4"]], "divergence_x_minus (field)": [[41, "index-11"]], "divergence_x_plus (field)": [[41, "index-10"]], "divergence_y_minus (field)": [[41, "index-13"]], "divergence_y_plus (field)": [[41, "index-12"]], "source_distance_x (field)": [[41, "index-8"]], "source_distance_y (field)": [[41, "index-9"]], "nxcapillary": [[42, "index-0"]], "nxcapillary (base class)": [[42, "index-0"], [64, "index-1"]], "accepting_aperture (field)": [[42, "index-7"]], "capillary (base class)": [[42, "index-0"], [42, "index-0"]], "focal_size (field)": [[42, "index-9"]], "manufacturer (field)": [[42, "index-5"]], "maximum_incident_angle (field)": [[42, "index-6"]], "working_distance (field)": [[42, "index-8"]], "nxcite": [[43, "index-0"]], "nxcite (base class)": [[43, "index-0"]], "bibtex (field)": [[43, "index-7"]], "cite (base class)": [[43, "index-0"], [43, "index-0"]], "doi (field)": [[43, "index-5"]], "endnote (field)": [[43, "index-6"]], "url (field)": [[43, "index-4"]], "nxcollection": [[44, "index-0"]], "collection (base class)": [[44, "index-0"], [44, "index-0"]], "nxcollimator": [[45, "index-0"]], "nxlog (base class)": [[45, "index-1"], [46, "index-1"], [57, "index-1"], [65, "index-0"], [67, "index-1"], [68, "index-1"], [82, "index-1"], [84, "index-1"], [98, "index-1"], [99, "index-1"], [101, "index-1"], [102, "index-1"], [103, "index-1"], [104, "index-1"], [105, "index-1"], [108, "index-1"]], "absorbing_material (field)": [[45, "index-11"], [56, "index-15"]], "blade_spacing (field)": [[45, "index-10"]], "blade_thickness (field)": [[45, "index-9"]], "collimator (base class)": [[45, "index-0"], [45, "index-0"]], "divergence_x (field)": [[45, "index-6"]], "divergence_y (field)": [[45, "index-7"]], "frequency (field)": [[45, "index-8"], [87, "index-18"], [103, "index-49"], [104, "index-49"]], "soller_angle (field)": [[45, "index-5"]], "transmitting_material (field)": [[45, "index-12"], [56, "index-16"]], "nxcrystal": [[46, "index-0"]], "bragg_angle (field)": [[46, "index-39"]], "crystal (base class)": [[46, "index-0"], [46, "index-0"]], "curvature_horizontal (field)": [[46, "index-33"]], "curvature_vertical (field)": [[46, "index-34"]], "cut_angle (field)": [[46, "index-8"]], "cylindrical_orientation_angle (field)": [[46, "index-36"]], "d_spacing (field)": [[46, "index-20"]], "density (field)": [[46, "index-24"], [57, "index-8"], [82, "index-23"], [83, "index-12"], [95, "index-5"]], "is_cylindrical (field)": [[46, "index-35"]], "mosaic_horizontal (field)": [[46, "index-31"]], "mosaic_vertical (field)": [[46, "index-32"]], "order_no (field)": [[46, "index-7"]], "reflection (field)": [[46, "index-22"], [77, "index-6"]], "scattering_vector (field)": [[46, "index-21"]], "segment_columns (field)": [[46, "index-29"]], "segment_gap (field)": [[46, "index-28"]], "segment_height (field)": [[46, "index-26"]], "segment_rows (field)": [[46, "index-30"]], "segment_thickness (field)": [[46, "index-27"]], "segment_width (field)": [[46, "index-25"]], "space_group (field)": [[46, "index-9"], [82, "index-35"], [83, "index-18"]], "temperature_coefficient (field)": [[46, "index-41"]], "unit_cell_a (field)": [[46, "index-11"], [57, "index-10"]], "unit_cell_alpha (field)": [[46, "index-14"], [57, "index-13"]], "unit_cell_b (field)": [[46, "index-12"], [57, "index-11"]], "unit_cell_beta (field)": [[46, "index-15"], [57, "index-14"]], "unit_cell_c (field)": [[46, "index-13"], [57, "index-12"]], "unit_cell_gamma (field)": [[46, "index-16"], [57, "index-15"]], "unit_cell_volume (field)": [[46, "index-17"], [57, "index-16"], [82, "index-18"], [83, "index-8"]], "usage (field)": [[46, "index-4"]], "nxcylindrical_geometry": [[47, "index-0"]], "nxcylindrical_geometry (base class)": [[47, "index-0"], [49, "index-1"]], "cylinders (field)": [[47, "index-4"]], "cylindrical_geometry (base class)": [[47, "index-0"], [47, "index-0"]], "vertices (field)": [[47, "index-3"], [72, "index-3"]], "axisname_indices (file attribute)": [[48, "index-10"]], "nxdata": [[48, "index-0"]], "variable_errors (field)": [[48, "index-17"]], "auxiliary_signals (file attribute)": [[48, "index-4"]], "axes (attribute)": [[48, "index-3"], [114, "index-38"]], "axes (field attribute)": [[48, "index-22"], [97, "index-24"]], "axes (file attribute)": [[48, "index-8"]], "axis (field attribute)": [[48, "index-16"], [49, "index-16"], [49, "index-20"], [49, "index-24"], [49, "index-5"]], "data (base class)": [[48, "index-0"], [48, "index-0"]], "distribution (field attribute)": [[48, "index-13"]], "errors (field)": [[48, "index-24"]], "first_good (field attribute)": [[48, "index-14"]], "last_good (field attribute)": [[48, "index-15"]], "link": [[48, "index-2"], [110, "index-1"], [114, "index-36"], [116, "index-14"], [116, "index-16"], [116, "index-17"], [127, "index-6"], [133, "index-7"]], "long_name (field attribute)": [[48, "index-12"], [48, "index-23"], [49, "index-12"], [49, "index-18"], [49, "index-22"], [49, "index-26"], [49, "index-7"]], "offset (field)": [[48, "index-26"]], "scaling_factor (field)": [[48, "index-25"]], "signal (file attribute)": [[48, "index-6"]], "nxdetector": [[49, "index-0"]], "axes (group attribute)": [[49, "index-85"], [62, "index-20"], [97, "index-20"], [97, "index-39"], [107, "index-31"]], "calibration_date (field)": [[49, "index-51"]], "check_sum (field attribute)": [[49, "index-13"]], "crate (field)": [[49, "index-39"]], "data_errors (field)": [[49, "index-14"]], "detection_gas_path (field)": [[49, "index-38"]], "detector (base class)": [[49, "index-0"], [49, "index-0"]], "efficiency (field)": [[49, "index-87"], [68, "index-14"], [77, "index-7"]], "frequency (field attribute)": [[49, "index-9"]], "gas_pressure (field)": [[49, "index-37"], [93, "index-15"]], "input (field)": [[49, "index-43"]], "layout (field)": [[49, "index-52"]], "local_name (field attribute)": [[49, "index-40"], [49, "index-42"], [49, "index-44"]], "local_name (field)": [[49, "index-32"]], "number_of_cycles (field)": [[49, "index-78"]], "primary (field attribute)": [[49, "index-17"], [49, "index-21"], [49, "index-25"], [49, "index-6"]], "raw_time_of_flight (field)": [[49, "index-8"]], "real_time (field)": [[49, "index-46"]], "serial_number (field)": [[49, "index-31"]], "slot (field)": [[49, "index-41"]], "solid_angle (field)": [[49, "index-33"]], "start (field attribute)": [[49, "index-48"], [49, "index-50"], [52, "index-11"], [55, "index-10"], [65, "index-17"], [65, "index-4"]], "stop_time (field)": [[49, "index-49"]], "trigger_dead_time (field)": [[49, "index-73"]], "trigger_delay_time (field)": [[49, "index-70"]], "trigger_delay_time_set (field)": [[49, "index-71"]], "trigger_internal_delay_time (field)": [[49, "index-72"]], "wavelength_indices (group attribute)": [[49, "index-86"], [62, "index-22"]], "x_pixel_offset (field)": [[49, "index-15"], [103, "index-63"], [103, "index-75"], [104, "index-63"], [104, "index-76"]], "y_pixel_offset (field)": [[49, "index-19"], [103, "index-64"], [104, "index-64"]], "z_pixel_offset (field)": [[49, "index-23"]], "nxdetector_group": [[50, "index-0"]], "detector_group (base class)": [[50, "index-0"], [50, "index-0"]], "group_type (field)": [[50, "index-6"]], "nxdetector_module": [[51, "index-0"]], "detector_module (base class)": [[51, "index-0"], [51, "index-0"]], "dimension": [[51, "index-12"], [51, "index-19"], [114, "index-10"], [114, "index-11"], [114, "index-34"], [114, "index-35"], [114, "index-37"], [114, "index-39"], [114, "index-41"], [114, "index-43"], [114, "index-45"], [114, "index-8"], [114, "index-9"], [116, "index-11"]], "fastest varying": [[51, "index-12"], [114, "index-10"], [114, "index-41"]], "offset_units (field attribute)": [[51, "index-16"], [51, "index-23"], [51, "index-9"], [89, "index-7"]], "slowest varying": [[51, "index-19"], [114, "index-9"]], "nxdisk_chopper": [[52, "index-0"]], "beam_position (field)": [[52, "index-12"]], "delay (field)": [[52, "index-16"]], "disk_chopper (base class)": [[52, "index-0"], [52, "index-0"]], "pair_separation (field)": [[52, "index-8"]], "phase (field)": [[52, "index-15"], [63, "index-7"]], "radius (field)": [[52, "index-13"], [56, "index-6"], [92, "index-6"]], "ratio (field)": [[52, "index-17"]], "slit_angle (field)": [[52, "index-7"]], "slit_edges (field)": [[52, "index-9"]], "slit_height (field)": [[52, "index-14"]], "slits (field)": [[52, "index-6"]], "top_dead_center (field)": [[52, "index-10"]], "wavelength_range (field)": [[52, "index-19"]], "idf_version (file attribute)": [[53, "index-4"], [88, "index-4"]], "nxentry": [[53, "index-0"]], "nxsubentry (base class)": [[53, "index-1"], [88, "index-0"]], "url (field attribute)": [[53, "index-16"], [53, "index-20"], [88, "index-13"], [88, "index-16"]], "comment (field attribute)": [[53, "index-30"], [88, "index-26"]], "configuration (field attribute)": [[53, "index-28"], [88, "index-24"]], "definition_local (field)": [[53, "index-17"], [88, "index-14"]], "entry (base class)": [[53, "index-0"], [53, "index-0"]], "entry_identifier_uuid (field)": [[53, "index-11"]], "features (field)": [[53, "index-13"]], "type (group attribute)": [[53, "index-32"]], "nxenvironment": [[54, "index-0"]], "nxenvironment (base class)": [[54, "index-0"], [82, "index-1"]], "nxsensor (base class)": [[54, "index-1"], [57, "index-1"], [84, "index-0"]], "environment (base class)": [[54, "index-0"], [54, "index-0"]], "short_name (field)": [[54, "index-3"], [84, "index-6"]], "nxevent_data": [[55, "index-0"]], "nxevent_data (base class)": [[55, "index-0"], [64, "index-1"], [103, "index-1"]], "cue_index (field)": [[55, "index-11"], [65, "index-19"]], "cue_timestamp_zero (field)": [[55, "index-9"], [65, "index-16"]], "event_data (base class)": [[55, "index-0"], [55, "index-0"]], "event_id (field)": [[55, "index-4"]], "event_index (field)": [[55, "index-7"], [103, "index-56"]], "event_time_offset (field)": [[55, "index-3"]], "event_time_zero (field)": [[55, "index-5"]], "pulse_height (field)": [[55, "index-8"]], "nxfermi_chopper": [[56, "index-0"]], "fermi_chopper (base class)": [[56, "index-0"], [56, "index-0"]], "height (field)": [[56, "index-10"], [92, "index-12"]], "number (field)": [[56, "index-9"]], "r_slit (field)": [[56, "index-8"]], "slit (field)": [[56, "index-7"]], "width (field)": [[56, "index-11"], [92, "index-13"]], "nxfilter": [[57, "index-0"]], "nxfilter (base class)": [[57, "index-0"], [64, "index-1"]], "coating_material (field)": [[57, "index-21"], [61, "index-14"], [62, "index-13"], [66, "index-15"]], "coating_roughness (field)": [[57, "index-23"], [61, "index-16"], [62, "index-15"], [66, "index-17"]], "filter (base class)": [[57, "index-0"], [57, "index-0"]], "m_value (field)": [[57, "index-18"], [62, "index-10"], [66, "index-11"]], "substrate_material (field)": [[57, "index-19"], [61, "index-11"], [62, "index-11"], [66, "index-12"]], "substrate_roughness (field)": [[57, "index-22"], [61, "index-15"], [62, "index-14"], [66, "index-16"]], "substrate_thickness (field)": [[57, "index-20"], [61, "index-13"], [62, "index-12"], [66, "index-14"]], "nxflipper": [[58, "index-0"]], "nxflipper (base class)": [[58, "index-0"], [64, "index-1"]], "comp_current (field)": [[58, "index-9"]], "comp_turns (field)": [[58, "index-6"]], "flip_current (field)": [[58, "index-8"]], "flip_turns (field)": [[58, "index-5"]], "flipper (base class)": [[58, "index-0"], [58, "index-0"]], "guide_current (field)": [[58, "index-10"]], "guide_turns (field)": [[58, "index-7"]], "nxfresnel_zone_plate": [[59, "index-0"]], "nxfresnel_zone_plate (base class)": [[59, "index-0"]], "central_stop_diameter (field)": [[59, "index-7"]], "central_stop_material (field)": [[59, "index-12"]], "central_stop_thickness (field)": [[59, "index-13"]], "fabrication (field)": [[59, "index-8"]], "focus_parameters (field)": [[59, "index-4"]], "fresnel_zone_plate (base class)": [[59, "index-0"], [59, "index-0"]], "mask_material (field)": [[59, "index-15"]], "mask_thickness (field)": [[59, "index-14"]], "outer_diameter (field)": [[59, "index-5"]], "outermost_zone_width (field)": [[59, "index-6"]], "support_membrane_material (field)": [[59, "index-16"]], "support_membrane_thickness (field)": [[59, "index-17"]], "zone_height (field)": [[59, "index-9"]], "zone_material (field)": [[59, "index-10"]], "zone_support_material (field)": [[59, "index-11"]], "nxgeometry": [[60, "index-0"]], "nxorientation (base class)": [[60, "index-2"], [73, "index-0"], [84, "index-1"], [103, "index-1"], [104, "index-1"]], "nxtranslation (base class)": [[60, "index-2"], [90, "index-0"], [103, "index-1"], [104, "index-1"]], "component_index (field)": [[60, "index-6"]], "geometry (base class)": [[60, "index-0"], [60, "index-0"]], "nxgrating": [[61, "index-0"]], "nxgrating (base class)": [[61, "index-0"], [69, "index-1"]], "deflection_angle (field)": [[61, "index-9"]], "depth (field)": [[61, "index-7"]], "diffraction_order (field)": [[61, "index-8"]], "duty_cycle (field)": [[61, "index-6"]], "grating (base class)": [[61, "index-0"], [61, "index-0"]], "interior_atmosphere (field)": [[61, "index-10"], [62, "index-8"], [66, "index-9"]], "layer_thickness (field)": [[61, "index-17"], [66, "index-22"]], "period (field)": [[61, "index-5"], [87, "index-19"]], "substrate_density (field)": [[61, "index-12"], [66, "index-13"]], "nxguide": [[62, "index-0"]], "nxguide (base class)": [[62, "index-0"], [64, "index-1"]], "bend_angle_x (field)": [[62, "index-6"], [66, "index-7"]], "bend_angle_y (field)": [[62, "index-7"], [66, "index-8"]], "external_material (field)": [[62, "index-9"], [66, "index-10"]], "guide (base class)": [[62, "index-0"], [62, "index-0"]], "incident_angle (field)": [[62, "index-5"], [66, "index-6"]], "number_sections (field)": [[62, "index-16"]], "surface (field)": [[62, "index-24"]], "surface_indices (group attribute)": [[62, "index-21"]], "nxinsertion_device": [[63, "index-0"]], "nxinsertion_device (base class)": [[63, "index-0"], [64, "index-1"]], "bandwidth (field)": [[63, "index-14"]], "gap (field)": [[63, "index-5"]], "harmonic (field)": [[63, "index-15"]], "insertion_device (base class)": [[63, "index-0"], [63, "index-0"]], "k (field)": [[63, "index-10"], [80, "index-7"]], "magnetic_wavelength (field)": [[63, "index-9"]], "poles (field)": [[63, "index-8"]], "power (field)": [[63, "index-12"], [87, "index-9"]], "taper (field)": [[63, "index-6"]], "nxinstrument": [[64, "index-0"]], "nxmirror (base class)": [[64, "index-1"], [66, "index-0"]], "nxmoderator (base class)": [[64, "index-1"], [67, "index-0"], [103, "index-1"], [104, "index-1"]], "nxpolarizer (base class)": [[64, "index-1"], [77, "index-0"], [103, "index-1"], [104, "index-1"]], "nxpositioner (base class)": [[64, "index-1"], [78, "index-0"], [82, "index-1"], [103, "index-1"], [104, "index-1"]], "nxvelocity_selector (base class)": [[64, "index-1"], [69, "index-1"], [92, "index-0"]], "nxxraylens (base class)": [[64, "index-1"], [93, "index-0"]], "instrument (base class)": [[64, "index-0"], [64, "index-0"]], "nxlog": [[65, "index-0"]], "average_value (field)": [[65, "index-9"], [103, "index-17"], [103, "index-27"], [104, "index-17"], [104, "index-27"]], "average_value_error (field)": [[65, "index-10"], [103, "index-18"], [103, "index-28"], [104, "index-18"], [104, "index-28"]], "average_value_errors (field)": [[65, "index-12"], [103, "index-20"], [103, "index-30"], [104, "index-20"], [104, "index-30"]], "log (base class)": [[65, "index-0"], [65, "index-0"]], "maximum_value (field)": [[65, "index-14"], [103, "index-23"], [103, "index-33"], [104, "index-23"], [104, "index-33"]], "minimum_value (field)": [[65, "index-13"], [103, "index-24"], [103, "index-34"], [104, "index-24"], [104, "index-34"]], "raw_value (field)": [[65, "index-7"], [78, "index-7"]], "time (field)": [[65, "index-3"], [103, "index-25"], [103, "index-35"], [104, "index-25"], [104, "index-35"]], "value (field)": [[65, "index-6"], [73, "index-4"], [78, "index-6"], [84, "index-13"], [98, "index-8"], [98, "index-9"], [99, "index-8"], [99, "index-9"], [101, "index-5"], [101, "index-6"], [102, "index-6"], [102, "index-7"], [102, "index-8"], [102, "index-9"], [103, "index-26"], [103, "index-36"], [103, "index-65"], [103, "index-76"], [103, "index-85"], [104, "index-26"], [104, "index-36"], [104, "index-65"], [104, "index-77"], [104, "index-86"], [105, "index-5"], [105, "index-6"], [108, "index-6"], [108, "index-7"], [108, "index-8"], [108, "index-9"]], "nxmirror": [[66, "index-0"]], "even_layer_density (field)": [[66, "index-19"]], "even_layer_material (field)": [[66, "index-18"]], "mirror (base class)": [[66, "index-0"], [66, "index-0"]], "odd_layer_density (field)": [[66, "index-21"]], "odd_layer_material (field)": [[66, "index-20"]], "nxmoderator": [[67, "index-0"]], "coupled (field)": [[67, "index-7"]], "coupling_material (field)": [[67, "index-8"], [103, "index-71"], [104, "index-72"]], "moderator (base class)": [[67, "index-0"], [67, "index-0"]], "poison_depth (field)": [[67, "index-6"]], "poison_material (field)": [[67, "index-9"]], "nxmonitor": [[68, "index-0"]], "monitor (base class)": [[68, "index-0"], [68, "index-0"]], "nominal (field)": [[68, "index-10"]], "range (field)": [[68, "index-9"]], "sampled_fraction (field)": [[68, "index-16"]], "nxmonochromator": [[69, "index-0"]], "energy_error (field)": [[69, "index-9"]], "energy_errors (field)": [[69, "index-11"]], "monochromator (base class)": [[69, "index-0"], [69, "index-0"]], "wavelength_error (field)": [[69, "index-5"]], "wavelength_errors (field)": [[69, "index-7"]], "nxnote": [[70, "index-0"]], "author (field)": [[70, "index-3"], [103, "index-39"], [104, "index-39"]], "file_name (field)": [[70, "index-6"]], "note (base class)": [[70, "index-0"], [70, "index-0"]], "sequence_index (field)": [[70, "index-8"], [79, "index-5"]], "nxobject": [[71, "index-0"]], "nxobject (base class)": [[71, "index-0"]], "object (base class)": [[71, "index-0"], [71, "index-0"]], "nxoff_geometry": [[72, "index-0"]], "detector_faces (field)": [[72, "index-6"]], "faces (field)": [[72, "index-5"]], "off_geometry (base class)": [[72, "index-0"], [72, "index-0"]], "winding_order (field)": [[72, "index-4"]], "nxorientation": [[73, "index-0"]], "orientation (base class)": [[73, "index-0"], [73, "index-0"]], "nxparameters": [[74, "index-0"]], "parameters (base class)": [[74, "index-0"], [74, "index-0"]], "nxpdb": [[75, "index-0"]], "nxpdb (base class)": [[75, "index-0"]], "pdb (base class)": [[75, "index-0"], [75, "index-0"]], "nxpinhole": [[76, "index-0"]], "nxpinhole (base class)": [[76, "index-0"]], "pinhole (base class)": [[76, "index-0"], [76, "index-0"]], "nxpolarizer": [[77, "index-0"]], "composition (field)": [[77, "index-5"]], "polarizer (base class)": [[77, "index-0"], [77, "index-0"]], "nxpositioner": [[78, "index-0"]], "acceleration_time (field)": [[78, "index-13"]], "controller_record (field)": [[78, "index-14"]], "positioner (base class)": [[78, "index-0"], [78, "index-0"]], "soft_limit_max (field)": [[78, "index-11"]], "soft_limit_min (field)": [[78, "index-10"]], "target_value (field)": [[78, "index-8"]], "tolerance (field)": [[78, "index-9"]], "velocity (field)": [[78, "index-12"]], "process (base class)": [[79, "index-0"], [79, "index-0"]], "nxreflections": [[80, "index-0"]], "nxreflections (base class)": [[80, "index-0"]], "background_mean (field)": [[80, "index-75"]], "bounding_box (field)": [[80, "index-73"]], "d (field)": [[80, "index-21"]], "description (field attribute)": [[80, "index-10"], [80, "index-12"], [80, "index-14"], [80, "index-16"], [80, "index-18"], [80, "index-20"], [80, "index-22"], [80, "index-24"], [80, "index-26"], [80, "index-28"], [80, "index-30"], [80, "index-32"], [80, "index-34"], [80, "index-36"], [80, "index-38"], [80, "index-40"], [80, "index-42"], [80, "index-44"], [80, "index-46"], [80, "index-48"], [80, "index-50"], [80, "index-52"], [80, "index-54"], [80, "index-56"], [80, "index-58"], [80, "index-6"], [80, "index-60"], [80, "index-62"], [80, "index-64"], [80, "index-66"], [80, "index-68"], [80, "index-70"], [80, "index-72"], [80, "index-74"], [80, "index-76"], [80, "index-78"], [80, "index-8"], [80, "index-80"], [80, "index-82"], [80, "index-84"], [80, "index-86"], [80, "index-88"], [80, "index-90"], [80, "index-92"], [80, "index-94"], [80, "index-96"], [98, "index-5"], [99, "index-5"], [107, "index-66"]], "description (file attribute)": [[80, "index-1"]], "det_module (field)": [[80, "index-17"]], "entering (field)": [[80, "index-15"]], "experiments (field)": [[80, "index-4"]], "flags (field)": [[80, "index-19"]], "h (field)": [[80, "index-5"]], "id (field)": [[80, "index-11"]], "int_prf (field)": [[80, "index-77"]], "int_prf_errors (field)": [[80, "index-81"]], "int_prf_var (field)": [[80, "index-79"]], "int_sum (field)": [[80, "index-83"]], "int_sum_errors (field)": [[80, "index-87"]], "int_sum_var (field)": [[80, "index-85"]], "l (field)": [[80, "index-9"]], "lp (field)": [[80, "index-89"]], "observed_frame (field)": [[80, "index-37"]], "observed_frame_errors (field)": [[80, "index-41"]], "observed_frame_var (field)": [[80, "index-39"]], "observed_phi (field)": [[80, "index-55"]], "observed_phi_errors (field)": [[80, "index-59"]], "observed_phi_var (field)": [[80, "index-57"]], "observed_px_x (field)": [[80, "index-43"]], "observed_px_x_errors (field)": [[80, "index-47"]], "observed_px_x_var (field)": [[80, "index-45"]], "observed_px_y (field)": [[80, "index-49"]], "observed_px_y_errors (field)": [[80, "index-53"]], "observed_px_y_var (field)": [[80, "index-51"]], "observed_x (field)": [[80, "index-61"]], "observed_x_errors (field)": [[80, "index-65"]], "observed_x_var (field)": [[80, "index-63"]], "observed_y (field)": [[80, "index-67"]], "observed_y_errors (field)": [[80, "index-71"]], "observed_y_var (field)": [[80, "index-69"]], "overlaps (field)": [[80, "index-93"]], "partiality (field)": [[80, "index-23"]], "predicted_frame (field)": [[80, "index-25"]], "predicted_phi (field)": [[80, "index-31"]], "predicted_px_x (field)": [[80, "index-33"]], "predicted_px_y (field)": [[80, "index-35"]], "predicted_x (field)": [[80, "index-27"]], "predicted_y (field)": [[80, "index-29"]], "prf_cc (field)": [[80, "index-91"]], "reflection_id (field)": [[80, "index-13"]], "reflections (base class)": [[80, "index-0"], [80, "index-0"]], "hdf5_version (file attribute)": [[81, "index-8"], [107, "index-4"]], "hdf_version (file attribute)": [[81, "index-7"]], "nx_class (file attribute)": [[81, "index-2"]], "nxroot": [[81, "index-0"]], "nxroot (base class)": [[81, "index-0"], [116, "index-12"]], "nexus_version (file attribute)": [[81, "index-6"]], "xml_version (file attribute)": [[81, "index-9"]], "creator (file attribute)": [[81, "index-11"]], "creator_version (file attribute)": [[81, "index-12"]], "file_name (file attribute)": [[81, "index-4"]], "file_time (file attribute)": [[81, "index-3"]], "file_update_time (file attribute)": [[81, "index-5"]], "h5py_version (file attribute)": [[81, "index-10"], [107, "index-5"]], "root (base class)": [[81, "index-0"], [81, "index-0"]], "nxsample": [[82, "index-0"]], "nxsample_component (base class)": [[82, "index-1"], [83, "index-0"]], "changer_position (field)": [[82, "index-14"], [103, "index-94"], [104, "index-95"]], "component (field)": [[82, "index-29"]], "concentration (field)": [[82, "index-31"]], "direction (field attribute)": [[82, "index-10"], [82, "index-12"], [82, "index-8"]], "external_dac (field)": [[82, "index-40"]], "mass (field)": [[82, "index-22"], [83, "index-11"]], "path_length (field)": [[82, "index-37"]], "path_length_window (field)": [[82, "index-38"]], "point_group (field)": [[82, "index-36"], [83, "index-19"]], "relative_molecular_mass (field)": [[82, "index-24"], [83, "index-13"], [95, "index-7"]], "sample (base class)": [[82, "index-0"], [82, "index-0"]], "sample_component (field)": [[82, "index-30"]], "sample_orientation (field)": [[82, "index-19"], [83, "index-9"]], "scattering_length_density (field)": [[82, "index-33"], [83, "index-16"]], "short_title (field)": [[82, "index-41"]], "ub_matrix (field)": [[82, "index-21"]], "unit_cell_abc (field)": [[82, "index-15"], [83, "index-6"]], "unit_cell_alphabetagamma (field)": [[82, "index-16"], [83, "index-7"]], "unit_cell_class (field)": [[82, "index-34"], [83, "index-17"]], "volume_fraction (field)": [[82, "index-32"], [83, "index-15"]], "nxsample_component": [[83, "index-0"]], "sample_component (base class)": [[83, "index-0"], [83, "index-0"]], "nxsensor": [[84, "index-0"]], "attached_to (field)": [[84, "index-7"]], "external_field_brief (field)": [[84, "index-16"]], "high_trip_value (field)": [[84, "index-11"]], "low_trip_value (field)": [[84, "index-12"]], "measurement (field)": [[84, "index-8"]], "model (field)": [[84, "index-4"]], "run_control (field)": [[84, "index-10"]], "sensor (base class)": [[84, "index-0"], [84, "index-0"]], "value_deriv1 (field)": [[84, "index-14"]], "value_deriv2 (field)": [[84, "index-15"]], "nxshape": [[85, "index-0"]], "direction (field)": [[85, "index-5"]], "shape (base class)": [[85, "index-0"], [85, "index-0"]], "nxslit": [[86, "index-0"]], "nxslit (base class)": [[86, "index-0"]], "slit (base class)": [[86, "index-0"], [86, "index-0"]], "nxsource": [[87, "index-0"]], "bunch_distance (field)": [[87, "index-23"]], "bunch_length (field)": [[87, "index-22"]], "current (field)": [[87, "index-16"]], "emittance_x (field)": [[87, "index-10"]], "emittance_y (field)": [[87, "index-11"]], "last_fill (field)": [[87, "index-27"]], "number_of_bunches (field)": [[87, "index-21"]], "pulse_width (field)": [[87, "index-24"]], "sigma_x (field)": [[87, "index-12"]], "sigma_y (field)": [[87, "index-13"]], "source (base class)": [[87, "index-0"], [87, "index-0"]], "target_material (field)": [[87, "index-20"]], "top_up (field)": [[87, "index-26"]], "voltage (field)": [[87, "index-17"]], "nxsubentry": [[88, "index-0"], [110, "index-2"]], "mime_type (group attribute)": [[88, "index-28"]], "subentry (base class)": [[88, "index-0"], [88, "index-0"]], "axisname (field)": [[89, "index-3"]], "axisname_end (field)": [[89, "index-9"]], "axisname_increment_set (field)": [[89, "index-10"]], "nxtransformations": [[89, "index-0"]], "transformations (base class)": [[89, "index-0"], [89, "index-0"]], "nxtranslation": [[90, "index-0"]], "distances (field)": [[90, "index-4"]], "translation (base class)": [[90, "index-0"], [90, "index-0"]], "nxuser": [[91, "index-0"]], "orcid (field)": [[91, "index-11"]], "address (field)": [[91, "index-6"]], "affiliation (field)": [[91, "index-5"]], "email (field)": [[91, "index-9"]], "fax_number (field)": [[91, "index-8"]], "telephone_number (field)": [[91, "index-7"]], "user (base class)": [[91, "index-0"], [91, "index-0"]], "nxvelocity_selector": [[92, "index-0"]], "num (field)": [[92, "index-9"]], "spwidth (field)": [[92, "index-7"]], "table (field)": [[92, "index-11"]], "twist (field)": [[92, "index-10"]], "velocity_selector (base class)": [[92, "index-0"], [92, "index-0"]], "nxxraylens": [[93, "index-0"]], "aperture (field)": [[93, "index-11"]], "curvature (field)": [[93, "index-10"]], "cylindrical (field)": [[93, "index-6"]], "focus_type (field)": [[93, "index-7"]], "gas (field)": [[93, "index-14"]], "lens_geometry (field)": [[93, "index-4"]], "lens_length (field)": [[93, "index-9"]], "lens_material (field)": [[93, "index-13"]], "lens_thickness (field)": [[93, "index-8"]], "number_of_lenses (field)": [[93, "index-12"]], "symmetric (field)": [[93, "index-5"]], "xraylens (base class)": [[93, "index-0"], [93, "index-0"]], "base class": [[94, "index-0"]], "nxcontainer": [[95, "index-0"]], "nxcontainer (contributed definition)": [[95, "index-0"]], "container (contributed definition)": [[95, "index-0"], [95, "index-0"]], "packing_fraction (field)": [[95, "index-6"]], "used in contributed definition": [[95, "index-1"], [96, "index-1"], [97, "index-1"], [98, "index-1"], [99, "index-1"], [101, "index-1"], [102, "index-1"], [103, "index-1"], [104, "index-1"], [105, "index-1"], [106, "index-1"], [107, "index-1"], [108, "index-1"]], "nxcsg": [[96, "index-0"]], "nxcsg (base class)": [[96, "index-1"], [106, "index-1"]], "nxcsg (contributed definition)": [[96, "index-0"]], "csg (contributed definition)": [[96, "index-0"], [96, "index-0"]], "geometry (field)": [[96, "index-3"]], "operation (field)": [[96, "index-2"]], "nxcxi_ptycho": [[97, "index-0"]], "nxcxi_ptycho (contributed definition)": [[97, "index-0"]], "cxi_ptycho (contributed definition)": [[97, "index-0"], [97, "index-0"]], "incident_beam_energy (field)": [[97, "index-16"]], "incident_energy_spread (field)": [[97, "index-18"]], "interpretation (field attribute)": [[97, "index-25"]], "transformations (field)": [[97, "index-44"]], "translation (field)": [[97, "index-22"]], "vector (field)": [[97, "index-37"]], "x_indices (field)": [[97, "index-41"]], "y_indices (field)": [[97, "index-42"]], "nxelectrostatic_kicker": [[98, "index-0"]], "nxelectrostatic_kicker (contributed definition)": [[98, "index-0"]], "beamline_distance (field)": [[98, "index-3"], [99, "index-3"], [101, "index-3"], [102, "index-3"], [105, "index-3"], [108, "index-3"]], "electrostatic_kicker (contributed definition)": [[98, "index-0"], [98, "index-0"]], "set_current (field)": [[98, "index-6"], [99, "index-6"], [101, "index-4"], [105, "index-4"]], "set_voltage (field)": [[98, "index-7"], [99, "index-7"]], "timing (field)": [[98, "index-4"], [99, "index-4"]], "nxmagnetic_kicker": [[99, "index-0"]], "nxmagnetic_kicker (contributed definition)": [[99, "index-0"]], "magnetic_kicker (contributed definition)": [[99, "index-0"], [99, "index-0"]], "nxquadric": [[100, "index-0"]], "nxquadric (contributed definition)": [[100, "index-0"]], "parameters (field)": [[100, "index-1"]], "quadric (contributed definition)": [[100, "index-0"], [100, "index-0"]], "surface_type (field)": [[100, "index-2"]], "nxquadrupole_magnet": [[101, "index-0"]], "nxquadrupole_magnet (contributed definition)": [[101, "index-0"]], "quadrupole_magnet (contributed definition)": [[101, "index-0"], [101, "index-0"]], "nxseparator": [[102, "index-0"]], "nxseparator (contributed definition)": [[102, "index-0"]], "separator (contributed definition)": [[102, "index-0"], [102, "index-0"]], "set_bfield_current (field)": [[102, "index-4"], [108, "index-4"]], "set_efield_voltage (field)": [[102, "index-5"], [108, "index-5"]], "nxsnsevent": [[103, "index-0"]], "nxsnsevent (contributed definition)": [[103, "index-0"]], "snsbanking_file_name (field)": [[103, "index-37"], [104, "index-37"]], "snsdetector_calibration_id (field)": [[103, "index-44"], [104, "index-44"]], "snsgeometry_file_name (field)": [[103, "index-45"], [104, "index-45"]], "snsmapping_file_name (field)": [[103, "index-38"], [104, "index-38"]], "snstranslation_service (field)": [[103, "index-46"], [104, "index-46"]], "beamline (field)": [[103, "index-47"], [104, "index-47"]], "collection_title (field)": [[103, "index-3"], [104, "index-3"]], "command1 (field)": [[103, "index-40"], [104, "index-40"]], "data_x_y (field)": [[103, "index-54"], [104, "index-56"]], "event_pixel_id (field)": [[103, "index-57"]], "event_time_of_flight (field)": [[103, "index-58"]], "holder (field)": [[103, "index-95"], [104, "index-96"]], "identifier (field)": [[103, "index-96"], [104, "index-97"]], "notes (field)": [[103, "index-9"], [104, "index-9"]], "pixel_id (field)": [[103, "index-59"], [104, "index-59"]], "proton_charge (field)": [[103, "index-10"], [104, "index-10"]], "pulse_time (field)": [[103, "index-61"]], "raw_frames (field)": [[103, "index-11"], [104, "index-11"]], "snsevent (contributed definition)": [[103, "index-0"], [103, "index-0"]], "total_counts (field)": [[103, "index-15"], [103, "index-62"], [104, "index-15"], [104, "index-62"]], "total_uncounted_counts (field)": [[103, "index-16"], [104, "index-16"]], "nxsnshisto": [[104, "index-0"]], "nxsnshisto (contributed definition)": [[104, "index-0"]], "data_x_time_of_flight (field)": [[104, "index-55"]], "data_y_time_of_flight (field)": [[104, "index-57"]], "snshisto (contributed definition)": [[104, "index-0"], [104, "index-0"]], "nxsolenoid_magnet": [[105, "index-0"]], "nxsolenoid_magnet (contributed definition)": [[105, "index-0"]], "solenoid_magnet (contributed definition)": [[105, "index-0"], [105, "index-0"]], "nxquadric (base class)": [[106, "index-1"]], "nxsolid_geometry": [[106, "index-0"]], "nxsolid_geometry (contributed definition)": [[106, "index-0"]], "solid_geometry (contributed definition)": [[106, "index-0"], [106, "index-0"]], "axisname_indices (group attribute)": [[107, "index-32"]], "degc_sp (field)": [[107, "index-22"]], "g0 (field)": [[107, "index-48"]], "g1 (field)": [[107, "index-49"]], "g2 (field)": [[107, "index-50"]], "g4 (field)": [[107, "index-51"]], "nxspecdata": [[107, "index-0"]], "nxspecdata (contributed definition)": [[107, "index-0"]], "spec_comments (file attribute)": [[107, "index-9"]], "spec_date (file attribute)": [[107, "index-7"]], "spec_epoch (file attribute)": [[107, "index-8"]], "spec_file (file attribute)": [[107, "index-6"]], "spec_num_headers (file attribute)": [[107, "index-10"]], "spec_user (field)": [[107, "index-70"]], "temp_sp (field)": [[107, "index-21"]], "_mca1_ (field)": [[107, "index-39"]], "_mca1_channel_ (field)": [[107, "index-40"]], "_mca_ (field)": [[107, "index-37"]], "_mca_channel_ (field)": [[107, "index-38"]], "calib_a (field)": [[107, "index-62"]], "calib_b (field)": [[107, "index-63"]], "calib_c (field)": [[107, "index-64"]], "command (field)": [[107, "index-17"]], "comment (group attribute)": [[107, "index-41"], [107, "index-43"], [107, "index-46"], [107, "index-71"]], "comments (field)": [[107, "index-19"]], "description (group attribute)": [[107, "index-23"], [107, "index-29"], [107, "index-42"], [107, "index-44"], [107, "index-47"], [107, "index-52"], [107, "index-54"], [107, "index-69"], [107, "index-72"]], "elapsed_live_time (field)": [[107, "index-56"]], "elapsed_real_time (field)": [[107, "index-57"]], "first_channel (field attribute)": [[107, "index-67"]], "first_saved (field)": [[107, "index-59"]], "intensity_factor (field)": [[107, "index-36"]], "last_channel (field attribute)": [[107, "index-68"]], "last_saved (field)": [[107, "index-60"]], "number_saved (field)": [[107, "index-58"]], "positioner (field)": [[107, "index-53"]], "preset_time (field)": [[107, "index-55"]], "reduction_coef (field)": [[107, "index-61"]], "roin (field)": [[107, "index-65"]], "scan_number (field)": [[107, "index-15"]], "spec_name (field attribute)": [[107, "index-34"]], "specdata (contributed definition)": [[107, "index-0"], [107, "index-0"]], "nxspin_rotator": [[108, "index-0"]], "nxspin_rotator (contributed definition)": [[108, "index-0"]], "spin_rotator (contributed definition)": [[108, "index-0"], [108, "index-0"]], "contributed definition": [[109, "index-0"], [112, "index-3"]], "multi-modal data": [[110, "index-2"]], "subentry": [[110, "index-2"]], "use of": [[110, "index-2"]], "sphinx (documentation generator)": [[111, "index-0"]], "manual source": [[111, "index-1"]], "niac": [[112, "index-1"], [130, "index-2"], [133, "index-18"], [144, "index-0"], [144, "index-0"]], "nexus webpage": [[112, "index-2"]], "community": [[112, "index-0"]], "webpage": [[112, "index-2"]], "fdl": [[113, "index-1"]], "lgpl": [[113, "index-2"]], "copyright": [[113, "index-0"]], "license": [[113, "index-0"]], "bluesky_": [[114, "index-5"]], "hdf5": [[114, "index-3"], [119, "index-0"], [130, "index-4"]], "idf_": [[114, "index-5"]], "ndattr": [[114, "index-5"]], "nx": [[114, "index-0"], [114, "index-5"], [116, "index-18"]], "nx_": [[114, "index-5"]], "nxclass": [[114, "index-0"]], "nxclass (attribute)": [[114, "index-0"]], "pdbx_": [[114, "index-5"]], "sas_": [[114, "index-5"]], "silx_": [[114, "index-5"]], "udunits": [[114, "index-24"], [114, "index-26"]], "utf-8": [[114, "index-16"], [146, "index-6"]], "unidata udunits": [[114, "index-24"]], "arrays": [[114, "index-19"]], "attribute": [[114, "index-0"], [115, "index-7"], [116, "index-12"], [116, "index-5"], [128, "index-2"], [147, "index-0"]], "axis": [[114, "index-40"]], "binary data": [[114, "index-20"], [146, "index-1"]], "data": [[114, "index-34"]], "date and time": [[114, "index-14"], [114, "index-22"], [114, "index-23"]], "dimension scale": [[114, "index-30"], [114, "index-31"], [114, "index-32"], [116, "index-24"]], "dimension scales": [[114, "index-35"], [114, "index-37"], [114, "index-39"], [114, "index-43"], [114, "index-45"]], "end": [[114, "index-7"]], "enumeration": [[114, "index-25"]], "errors": [[114, "index-7"]], "fixed-length": [[114, "index-18"]], "floating-point numbers": [[114, "index-13"], [114, "index-13"]], "how to find data": [[114, "index-28"]], "images": [[114, "index-21"]], "increment_set": [[114, "index-7"]], "indices": [[114, "index-7"]], "integers": [[114, "index-12"], [114, "index-12"]], "mask": [[114, "index-7"]], "monitor": [[114, "index-27"]], "multi-dimensional": [[114, "index-34"]], "multi-dimensional data": [[114, "index-34"]], "naming": [[114, "index-1"], [115, "index-6"], [116, "index-21"], [151, "index-1"]], "naming convention": [[114, "index-0"]], "numbers": [[114, "index-12"], [114, "index-13"]], "regular expression": [[114, "index-2"]], "reserved prefixes": [[114, "index-4"], [114, "index-5"]], "reserved suffixes": [[114, "index-6"], [114, "index-7"]], "rules": [[114, "index-1"], [114, "index-3"], [115, "index-4"], [115, "index-5"], [115, "index-6"], [116, "index-19"], [116, "index-21"], [116, "index-3"], [133, "index-1"], [151, "index-0"], [151, "index-1"]], "set": [[114, "index-7"]], "signal data": [[114, "index-29"], [116, "index-10"]], "storage order": [[114, "index-11"], [114, "index-8"]], "strings": [[114, "index-15"], [114, "index-17"], [114, "index-18"], [114, "index-19"]], "units": [[114, "index-24"], [115, "index-9"], [116, "index-6"], [116, "index-8"], [134, "index-7"]], "used as nx class prefix": [[114, "index-0"], [116, "index-18"]], "variable-length": [[114, "index-17"]], "weights": [[114, "index-7"]], "hdf": [[115, "index-4"], [116, "index-3"], [128, "index-1"], [128, "index-2"], [154, "index-29"]], "nxdl": [[115, "index-0"], [116, "index-20"], [127, "index-2"], [145, "index-0"], [145, "index-0"], [145, "index-1"]], "xml": [[115, "index-5"], [130, "index-1"]], "choice": [[115, "index-10"]], "flexible name": [[115, "index-8"]], "release": [[115, "index-1"], [115, "index-2"], [132, "index-10"], [132, "index-6"], [132, "index-7"], [132, "index-8"], [132, "index-9"]], "tags": [[115, "index-2"], [115, "index-3"], [132, "index-10"], [132, "index-11"]], "versioning": [[115, "index-1"], [132, "index-9"]], "cif": [[116, "index-38"], [116, "index-42"]], "iucr": [[116, "index-27"], [116, "index-28"]], "mcstas": [[116, "index-27"], [116, "index-41"], [116, "index-43"], [116, "index-44"], [116, "index-45"]], "nx prefix": [[116, "index-19"]], "nexus": [[116, "index-26"], [151, "index-0"]], "nexus link": [[116, "index-14"], [116, "index-14"], [116, "index-17"]], "nexus polar coordinate": [[116, "index-40"]], "sds (scientific data sets)": [[116, "index-4"]], "scientific data sets": [[116, "index-4"]], "address, absolute": [[116, "index-14"]], "address, relative": [[116, "index-14"]], "attributes": [[116, "index-12"]], "automatic plotting": [[116, "index-24"]], "class path": [[116, "index-15"]], "coordinate systems": [[116, "index-26"], [116, "index-27"], [116, "index-28"], [116, "index-30"], [116, "index-39"], [116, "index-40"], [116, "index-41"], [116, "index-42"], [116, "index-43"], [116, "index-44"], [116, "index-45"]], "data field": [[116, "index-4"]], "data group": [[116, "index-1"]], "data item": [[116, "index-4"]], "data object": [[116, "index-4"]], "data set": [[116, "index-4"]], "dataset": [[116, "index-4"]], "default plot": [[116, "index-24"]], "depends on (field attribute)": [[116, "index-35"], [116, "index-35"]], "direction": [[116, "index-33"]], "external file": [[116, "index-16"], [116, "index-17"]], "field": [[116, "index-4"], [116, "index-4"], [128, "index-2"], [133, "index-5"]], "field attribute": [[116, "index-5"], [116, "index-5"], [133, "index-6"], [134, "index-6"]], "file attribute": [[116, "index-12"], [116, "index-12"]], "folder": [[116, "index-1"]], "geometry": [[116, "index-27"], [116, "index-43"], [116, "index-45"]], "group": [[116, "index-1"], [116, "index-1"], [128, "index-2"], [133, "index-4"]], "group attribute": [[116, "index-5"], [116, "index-5"], [133, "index-6"]], "link target (internal attribute)": [[116, "index-13"]], "link, target, attribute": [[116, "index-14"]], "motivation": [[116, "index-24"], [133, "index-0"], [137, "index-0"], [137, "index-0"]], "order (transformation)": [[116, "index-35"]], "rotation": [[116, "index-32"]], "spherical polar": [[116, "index-45"]], "target, attribute": [[116, "index-14"]], "transformation matrices": [[116, "index-29"]], "transformation type (field attribute)": [[116, "index-32"]], "transformations": [[116, "index-30"]], "translation": [[116, "index-32"]], "value (transformation matrix)": [[116, "index-31"]], "napi": [[118, "index-0"], [127, "index-5"], [128, "index-0"], [130, "index-6"], [132, "index-0"], [132, "index-1"], [132, "index-2"], [132, "index-3"], [132, "index-4"], [132, "index-5"], [133, "index-2"], [134, "index-0"], [134, "index-1"], [134, "index-3"], [138, "index-0"], [138, "index-0"], [138, "index-1"], [139, "index-0"], [140, "index-0"], [141, "index-0"], [142, "index-0"], [143, "index-0"], [154, "index-8"]], "examples": [[118, "index-0"], [119, "index-0"], [120, "index-0"], [126, "index-0"], [133, "index-15"], [133, "index-9"]], "epics": [[120, "index-0"]], "ndattribute": [[120, "index-1"]], "nexpy": [[121, "index-2"], [133, "index-16"]], "h5py": [[121, "index-0"], [121, "index-1"]], "matlab": [[126, "index-0"], [154, "index-24"]], "faq": [[127, "index-0"]], "constitution": [[127, "index-3"], [144, "index-1"]], "contribute": [[127, "index-1"]], "bypassing": [[128, "index-0"]], "file format": [[128, "index-0"], [128, "index-1"]], "low-level file format": [[128, "index-0"]], "physical file format": [[128, "index-0"]], "git": [[129, "index-1"]], "repository": [[129, "index-0"], [132, "index-1"]], "hdf4": [[130, "index-5"]], "klosowski, przemys\u0142aw": [[130, "index-7"], [137, "index-4"]], "k\u00f6nnecke, mark": [[130, "index-10"], [137, "index-1"]], "osborn, raymond": [[130, "index-8"]], "riedel, richard": [[130, "index-3"]], "tischler, jonathan": [[130, "index-9"], [137, "index-2"]], "mac os x": [[132, "index-4"]], "microsoft windows": [[132, "index-3"]], "napi installation": [[132, "index-0"], [132, "index-1"], [132, "index-2"], [132, "index-3"], [132, "index-4"], [132, "index-5"]], "nexus definitions": [[132, "index-6"]], "rpm": [[132, "index-2"]], "windows": [[132, "index-3"]], "binary executable": [[132, "index-0"]], "download location": [[132, "index-1"]], "installation": [[132, "index-0"], [132, "index-0"]], "installation; mac os x": [[132, "index-4"]], "installation; rpm": [[132, "index-2"]], "installation; windows": [[132, "index-3"]], "installation; download location": [[132, "index-1"]], "installation; source distribution": [[132, "index-5"]], "notes": [[132, "index-7"]], "precompiled executable": [[132, "index-0"]], "process": [[132, "index-8"]], "source distribution": [[132, "index-5"]], "nexus file": [[133, "index-9"]], "nexus file; minimal": [[133, "index-15"]], "design principles": [[133, "index-3"]], "instrument definitions": [[133, "index-17"]], "introduction": [[133, "index-0"]], "tree structure": [[133, "index-9"]], "api": [[134, "index-0"], [154, "index-32"], [154, "index-33"], [154, "index-34"], [154, "index-35"], [154, "index-36"], [154, "index-37"], [154, "index-38"], [154, "index-39"], [154, "index-40"], [154, "index-41"], [154, "index-42"], [154, "index-43"]], "browser": [[134, "index-9"], [154, "index-3"]], "file": [[134, "index-0"], [154, "index-13"], [154, "index-14"]], "nxbrowse": [[134, "index-10"]], "read and write": [[134, "index-0"]], "read file": [[134, "index-8"]], "write file": [[134, "index-2"]], "issue reporting": [[135, "index-0"]], "mailing lists": [[136, "index-0"]], "nelson, mitchell": [[137, "index-3"]], "dictionary of terms": [[137, "index-0"], [137, "index-7"]], "exchange format": [[137, "index-0"]], "format unification": [[137, "index-0"], [137, "index-6"]], "lexicography": [[137, "index-7"]], "why nexus?": [[137, "index-0"]], "nexus application programming interface": [[138, "index-0"]], "core": [[138, "index-1"]], "c": [[139, "index-0"]], "c++": [[139, "index-0"]], "f77": [[140, "index-0"]], "f90": [[141, "index-0"]], "idl": [[142, "index-0"]], "java": [[143, "index-0"]], "nexus international advisory committee": [[144, "index-0"]], "nexus definition language": [[145, "index-0"]], "iso8601 (data type)": [[146, "index-2"]], "nx_angle (units type)": [[146, "index-14"]], "nx_any (units type)": [[146, "index-15"]], "nx_area (units type)": [[146, "index-16"]], "nx_binary": [[146, "index-1"]], "nx_binary (data type)": [[146, "index-3"]], "nx_boolean (data type)": [[146, "index-4"]], "nx_char (data type)": [[146, "index-5"]], "nx_charge (units type)": [[146, "index-17"]], "nx_cross_section (units type)": [[146, "index-18"]], "nx_current (units type)": [[146, "index-19"]], "nx_date_time (data type)": [[146, "index-7"]], "nx_dimensionless (units type)": [[146, "index-20"]], "nx_emittance (units type)": [[146, "index-21"]], "nx_energy (units type)": [[146, "index-22"]], "nx_float (data type)": [[146, "index-8"]], "nx_flux (units type)": [[146, "index-23"]], "nx_frequency (units type)": [[146, "index-24"]], "nx_int (data type)": [[146, "index-9"]], "nx_length (units type)": [[146, "index-25"]], "nx_mass (units type)": [[146, "index-26"]], "nx_mass_density (units type)": [[146, "index-27"]], "nx_molecular_weight (units type)": [[146, "index-28"]], "nx_number (data type)": [[146, "index-10"]], "nx_period (units type)": [[146, "index-29"]], "nx_per_area (units type)": [[146, "index-30"]], "nx_per_length (units type)": [[146, "index-31"]], "nx_posint (data type)": [[146, "index-11"]], "nx_power (units type)": [[146, "index-32"]], "nx_pressure (units type)": [[146, "index-33"]], "nx_pulses (units type)": [[146, "index-34"]], "nx_scattering_length_density (units type)": [[146, "index-35"]], "nx_solid_angle (units type)": [[146, "index-36"]], "nx_temperature (units type)": [[146, "index-37"]], "nx_time (units type)": [[146, "index-38"]], "nx_time_of_flight (units type)": [[146, "index-39"]], "nx_transformation (units type)": [[146, "index-40"]], "nx_uint (data type)": [[146, "index-12"]], "nx_unitless (units type)": [[146, "index-41"]], "nx_voltage (units type)": [[146, "index-42"]], "nx_volume (units type)": [[146, "index-43"]], "nx_wavelength (units type)": [[146, "index-44"]], "nx_wavenumber (units type)": [[146, "index-45"]], "data type": [[146, "index-0"], [146, "index-0"]], "type": [[146, "index-0"]], "unit category": [[146, "index-13"]], "nxdl attribute": [[147, "index-0"]], "nxdl elements": [[147, "index-0"]], "attribute (nxdl element)": [[147, "index-1"]], "attributetype (nxdl data type)": [[147, "index-12"]], "basiccomponent (nxdl data type)": [[147, "index-24"]], "choice (nxdl element)": [[147, "index-2"]], "choicetype (nxdl data type)": [[147, "index-20"]], "definition (nxdl data type)": [[147, "index-13"]], "definitiontype (nxdl data type)": [[147, "index-14"]], "definitiontypeattr (nxdl data type)": [[147, "index-15"]], "dimensionstype (nxdl data type)": [[147, "index-16"]], "doctype (nxdl data type)": [[147, "index-17"]], "enumeration (nxdl element)": [[147, "index-6"]], "enumerationtype (nxdl data type)": [[147, "index-18"]], "fieldtype (nxdl data type)": [[147, "index-19"]], "grouptype (nxdl data type)": [[147, "index-21"]], "link (nxdl element)": [[147, "index-9"]], "link target": [[147, "index-10"]], "linktype (nxdl data type)": [[147, "index-22"]], "nonnegativeunbounded (nxdl data type)": [[147, "index-28"]], "symbols (nxdl element)": [[147, "index-11"]], "symbolstype (nxdl data type)": [[147, "index-23"]], "validitemname (nxdl data type)": [[147, "index-25"]], "validnxclassname (nxdl data type)": [[147, "index-26"]], "validtargetname (nxdl data type)": [[147, "index-27"]], "revision history": [[150, "index-0"]], "simplest case(s)": [[152, "index-1"]], "strategies": [[152, "index-0"], [152, "index-1"]], "dave (data analysis software)": [[154, "index-15"]], "dawn (data analysis software)": [[154, "index-16"]], "f77; poldi": [[154, "index-32"]], "gda (data acquisition software)": [[154, "index-17"]], "gumtree (data analysis software)": [[154, "index-18"]], "hdfexplorer": [[154, "index-30"]], "hdfview": [[154, "index-31"]], "idl (data analysis software)": [[154, "index-19"]], "idl; axis2000": [[154, "index-33"]], "igor pro (data analysis software)": [[154, "index-20"]], "isaw (data analysis software)": [[154, "index-21"]], "igorpro; hdf5gateway": [[154, "index-34"]], "lamp (data analysis software)": [[154, "index-22"]], "mantid (data analysis software)": [[154, "index-23"]], "nxplot (utility)": [[154, "index-11"]], "nexpy (data analysis software)": [[154, "index-25"]], "opengenie (data analysis software)": [[154, "index-26"]], "pymca (data analysis software)": [[154, "index-27"]], "python; dials": [[154, "index-37"]], "python; mantis": [[154, "index-39"]], "python; sasview": [[154, "index-41"]], "python; h5py": [[154, "index-38"]], "python; nexusformat": [[154, "index-40"]], "cnxvalidate (utility)": [[154, "index-13"]], "conversion": [[154, "index-4"]], "data analysis software": [[154, "index-12"]], "ingestion": [[154, "index-6"]], "inspection": [[154, "index-5"]], "java; dawn": [[154, "index-35"]], "java; nxreader.zip": [[154, "index-36"]], "mixed; focus": [[154, "index-42"]], "mixed; zebra": [[154, "index-43"]], "nxbrowse (utility)": [[154, "index-3"]], "nxconvert (utility)": [[154, "index-4"]], "nxdir (utility)": [[154, "index-5"]], "nxingest (utility)": [[154, "index-6"]], "nxsummary": [[154, "index-9"]], "nxtranslate (utility)": [[154, "index-10"]], "programs": [[154, "index-1"]], "punx (utility)": [[154, "index-14"]], "software": [[154, "index-12"], [154, "index-2"]], "spec2nexus": [[154, "index-28"]], "tools": [[154, "index-29"]], "utilities": [[154, "index-0"]], "validate": [[154, "index-13"], [154, "index-14"]], "validation": [[154, "index-13"], [154, "index-14"], [155, "index-0"]], "nxvalidate": [[155, "index-2"]], "verification": [[155, "index-0"]]}}) \ No newline at end of file diff --git a/tests/json/test_transformation_reader.py b/tests/json/test_transformation_reader.py index c4b9d6847..ea3d033e3 100644 --- a/tests/json/test_transformation_reader.py +++ b/tests/json/test_transformation_reader.py @@ -332,6 +332,14 @@ def test_GIVEN_all_information_present_WHEN_attempting_to_create_translation_THE 2.0, 3.0, ] + transformation_json["children"][0]["attributes"][2]["offset"] = offset_vector = [ + 4.0, + 5.0, + 6.0, + ] + transformation_json["children"][0]["attributes"][2][ + "offset_units" + ] = offset_units = "mm" depends_on = None values = _create_transformation_dataset(angle_or_magnitude, "double", name) @@ -345,6 +353,8 @@ def test_GIVEN_all_information_present_WHEN_attempting_to_create_translation_THE vector=QVector3D(*vector), depends_on=depends_on, values=values, + offset_vector=QVector3D(*offset_vector), + offset_units=offset_units, ) diff --git a/tests/model/test_transformations.py b/tests/model/test_transformations.py index 3c62e5a00..c3b7fc542 100644 --- a/tests/model/test_transformations.py +++ b/tests/model/test_transformations.py @@ -16,10 +16,11 @@ def create_transform( name="test translation", ui_value=42.0, - vector=QVector3D(1.0, 0.0, 0.0), + vector=None, type="translation", values=Dataset(parent_node=None, name="", values=None, type=ValueTypes.DOUBLE), units="m", + offset_vector=None, ): translation = Transformation( name=name, @@ -29,7 +30,10 @@ def create_transform( parent_component=None, ) - translation.vector = vector + translation.vector = vector if vector is not None else QVector3D(1.0, 0.0, 0.0) + translation.offset_vector = ( + offset_vector if offset_vector is not None else QVector3D(0.0, 0.0, 0.0) + ) translation.transform_type = type translation.ui_value = ui_value translation.units = units diff --git a/ui/transformation.py b/ui/transformation.py index ce0b37b4e..f5b6ae533 100644 --- a/ui/transformation.py +++ b/ui/transformation.py @@ -1,4 +1,5 @@ from typing import TYPE_CHECKING +from functools import partial from PySide6.QtCore import QMetaObject, QSize from PySide6.QtGui import QFont @@ -11,9 +12,14 @@ QLabel, QLineEdit, QVBoxLayout, + QSizePolicy ) +from nexus_constructor.common_attrs import CommonAttrs from nexus_constructor.field_widget import FieldWidget +from nexus_constructor.ui_utils import validate_line_edit +from nexus_constructor.validators import UnitValidator +from nexus_constructor.unit_utils import METRES if TYPE_CHECKING: from nexus_constructor.transformation_view import EditTransformation @@ -49,22 +55,18 @@ def setup_ui(self, transformation): hide_name_field=True, show_only_f142_stream=True, ) + self.magnitude_widget.field_type_combo.setMaximumWidth(0) + self.magnitude_widget.value_type_combo.setMaximumWidth(0) + self.magnitude_widget.attrs_button.setMaximumWidth(0) self.magnitude_widget.setFrameShape(QFrame.NoFrame) self.magnitude_widget.setMinimumHeight(40) self.ui_placeholder_layout = QVBoxLayout() - self.offset_box = QDoubleSpinBox(transformation) - self.offset_box.setToolTip("Offset to the transformation.") - self.offset_box.setMinimumWidth(100) - self.offset_box.setMinimum(-1000) - self.offset_box.setDecimals(5) offset_font = QFont() offset_font.setBold(True) self.offset_label = QLabel("Offset") self.offset_label.setFont(offset_font) - self.ui_placeholder_layout.addWidget(self.offset_label) - self.ui_placeholder_layout.addWidget(self.offset_box) self.depends_on_text_box = QLineEdit(transformation) self.depends_on_text_box.setToolTip("depends_on for transformation.") @@ -79,6 +81,7 @@ def setup_ui(self, transformation): self.setup_name_layout() self.setup_vector_layout(transformation) + self.setup_offset_layout(transformation) self.setup_value_and_magnitude() self.set_spinbox_ranges() @@ -97,6 +100,30 @@ def setup_vector_layout(self, transformation): self._set_up_vector_box(transformation) self._add_line() + def setup_offset_layout(self, transformation): + self.main_layout.addWidget(self.offset_label) + self._set_up_vector_box_offset(transformation) + self.offset_units_line_edit = QLineEdit() + self.offset_unit_validator = UnitValidator(expected_dimensionality=METRES) + self.offset_units_line_edit.setValidator(self.offset_unit_validator) + self.offset_units_line_edit.setMinimumWidth(20) + offset_unit_size_policy = QSizePolicy() + offset_unit_size_policy.setHorizontalPolicy(QSizePolicy.Preferred) + offset_unit_size_policy.setHorizontalStretch(1) + self.offset_units_line_edit.setSizePolicy(offset_unit_size_policy) + if self.offset_units: + self.offset_units_line_edit.setText( + self.offset_units + ) + else: + self.offset_units_line_edit.setText("m") + self.offset_unit_validator.is_valid.connect( + partial(validate_line_edit, self.offset_units_line_edit) + ) + self.offset_units_line_edit.setPlaceholderText(CommonAttrs.OFFSET_UNITS) + self.main_layout.addWidget(self.offset_units_line_edit) + self._add_line() + def setup_name_layout(self): self.name_layout.addWidget(self.name_label) self.name_layout.addWidget(self.name_line_edit) @@ -123,6 +150,26 @@ def _set_up_vector_box(self, transformation): self.main_layout.addLayout(self.xyz_layout) + def _set_up_vector_box_offset(self, transformation): + self.xyz_layout_offset = QHBoxLayout() + + self.x_layout_offset = QFormLayout() + self.x_spinbox_offset = QDoubleSpinBox(transformation) + self.x_layout_offset.addRow("x:", self.x_spinbox_offset) + self.xyz_layout_offset.addLayout(self.x_layout_offset) + + self.y_layout_offset = QFormLayout() + self.y_spinbox_offset = QDoubleSpinBox(transformation) + self.y_layout_offset.addRow("y:", self.y_spinbox_offset) + self.xyz_layout_offset.addLayout(self.y_layout_offset) + + self.z_layout_offset = QFormLayout() + self.z_spinbox_offset = QDoubleSpinBox(transformation) + self.z_layout_offset.addRow("z:", self.z_spinbox_offset) + self.xyz_layout_offset.addLayout(self.z_layout_offset) + + self.main_layout.addLayout(self.xyz_layout_offset) + def _add_line(self): line = QFrame() line.setFrameShape(QFrame.HLine) @@ -133,12 +180,25 @@ def set_spinbox_ranges(self): self.spinboxes = [ self.x_spinbox, self.y_spinbox, - self.z_spinbox, + self.z_spinbox + ] + self.offset_spinboxes = [ + self.x_spinbox_offset, + self.y_spinbox_offset, + self.z_spinbox_offset, ] - for spinbox in self.spinboxes: + for spinbox in self.spinboxes + self.offset_spinboxes: spinbox.setRange(-10000000, 10000000) spinbox.setDecimals(5) + @property + def offset_units(self) -> str: + return self.offset_units_line_edit.text() + + @offset_units.setter + def offset_units(self, new_units: str): + self.offset_units_line_edit.setText(new_units) + @staticmethod def _make_text_bold(label: QLabel): font = label.font() diff --git a/ui_tests/test_ui_transformation_view.py b/ui_tests/test_ui_transformation_view.py index 71b535c23..89b645b85 100644 --- a/ui_tests/test_ui_transformation_view.py +++ b/ui_tests/test_ui_transformation_view.py @@ -12,6 +12,7 @@ from nexus_constructor.model.module import Dataset, F142Stream, Link from nexus_constructor.transformation_view import EditRotation, EditTranslation from nexus_constructor.validators import FieldType +from nexus_constructor.ui_utils import qvector3d_to_numpy_array @pytest.fixture @@ -63,8 +64,8 @@ def test_UI_GIVEN_scalar_angle_WHEN_creating_rotation_view_THEN_ui_is_filled_cor qtbot, model, component ): x = 1 - y = 2 - z = 3 + y = 0 + z = 0 angle = 90 transform = component.add_rotation(angle=angle, axis=QVector3D(x, y, z)) @@ -93,11 +94,10 @@ def test_UI_GIVEN_a_translation_with_zero_offset_WHEN_setting_the_offset_to_nonz view = EditTranslation(parent=None, transformation=transform, model=model) qtbot.addWidget(view) - view.transformation_frame.offset_box.setValue(9) + view.transformation_frame.offset_spinboxes[0].setValue(9) view.save_offset() - - assert transform.attributes.get_attribute_value(CommonAttrs.OFFSET) == 9 - assert view.transformation_frame.offset_box.value() == 9 + assert all(transform.attributes.get_attribute_value(CommonAttrs.OFFSET) == qvector3d_to_numpy_array(QVector3D(9, 0, 0))) + assert view.transformation_frame.offset_spinboxes[0].value() == 9 def test_UI_GIVEN_a_translation_with_nonzero_offset_WHEN_setting_the_offset_to_zero_THEN_ui_is_filled_correctly( @@ -106,15 +106,14 @@ def test_UI_GIVEN_a_translation_with_nonzero_offset_WHEN_setting_the_offset_to_z transform = component.add_translation(QVector3D(0, 0, 1), name="test") transform.values = create_corresponding_value_dataset(123) view = EditTranslation(parent=None, transformation=transform, model=model) - view.transformation_frame.offset_box.setValue(10) + view.transformation_frame.offset_spinboxes[0].setValue(10) qtbot.addWidget(view) view.save_offset() - view.transformation_frame.offset_box.setValue(0) + view.transformation_frame.offset_spinboxes[0].setValue(0) view.save_offset() - assert transform.attributes.get_attribute_value(CommonAttrs.OFFSET) == 0 - assert view.transformation_frame.offset_box.value() == 0 + assert view.transformation_frame.offset_spinboxes[0].value() == 0 def test_UI_GIVEN_array_dataset_as_magnitude_WHEN_creating_translation_THEN_ui_is_filled_correctly(